F420332

General Info

Members Datasets Scaffolds Average Seq Length
355 166 710 146

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023250|2524610580
Length 145
Sequence PNATLLKFGYPHSVVAETPFWTIQVRPQQPTLGSLVLVCREPVTAFGQVSPAAFAALQPVVTRLEAVLRRFVDYQKINYLMLMMVDPDVHFHVIPRYQGERDFQGTVFTDAGWPGPPNLGAAVPLDAAAMAEMTALLKRLWDEVA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
150 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
151 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
152 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
158 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
159 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
166 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 4.79
Rhizosphere 93.24
Stem 0
Stem Tuber 0.28
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10009905 3300001989 Bacteria 3543
2 Ga0070658_10010050 3300005327 Bacteria 7601
3 Ga0070658_10024019 3300005327 Bacteria 4892
4 Ga0070658_10250813 3300005327 Bacteria 1502
5 Ga0070670_100931086 3300005331 Bacteria 789
6 Ga0068869_100394638 3300005334 Bacteria 1137
7 Ga0068869_100482103 3300005334 Bacteria 1033
8 Ga0070666_10235013 3300005335 Bacteria 1295
9 Ga0070660_100003988 3300005339 Bacteria 10199
10 Ga0070660_100234817 3300005339 Bacteria 1492
11 Ga0070660_101245774 3300005339 Bacteria 631
12 Ga0070661_100482110 3300005344 Bacteria 990
13 Ga0070661_101296682 3300005344 Bacteria 611
14 Ga0070668_100000910 3300005347 Bacteria 20612
15 Ga0070668_100118440 3300005347 Bacteria 2114
16 Ga0070668_100303011 3300005347 Bacteria 1341
17 Ga0070668_100348620 3300005347 Bacteria 1252
18 Ga0070669_100033628 3300005353 Bacteria 3709
19 Ga0070669_100156726 3300005353 Bacteria 1767
20 Ga0070675_100403687 3300005354 Bacteria 1219
21 Ga0070675_100471555 3300005354 Bacteria 1128
22 Ga0070675_100959438 3300005354 Bacteria 785
23 Ga0070671_100007853 3300005355 Bacteria 8529
24 Ga0070671_100044442 3300005355 Bacteria 3692
25 Ga0070671_100104033 3300005355 Bacteria 2383
26 Ga0070671_100191565 3300005355 Bacteria 1733
27 Ga0070671_100554084 3300005355 Bacteria 992
28 Ga0070674_100009591 3300005356 Bacteria 5801
29 Ga0070673_100103279 3300005364 Bacteria 2351
30 Ga0070673_100147674 3300005364 Bacteria 1989
31 Ga0070673_100834625 3300005364 Bacteria 852
32 Ga0070673_100893564 3300005364 Bacteria 823
33 Ga0070659_100071303 3300005366 Bacteria 2762
34 Ga0070659_100292953 3300005366 Bacteria 1356
35 Ga0070659_100357344 3300005366 Bacteria 1226
36 Ga0070667_100003165 3300005367 Bacteria 14103
37 Ga0070667_100034590 3300005367 Bacteria 4228
38 Ga0070667_100456887 3300005367 Bacteria 1167
39 Ga0070667_100933063 3300005367 Bacteria 808
40 Ga0070667_101594096 3300005367 Bacteria 614
41 Ga0070714_100750190 3300005435 Bacteria 944
42 Ga0070700_100696107 3300005441 Bacteria 807
43 Ga0070663_100564757 3300005455 Bacteria 953
44 Ga0070663_101003078 3300005455 Bacteria 726
45 Ga0070678_100012962 3300005456 Bacteria 5206
46 Ga0070678_100940617 3300005456 Bacteria 792
47 Ga0070662_100056205 3300005457 Bacteria 2857
48 Ga0068867_100062061 3300005459 Bacteria 2776
49 Ga0070679_100264645 3300005530 Bacteria 1674
50 Ga0068853_100005488 3300005539 Bacteria 9938
51 Ga0068853_100115712 3300005539 Bacteria 2387
52 Ga0070672_100006042 3300005543 Bacteria 8087
53 Ga0070672_100045936 3300005543 Bacteria 3382
54 Ga0070672_100078065 3300005543 Bacteria 2649
55 Ga0070672_100290266 3300005543 Bacteria 1385
56 Ga0070686_100997504 3300005544 Bacteria 686
57 Ga0070686_101158662 3300005544 Bacteria 641
58 Ga0070696_101221790 3300005546 Bacteria 636
59 Ga0070665_100553516 3300005548 Bacteria 1163
60 Ga0068855_100376019 3300005563 Bacteria 1561
61 Ga0068855_101173086 3300005563 Bacteria 800
62 Ga0070664_100043204 3300005564 Bacteria 3802
63 Ga0070664_100713854 3300005564 Bacteria 935
64 Ga0068857_100031526 3300005577 Bacteria 4684
65 Ga0068854_100671530 3300005578 Bacteria 891
66 Ga0068856_100079030 3300005614 Bacteria 3262
67 Ga0068852_100025907 3300005616 Bacteria 4759
68 Ga0068852_100254617 3300005616 Bacteria 1683
69 Ga0068852_100620355 3300005616 Bacteria 1087
70 Ga0068859_100000377 3300005617 Bacteria 44438
71 Ga0068859_100306794 3300005617 Bacteria 1681
72 Ga0068859_100734747 3300005617 Bacteria 1077
73 Ga0068864_100000074 3300005618 Bacteria 109458
74 Ga0068864_100202177 3300005618 Bacteria 1826
75 Ga0068864_101009282 3300005618 Bacteria 826
76 Ga0068851_10329801 3300005834 Bacteria 883
77 Ga0068863_100000887 3300005841 Bacteria 30122
78 Ga0068863_100042060 3300005841 Bacteria 4343
79 Ga0068863_100064465 3300005841 Bacteria 3465
80 Ga0068863_100211126 3300005841 Bacteria 1870
81 Ga0068863_100458259 3300005841 Bacteria 1252
82 Ga0068858_100003534 3300005842 Bacteria 15479
83 Ga0068858_100516811 3300005842 Bacteria 1154
84 Ga0068858_100898466 3300005842 Bacteria 866
85 Ga0068860_100001585 3300005843 Bacteria 24476
86 Ga0068860_101325791 3300005843 Bacteria 741
87 Ga0068862_100103251 3300005844 Bacteria 2496
88 Ga0068862_100268167 3300005844 Bacteria 1560
89 Ga0068862_100440344 3300005844 Bacteria 1226
90 Ga0070717_10144203 3300006028 Bacteria 2056
91 Ga0097621_100185947 3300006237 Bacteria 1797
92 Ga0097621_100489707 3300006237 Bacteria 1113
93 Ga0068871_100157576 3300006358 Bacteria 1940
94 Ga0068871_101565338 3300006358 Bacteria 624
95 Ga0075430_100012777 3300006846 Bacteria 7152
96 Ga0068865_100522825 3300006881 Bacteria 992
97 Ga0097620_100000377 3300006931 Bacteria 44438
98 Ga0097620_100306800 3300006931 Bacteria 1681
99 Ga0097620_100734695 3300006931 Bacteria 1077
100 Ga0105247_10082954 3300009101 Bacteria 2023
101 Ga0105248_10000071 3300009177 Bacteria 118281
102 Ga0105248_10011202 3300009177 Bacteria 9891
103 Ga0105248_10053708 3300009177 Bacteria 4520
104 Ga0105248_10060278 3300009177 Bacteria 4260
105 Ga0105238_10430473 3300009551 Bacteria 1315
106 Ga0105249_10033934 3300009553 Bacteria 4621
107 Ga0105249_12330127 3300009553 Bacteria 608
108 Ga0105239_11464553 3300010375 Unclassified 789
109 Ga0157373_10034931 3300013100 Bacteria 3610
110 Ga0157373_10104286 3300013100 Bacteria 1994
111 Ga0157371_10023713 3300013102 Bacteria 4486
112 Ga0157371_10030037 3300013102 Bacteria 3922
113 Ga0157371_10313920 3300013102 Unclassified 1137
114 Ga0157371_10869374 3300013102 Bacteria 682
115 Ga0157370_10074624 3300013104 Bacteria 3199
116 Ga0157370_10345334 3300013104 Bacteria 1372
117 Ga0163162_10111859 3300013306 Bacteria 2829
118 Ga0163162_10156929 3300013306 Bacteria 2396
119 Ga0157375_10031218 3300013308 Bacteria 5032
120 Ga0157375_10117683 3300013308 Bacteria 2763
121 Ga0163163_10000424 3300014325 Bacteria 39058
122 Ga0163163_10095400 3300014325 Bacteria 2994
123 Ga0157380_10567898 3300014326 Bacteria 1116
124 Ga0157379_10001730 3300014968 Bacteria 18065
125 Ga0163161_10003795 3300017792 Bacteria 10592
126 Ga0207697_10037748 3300025315 Bacteria 1980
127 Ga0207656_10115508 3300025321 Bacteria 1245
128 Ga0207696_1008319 3300025711 Bacteria 3982
129 Ga0207710_10097776 3300025900 Bacteria 1381
130 Ga0207680_10181710 3300025903 Bacteria 1423
131 Ga0207645_10000464 3300025907 Bacteria 33570
132 Ga0207705_10016648 3300025909 Bacteria 5266
133 Ga0207705_10017955 3300025909 Bacteria 5060
134 Ga0207707_10287093 3300025912 Bacteria 1424
135 Ga0207660_10630602 3300025917 Bacteria 874
136 Ga0207660_11103041 3300025917 Bacteria 647
137 Ga0207657_10000479 3300025919 Bacteria 42180
138 Ga0207657_10126113 3300025919 Bacteria 2102
139 Ga0207649_10490646 3300025920 Bacteria 933
140 Ga0207681_10013179 3300025923 Bacteria 5111
141 Ga0207681_10131137 3300025923 Bacteria 1853
142 Ga0207650_11181420 3300025925 Bacteria 651
143 Ga0207659_10045467 3300025926 Bacteria 3095
144 Ga0207659_10223003 3300025926 Bacteria 1517
145 Ga0207644_10045392 3300025931 Bacteria 3126
146 Ga0207644_10123907 3300025931 Bacteria 1970
147 Ga0207644_10442897 3300025931 Bacteria 1066
148 Ga0207644_10461862 3300025931 Bacteria 1044
149 Ga0207690_10302811 3300025932 Bacteria 1251
150 Ga0207690_10306262 3300025932 Bacteria 1245
151 Ga0207690_10984570 3300025932 Bacteria 701
152 Ga0207706_10012756 3300025933 Bacteria 7649
153 Ga0207706_10194742 3300025933 Bacteria 1778
154 Ga0207706_10417043 3300025933 Bacteria 1163
155 Ga0207669_10241810 3300025937 Bacteria 1338
156 Ga0207691_10025962 3300025940 Bacteria 5497
157 Ga0207691_10031645 3300025940 Bacteria 4936
158 Ga0207691_10078730 3300025940 Bacteria 2967
159 Ga0207711_10000450 3300025941 Bacteria 42929
160 Ga0207711_10007359 3300025941 Bacteria 9214
161 Ga0207711_10033336 3300025941 Bacteria 4357
162 Ga0207711_10405382 3300025941 Bacteria 1267
163 Ga0207689_10164653 3300025942 Bacteria 1827
164 Ga0207689_11300659 3300025942 Bacteria 611
165 Ga0207661_10158573 3300025944 Bacteria 1962
166 Ga0207679_10642661 3300025945 Bacteria 959
167 Ga0207651_10079391 3300025960 Bacteria 2357
168 Ga0207651_10367203 3300025960 Bacteria 1216
169 Ga0207651_10571346 3300025960 Bacteria 985
170 Ga0207712_10018282 3300025961 Bacteria 4564
171 Ga0207668_10000074 3300025972 Bacteria 75726
172 Ga0207668_10161108 3300025972 Bacteria 1748
173 Ga0207640_10048846 3300025981 Bacteria 2738
174 Ga0207658_10000634 3300025986 Bacteria 30862
175 Ga0207658_10011702 3300025986 Bacteria 5973
176 Ga0207658_10012070 3300025986 Bacteria 5893
177 Ga0207658_11128058 3300025986 Bacteria 716
178 Ga0207703_10011564 3300026035 Bacteria 6863
179 Ga0207703_10483906 3300026035 Bacteria 1160
180 Ga0207703_10796870 3300026035 Bacteria 902
181 Ga0207639_10031398 3300026041 Bacteria 3904
182 Ga0207639_10047906 3300026041 Bacteria 3233
183 Ga0207639_12114045 3300026041 Bacteria 524
184 Ga0207678_10083084 3300026067 Bacteria 2740
185 Ga0207678_10366583 3300026067 Bacteria 1244
186 Ga0207702_10266227 3300026078 Bacteria 1615
187 Ga0207702_10747357 3300026078 Bacteria 965
188 Ga0207641_10000188 3300026088 Bacteria 86532
189 Ga0207641_10015409 3300026088 Bacteria 6263
190 Ga0207641_10057399 3300026088 Bacteria 3310
191 Ga0207648_10029788 3300026089 Bacteria 4840
192 Ga0207676_10000438 3300026095 Bacteria 35161
193 Ga0207676_10719367 3300026095 Bacteria 969
194 Ga0207674_10012628 3300026116 Bacteria 9440
195 Ga0207674_10033864 3300026116 Bacteria 5345
196 Ga0207675_100940018 3300026118 Bacteria 882
197 Ga0207683_10046100 3300026121 Bacteria 3813
198 Ga0207698_10168566 3300026142 Bacteria 1925
199 Ga0207698_10253095 3300026142 Bacteria 1613
200 Ga0207698_10536911 3300026142 Bacteria 1144
201 Ga0209974_10002037 3300027876 Bacteria 7383
202 Ga0268265_10026683 3300028380 Bacteria 4112
203 Ga0268265_10029119 3300028380 Bacteria 3961
204 Ga0268264_10001006 3300028381 Bacteria 28608
205 Ga0268264_10146879 3300028381 Bacteria 2110
206 Ga0307515_10716548 3300028794 Bacteria 617
207 Ga0307513_10337900 3300031456 Bacteria 1258
208 Ga0307408_100076126 3300031548 Bacteria 2495
209 Ga0307408_100118403 3300031548 Bacteria 2048
210 Ga0307408_100251027 3300031548 Bacteria 1459
211 Ga0307408_100328361 3300031548 Bacteria 1291
212 Ga0307408_100623266 3300031548 Bacteria 961
213 Ga0307405_10062946 3300031731 Bacteria 2351
214 Ga0307405_10097135 3300031731 Bacteria 1966
215 Ga0307405_10121720 3300031731 Bacteria 1786
216 Ga0307405_10949840 3300031731 Bacteria 730
217 Ga0307413_10010708 3300031824 Bacteria 4466
218 Ga0307413_10017180 3300031824 Bacteria 3762
219 Ga0307413_10017212 3300031824 Bacteria 3759
220 Ga0307413_10086302 3300031824 Bacteria 2029
221 Ga0307413_11477123 3300031824 Bacteria 600
222 Ga0307410_10019226 3300031852 Bacteria 4150
223 Ga0307410_10055596 3300031852 Bacteria 2687
224 Ga0307410_10077087 3300031852 Bacteria 2329
225 Ga0307410_10262035 3300031852 Bacteria 1348
226 Ga0307410_10809210 3300031852 Bacteria 797
227 Ga0307410_11421703 3300031852 Bacteria 609
228 Ga0307406_10168528 3300031901 Bacteria 1582
229 Ga0307406_10831751 3300031901 Bacteria 781
230 Ga0307407_10180845 3300031903 Bacteria 1397
231 Ga0307407_10387328 3300031903 Bacteria 999
232 Ga0307412_10051568 3300031911 Bacteria 2719
233 Ga0307412_10085497 3300031911 Bacteria 2192
234 Ga0307412_10310208 3300031911 Bacteria 1251
235 Ga0307412_10320171 3300031911 Bacteria 1233
236 Ga0307412_10441077 3300031911 Bacteria 1070
237 Ga0307412_10835066 3300031911 Bacteria 802
238 Ga0307412_10857432 3300031911 Bacteria 793
239 Ga0307409_100104978 3300031995 Bacteria 2354
240 Ga0307409_100455632 3300031995 Bacteria 1235
241 Ga0307409_100491876 3300031995 Bacteria 1192
242 Ga0307409_100494387 3300031995 Bacteria 1190
243 Ga0307409_100685690 3300031995 Bacteria 1022
244 Ga0307409_101174823 3300031995 Bacteria 790
245 Ga0307416_100027288 3300032002 Bacteria 4225
246 Ga0307416_100081716 3300032002 Bacteria 2733
247 Ga0307416_100085512 3300032002 Bacteria 2684
248 Ga0307416_100673647 3300032002 Bacteria 1121
249 Ga0307416_100903545 3300032002 Bacteria 983
250 Ga0307416_101016442 3300032002 Bacteria 932
251 Ga0307416_101768382 3300032002 Bacteria 722
252 Ga0307414_10034633 3300032004 Bacteria 3351
253 Ga0307414_10155018 3300032004 Bacteria 1812
254 Ga0307414_10203403 3300032004 Bacteria 1612
255 Ga0307411_10007325 3300032005 Bacteria 5607
256 Ga0307411_10017044 3300032005 Bacteria 4126
257 Ga0307411_10054145 3300032005 Bacteria 2633
258 Ga0307411_10182765 3300032005 Bacteria 1593
259 Ga0307411_10334229 3300032005 Bacteria 1229
260 Ga0307415_100014334 3300032126 Bacteria 4657
261 Ga0307415_100118159 3300032126 Bacteria 1982
262 Ga0307415_100141828 3300032126 Bacteria 1836
263 Ga0307415_100147433 3300032126 Bacteria 1806
264 Ga0307415_100452371 3300032126 Bacteria 1110
265 Ga0307415_101502568 3300032126 Bacteria 644
266 Ga0373946_0610760 3300035171 Bacteria 566
267 Ga0395899_0000514 3300037312 Bacteria 42939
268 Ga0395899_0096778 3300037312 Bacteria 2134
269 Ga0395900_0004798 3300037418 Bacteria 14244
270 Ga0395900_0125264 3300037418 Bacteria 2635
271 Ga0395900_0247402 3300037418 Bacteria 1785
272 Ga0395900_0293699 3300037418 Bacteria 1613
273 Ga0395900_0332212 3300037418 Bacteria 1498
274 Ga0395900_0503301 3300037418 Bacteria 1161
275 Ga0395898_0000021 3300037466 Bacteria 393971
276 Ga0395898_0347155 3300037466 Bacteria 1415
277 Ga0395898_0933982 3300037466 Bacteria 805
278 Ga0395898_1376922 3300037466 Bacteria 633
279 Ga0395905_0000006 3300037471 Bacteria 549428
280 Ga0395905_0007739 3300037471 Bacteria 10657
281 Ga0395905_0046663 3300037471 Bacteria 4062
282 Ga0395905_0070587 3300037471 Bacteria 3274
283 Ga0395905_0127761 3300037471 Bacteria 2390
284 Ga0395905_0428455 3300037471 Bacteria 1219
285 Ga0395905_0971138 3300037471 Bacteria 752
286 Ga0395905_1409565 3300037471 Unclassified 601
287 Ga0395901_0003108 3300038443 Bacteria 16701
288 Ga0395901_0011593 3300038443 Bacteria 8930
289 Ga0395901_0136053 3300038443 Bacteria 2582
290 Ga0395901_0140254 3300038443 Bacteria 2540
291 Ga0395901_0483023 3300038443 Bacteria 1263
292 Ga0395901_0972056 3300038443 Bacteria 826
293 Ga0395901_0987612 3300038443 Bacteria 818
294 Ga0439465_0039477 3300041413 Bacteria 1524
295 Ga0439465_0044728 3300041413 Bacteria 1439
296 Ga0451853_1655938 3300041512 Bacteria 953
297 Ga0466969_0395987 3300044656 Unclassified 627
298 Ga0466972_0116298 3300044658 Bacteria 1262
299 Ga0466966_0053518 3300044684 Bacteria 2560
300 Ga0466966_0086878 3300044684 Bacteria 1944
301 Ga0466966_0282999 3300044684 Bacteria 997
302 Ga0466961_0115150 3300044693 Bacteria 1690
303 Ga0466961_0319137 3300044693 Bacteria 947
304 Ga0466961_0545001 3300044693 Bacteria 699
305 Ga0466971_0612589 3300044719 Unclassified 543
306 Ga0466957_0022667 3300044842 Bacteria 3706
307 Ga0466959_0016931 3300045049 Bacteria 5335
308 Ga0466959_0395151 3300045049 Bacteria 940
309 Ga0466958_0149752 3300045836 Bacteria 1472
310 Ga0466958_0189336 3300045836 Bacteria 1307
311 Ga0466967_0102205 3300045976 Bacteria 2622
312 Ga0466967_0404819 3300045976 Bacteria 1328
313 Ga0466967_2341438 3300045976 Bacteria 529
314 Ga0495638_0086268 3300046460 Bacteria 1897
315 Ga0495668_0003707 3300046616 Bacteria 11250
316 Ga0495669_0059965 3300046684 Bacteria 1720
317 Ga0495686_0002528 3300047472 Bacteria 17129
318 Ga0495686_0016229 3300047472 Bacteria 5055
319 Ga0496101_0109087 3300048904 Bacteria 2082
320 Ga0496105_0653718 3300048908 Bacteria 811
321 Ga0496107_0181295 3300048910 Bacteria 1564
322 Ga0496108_0003382 3300048911 Bacteria 12807
323 Ga0496108_0012589 3300048911 Bacteria 6892
324 Ga0496108_0260600 3300048911 Bacteria 1509
325 Ga0496109_0074325 3300048912 Bacteria 3124
326 Ga0496109_0102795 3300048912 Bacteria 2652
327 Ga0496109_0205553 3300048912 Bacteria 1851
328 Ga0496109_0785125 3300048912 Bacteria 890
329 Ga0496110_0033790 3300048913 Bacteria 4427
330 Ga0496110_0134815 3300048913 Bacteria 2231
331 Ga0496111_0070992 3300048914 Bacteria 2534
332 Ga0496111_0115215 3300048914 Bacteria 1981
333 Ga0496112_0467184 3300048915 Bacteria 1199
334 Ga0496113_0028102 3300048916 Bacteria 4041
335 Ga0496114_0009772 3300048917 Bacteria 7621
336 Ga0501067_0025608 3300049583 Bacteria 3270
337 Ga0501217_002118 3300049661 Bacteria 3853
338 Ga0501224_003555 3300049664 Bacteria 2181
339 Ga0501233_028066 3300049668 Bacteria 1254
340 Ga0501235_000668 3300049669 Bacteria 6926
341 Ga0501235_177185 3300049669 Unclassified 566
342 Ga0501249_004905 3300049679 Bacteria 2728
343 Ga0501257_011203 3300049686 Bacteria 2044
344 Ga0501225_0006134 3300049705 Bacteria 3510
345 Ga0501234_002125 3300049707 Bacteria 3135
346 Ga0501268_005075 3300049765 Bacteria 1876
347 Ga0501272_000728 3300049769 Bacteria 2964
348 Ga0501273_036456 3300049770 Bacteria 716
349 Ga0501035_0266062 3300049822 Bacteria 1452
350 Ga0501212_048125 3300049851 Bacteria 717
351 nmdc:mga0qj67_6321_c1 3300050509 Bacteria 8697
352 Ga0500658_0000963 3300053134 Bacteria 11749
353 Ga0500559_0011133 3300053136 Bacteria 3849
354 2524610580 2524023250 Bacteria 5457705
355 2885428246 2885427238 Bacteria 2291351
356 JGI24739J22299_10009905
357 Ga0070658_10010050
358 Ga0070658_10024019
359 Ga0070658_10250813
360 Ga0070670_100931086
361 Ga0068869_100394638
362 Ga0068869_100482103
363 Ga0070666_10235013
364 Ga0070660_100003988
365 Ga0070660_100234817
366 Ga0070660_101245774
367 Ga0070661_100482110
368 Ga0070661_101296682
369 Ga0070668_100000910
370 Ga0070668_100118440
371 Ga0070668_100303011
372 Ga0070668_100348620
373 Ga0070669_100033628
374 Ga0070669_100156726
375 Ga0070675_100403687
376 Ga0070675_100471555
377 Ga0070675_100959438
378 Ga0070671_100007853
379 Ga0070671_100044442
380 Ga0070671_100104033
381 Ga0070671_100191565
382 Ga0070671_100554084
383 Ga0070674_100009591
384 Ga0070673_100103279
385 Ga0070673_100147674
386 Ga0070673_100834625
387 Ga0070673_100893564
388 Ga0070659_100071303
389 Ga0070659_100292953
390 Ga0070659_100357344
391 Ga0070667_100003165
392 Ga0070667_100034590
393 Ga0070667_100456887
394 Ga0070667_100933063
395 Ga0070667_101594096
396 Ga0070714_100750190
397 Ga0070700_100696107
398 Ga0070663_100564757
399 Ga0070663_101003078
400 Ga0070678_100012962
401 Ga0070678_100940617
402 Ga0070662_100056205
403 Ga0068867_100062061
404 Ga0070679_100264645
405 Ga0068853_100005488
406 Ga0068853_100115712
407 Ga0070672_100006042
408 Ga0070672_100045936
409 Ga0070672_100078065
410 Ga0070672_100290266
411 Ga0070686_100997504
412 Ga0070686_101158662
413 Ga0070696_101221790
414 Ga0070665_100553516
415 Ga0068855_100376019
416 Ga0068855_101173086
417 Ga0070664_100043204
418 Ga0070664_100713854
419 Ga0068857_100031526
420 Ga0068854_100671530
421 Ga0068856_100079030
422 Ga0068852_100025907
423 Ga0068852_100254617
424 Ga0068852_100620355
425 Ga0068859_100000377
426 Ga0068859_100306794
427 Ga0068859_100734747
428 Ga0068864_100000074
429 Ga0068864_100202177
430 Ga0068864_101009282
431 Ga0068851_10329801
432 Ga0068863_100000887
433 Ga0068863_100042060
434 Ga0068863_100064465
435 Ga0068863_100211126
436 Ga0068863_100458259
437 Ga0068858_100003534
438 Ga0068858_100516811
439 Ga0068858_100898466
440 Ga0068860_100001585
441 Ga0068860_101325791
442 Ga0068862_100103251
443 Ga0068862_100268167
444 Ga0068862_100440344
445 Ga0070717_10144203
446 Ga0097621_100185947
447 Ga0097621_100489707
448 Ga0068871_100157576
449 Ga0068871_101565338
450 Ga0075430_100012777
451 Ga0068865_100522825
452 Ga0097620_100000377
453 Ga0097620_100306800
454 Ga0097620_100734695
455 Ga0105247_10082954
456 Ga0105248_10000071
457 Ga0105248_10011202
458 Ga0105248_10053708
459 Ga0105248_10060278
460 Ga0105238_10430473
461 Ga0105249_10033934
462 Ga0105249_12330127
463 Ga0105239_11464553
464 Ga0157373_10034931
465 Ga0157373_10104286
466 Ga0157371_10023713
467 Ga0157371_10030037
468 Ga0157371_10313920
469 Ga0157371_10869374
470 Ga0157370_10074624
471 Ga0157370_10345334
472 Ga0163162_10111859
473 Ga0163162_10156929
474 Ga0157375_10031218
475 Ga0157375_10117683
476 Ga0163163_10000424
477 Ga0163163_10095400
478 Ga0157380_10567898
479 Ga0157379_10001730
480 Ga0163161_10003795
481 Ga0207697_10037748
482 Ga0207656_10115508
483 Ga0207696_1008319
484 Ga0207710_10097776
485 Ga0207680_10181710
486 Ga0207645_10000464
487 Ga0207705_10016648
488 Ga0207705_10017955
489 Ga0207707_10287093
490 Ga0207660_10630602
491 Ga0207660_11103041
492 Ga0207657_10000479
493 Ga0207657_10126113
494 Ga0207649_10490646
495 Ga0207681_10013179
496 Ga0207681_10131137
497 Ga0207650_11181420
498 Ga0207659_10045467
499 Ga0207659_10223003
500 Ga0207644_10045392
501 Ga0207644_10123907
502 Ga0207644_10442897
503 Ga0207644_10461862
504 Ga0207690_10302811
505 Ga0207690_10306262
506 Ga0207690_10984570
507 Ga0207706_10012756
508 Ga0207706_10194742
509 Ga0207706_10417043
510 Ga0207669_10241810
511 Ga0207691_10025962
512 Ga0207691_10031645
513 Ga0207691_10078730
514 Ga0207711_10000450
515 Ga0207711_10007359
516 Ga0207711_10033336
517 Ga0207711_10405382
518 Ga0207689_10164653
519 Ga0207689_11300659
520 Ga0207661_10158573
521 Ga0207679_10642661
522 Ga0207651_10079391
523 Ga0207651_10367203
524 Ga0207651_10571346
525 Ga0207712_10018282
526 Ga0207668_10000074
527 Ga0207668_10161108
528 Ga0207640_10048846
529 Ga0207658_10000634
530 Ga0207658_10011702
531 Ga0207658_10012070
532 Ga0207658_11128058
533 Ga0207703_10011564
534 Ga0207703_10483906
535 Ga0207703_10796870
536 Ga0207639_10031398
537 Ga0207639_10047906
538 Ga0207639_12114045
539 Ga0207678_10083084
540 Ga0207678_10366583
541 Ga0207702_10266227
542 Ga0207702_10747357
543 Ga0207641_10000188
544 Ga0207641_10015409
545 Ga0207641_10057399
546 Ga0207648_10029788
547 Ga0207676_10000438
548 Ga0207676_10719367
549 Ga0207674_10012628
550 Ga0207674_10033864
551 Ga0207675_100940018
552 Ga0207683_10046100
553 Ga0207698_10168566
554 Ga0207698_10253095
555 Ga0207698_10536911
556 Ga0209974_10002037
557 Ga0268265_10026683
558 Ga0268265_10029119
559 Ga0268264_10001006
560 Ga0268264_10146879
561 Ga0307515_10716548
562 Ga0307513_10337900
563 Ga0307408_100076126
564 Ga0307408_100118403
565 Ga0307408_100251027
566 Ga0307408_100328361
567 Ga0307408_100623266
568 Ga0307405_10062946
569 Ga0307405_10097135
570 Ga0307405_10121720
571 Ga0307405_10949840
572 Ga0307413_10010708
573 Ga0307413_10017180
574 Ga0307413_10017212
575 Ga0307413_10086302
576 Ga0307413_11477123
577 Ga0307410_10019226
578 Ga0307410_10055596
579 Ga0307410_10077087
580 Ga0307410_10262035
581 Ga0307410_10809210
582 Ga0307410_11421703
583 Ga0307406_10168528
584 Ga0307406_10831751
585 Ga0307407_10180845
586 Ga0307407_10387328
587 Ga0307412_10051568
588 Ga0307412_10085497
589 Ga0307412_10310208
590 Ga0307412_10320171
591 Ga0307412_10441077
592 Ga0307412_10835066
593 Ga0307412_10857432
594 Ga0307409_100104978
595 Ga0307409_100455632
596 Ga0307409_100491876
597 Ga0307409_100494387
598 Ga0307409_100685690
599 Ga0307409_101174823
600 Ga0307416_100027288
601 Ga0307416_100081716
602 Ga0307416_100085512
603 Ga0307416_100673647
604 Ga0307416_100903545
605 Ga0307416_101016442
606 Ga0307416_101768382
607 Ga0307414_10034633
608 Ga0307414_10155018
609 Ga0307414_10203403
610 Ga0307411_10007325
611 Ga0307411_10017044
612 Ga0307411_10054145
613 Ga0307411_10182765
614 Ga0307411_10334229
615 Ga0307415_100014334
616 Ga0307415_100118159
617 Ga0307415_100141828
618 Ga0307415_100147433
619 Ga0307415_100452371
620 Ga0307415_101502568
621 Ga0373946_0610760
622 Ga0395899_0000514
623 Ga0395899_0096778
624 Ga0395900_0004798
625 Ga0395900_0125264
626 Ga0395900_0247402
627 Ga0395900_0293699
628 Ga0395900_0332212
629 Ga0395900_0503301
630 Ga0395898_0000021
631 Ga0395898_0347155
632 Ga0395898_0933982
633 Ga0395898_1376922
634 Ga0395905_0000006
635 Ga0395905_0007739
636 Ga0395905_0046663
637 Ga0395905_0070587
638 Ga0395905_0127761
639 Ga0395905_0428455
640 Ga0395905_0971138
641 Ga0395905_1409565
642 Ga0395901_0003108
643 Ga0395901_0011593
644 Ga0395901_0136053
645 Ga0395901_0140254
646 Ga0395901_0483023
647 Ga0395901_0972056
648 Ga0395901_0987612
649 Ga0439465_0039477
650 Ga0439465_0044728
651 Ga0451853_1655938
652 Ga0466969_0395987
653 Ga0466972_0116298
654 Ga0466966_0053518
655 Ga0466966_0086878
656 Ga0466966_0282999
657 Ga0466961_0115150
658 Ga0466961_0319137
659 Ga0466961_0545001
660 Ga0466971_0612589
661 Ga0466957_0022667
662 Ga0466959_0016931
663 Ga0466959_0395151
664 Ga0466958_0149752
665 Ga0466958_0189336
666 Ga0466967_0102205
667 Ga0466967_0404819
668 Ga0466967_2341438
669 Ga0495638_0086268
670 Ga0495668_0003707
671 Ga0495669_0059965
672 Ga0495686_0002528
673 Ga0495686_0016229
674 Ga0496101_0109087
675 Ga0496105_0653718
676 Ga0496107_0181295
677 Ga0496108_0003382
678 Ga0496108_0012589
679 Ga0496108_0260600
680 Ga0496109_0074325
681 Ga0496109_0102795
682 Ga0496109_0205553
683 Ga0496109_0785125
684 Ga0496110_0033790
685 Ga0496110_0134815
686 Ga0496111_0070992
687 Ga0496111_0115215
688 Ga0496112_0467184
689 Ga0496113_0028102
690 Ga0496114_0009772
691 Ga0501067_0025608
692 Ga0501217_002118
693 Ga0501224_003555
694 Ga0501233_028066
695 Ga0501235_000668
696 Ga0501235_177185
697 Ga0501249_004905
698 Ga0501257_011203
699 Ga0501225_0006134
700 Ga0501234_002125
701 Ga0501268_005075
702 Ga0501272_000728
703 Ga0501273_036456
704 Ga0501035_0266062
705 Ga0501212_048125
706 nmdc:mga0qj67_6321_c1
707 Ga0500658_0000963
708 Ga0500559_0011133
709 2524610580
710 2885428246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

10

99

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imi-assembly2.cif.gz_C 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' 0.8733 13 97
3fit-assembly1.cif.gz_A-2 fhit (fragile histidine triad protein) in complex with adenosine/sulfate amp analog 0.8428 11 139
2fhi-assembly1.cif.gz_A-2 substrate analog (ib2) complex with the his 96 asn substitution of the fragile histidine triad protein, fhit 0.8424 11 139
1fit-assembly1.cif.gz_A fhit (fragile histidine triad protein) 0.8365 11 140
3nrd-assembly1.cif.gz_A crystal structure of a histidine triad (hit) protein (smc02904) from sinorhizobium meliloti 1021 at 2.06 a resolution 0.8302 1 140
ID Description Score Start End Superfamily
af_Q8IL97_1_145_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8987 11 96 3.30.428.10
af_Q9JIX3_1_149_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8855 11 99 3.30.428.10
af_O76464_317_457_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8853 11 99 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8844 11 98 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8699 8 96 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A0Q8RZ40-F1-model_v4 HIT family hydrolase 0.9939 1 141 GO:0016787
AF-A0A0W1DGX3-F1-model_v4 HIT family hydrolase 0.9933 1 141 GO:0016787
AF-A0A7W9V9H9-F1-model_v4 deleted 0.9902 1 140
AF-A0A1T5C0J4-F1-model_v4 Diadenosine tetraphosphate (Ap4A) hydrolase 0.9892 1 142 GO:0016787
AF-A0A7Y3AQX9-F1-model_v4 HIT family protein 0.9888 1 140 GO:0003824

Map