F420232

General Info

Members Datasets Scaffolds Average Seq Length
355 152 354 240

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0086031|Ga0466963_0086031_342_1157
Length 266
Sequence MVYEKFTSDGVCEVRGSALPQGDFMERVVFDRMAELDQLHWWFVAAEVXXXVVKPPKKARLLEVGCGTGHNFAMLKQFGRLDACELDYCARALATKRLRRKVEDAKLPDLSMFERNSYDLVALLDVLEHVRGDVAALRAIHRRLKPGGALLLTVPANPWMWSAHDAAHHHFRRYSKRQLAKVLSDAGFEVQLLSYFNTLLFPLIAAARFAGKLTGKDAADDKLPSGLVNSALDRIFGIEAALLGRLPMPFGVSLVAVVRRPAACKG

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
145 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
148 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
149 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
150 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.07
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10010986 3300005327 Bacteria 7257
2 Ga0070658_10027893 3300005327 Bacteria 4531
3 Ga0070658_10059559 3300005327 Bacteria 3109
4 Ga0070658_10212478 3300005327 Bacteria 1634
5 Ga0070658_10215655 3300005327 Bacteria 1622
6 Ga0070658_10343348 3300005327 Bacteria 1277
7 Ga0070658_10524303 3300005327 Unclassified 1024
8 Ga0070683_100828654 3300005329 Bacteria 887
9 Ga0070670_100252742 3300005331 Bacteria 1536
10 Ga0070670_100485360 3300005331 Bacteria 1098
11 Ga0070677_10087786 3300005333 Bacteria 1346
12 Ga0070682_100184800 3300005337 Bacteria 1459
13 Ga0068868_100000006 3300005338 Bacteria 123358
14 Ga0068868_100137793 3300005338 Bacteria 2001
15 Ga0070660_100007343 3300005339 Bacteria 7678
16 Ga0070660_100043181 3300005339 Bacteria 3444
17 Ga0070660_100089429 3300005339 Bacteria 2426
18 Ga0070660_100125882 3300005339 Bacteria 2047
19 Ga0070660_100127468 3300005339 Bacteria 2034
20 Ga0070660_100221084 3300005339 Bacteria 1539
21 Ga0070660_100346112 3300005339 Bacteria 1223
22 Ga0070660_100532561 3300005339 Bacteria 979
23 Ga0070691_10001627 3300005341 Bacteria 9737
24 Ga0070661_100023470 3300005344 Bacteria 4421
25 Ga0070661_100085637 3300005344 Bacteria 2329
26 Ga0070661_100148845 3300005344 Bacteria 1769
27 Ga0070675_100007132 3300005354 Bacteria 8609
28 Ga0070671_100009253 3300005355 Bacteria 7915
29 Ga0070671_100018915 3300005355 Bacteria 5600
30 Ga0070671_100092177 3300005355 Bacteria 2538
31 Ga0070674_100031382 3300005356 Bacteria 3520
32 Ga0070674_100052637 3300005356 Bacteria 2808
33 Ga0070673_100060752 3300005364 Bacteria 2996
34 Ga0070659_100000005 3300005366 Bacteria 259902
35 Ga0070659_100046514 3300005366 Bacteria 3401
36 Ga0070659_100547866 3300005366 Bacteria 990
37 Ga0070714_100040856 3300005435 Bacteria 3910
38 Ga0070714_100103995 3300005435 Bacteria 2506
39 Ga0070713_100018111 3300005436 Bacteria 5350
40 Ga0070663_100334133 3300005455 Bacteria 1222
41 Ga0070663_100589082 3300005455 Bacteria 934
42 Ga0070678_100005221 3300005456 Bacteria 7472
43 Ga0070678_100165193 3300005456 Bacteria 1797
44 Ga0070678_100302349 3300005456 Bacteria 1360
45 Ga0070662_100123435 3300005457 Bacteria 1987
46 Ga0070662_100341715 3300005457 Bacteria 1225
47 Ga0070679_100043335 3300005530 Bacteria 4482
48 Ga0068853_100034504 3300005539 Bacteria 4295
49 Ga0068853_100044692 3300005539 Bacteria 3792
50 Ga0068853_100221959 3300005539 Bacteria 1726
51 Ga0068853_100415138 3300005539 Bacteria 1261
52 Ga0070672_100209756 3300005543 Bacteria 1631
53 Ga0070686_100000180 3300005544 Bacteria 44847
54 Ga0070696_100373202 3300005546 Bacteria 1110
55 Ga0070665_100000145 3300005548 Bacteria 131599
56 Ga0068855_100116879 3300005563 Bacteria 3056
57 Ga0068855_100303123 3300005563 Bacteria 1769
58 Ga0070664_100028236 3300005564 Bacteria 4667
59 Ga0070664_100152365 3300005564 Bacteria 2042
60 Ga0068857_100066083 3300005577 Bacteria 3217
61 Ga0068857_100173877 3300005577 Bacteria 1958
62 Ga0068854_100013602 3300005578 Bacteria 5347
63 Ga0068856_100123647 3300005614 Bacteria 2590
64 Ga0068856_100169665 3300005614 Bacteria 2194
65 Ga0068856_100176309 3300005614 Bacteria 2150
66 Ga0068856_100221058 3300005614 Bacteria 1909
67 Ga0068856_100343679 3300005614 Bacteria 1510
68 Ga0068856_100615922 3300005614 Bacteria 1106
69 Ga0068852_100014775 3300005616 Bacteria 6028
70 Ga0068852_100039967 3300005616 Bacteria 3953
71 Ga0068852_100699583 3300005616 Unclassified 1023
72 Ga0068859_100442171 3300005617 Bacteria 1396
73 Ga0068864_100012151 3300005618 Bacteria 7116
74 Ga0068864_100012283 3300005618 Bacteria 7078
75 Ga0068863_100003472 3300005841 Bacteria 15545
76 Ga0068863_100012682 3300005841 Bacteria 8128
77 Ga0068860_100005276 3300005843 Bacteria 13115
78 Ga0068862_100000461 3300005844 Bacteria 44027
79 Ga0081539_10035565 3300005985 Bacteria 2991
80 Ga0070717_10005021 3300006028 Bacteria 9636
81 Ga0097621_100151043 3300006237 Bacteria 1992
82 Ga0068871_100420864 3300006358 Bacteria 1193
83 Ga0097620_100442163 3300006931 Bacteria 1396
84 Ga0105240_10097594 3300009093 Bacteria 3580
85 Ga0105240_10504577 3300009093 Bacteria 1345
86 Ga0105245_10026769 3300009098 Bacteria 5078
87 Ga0105245_10385962 3300009098 Bacteria 1396
88 Ga0105242_10321618 3300009176 Bacteria 1419
89 Ga0105248_10000790 3300009177 Bacteria 35522
90 Ga0105248_10178148 3300009177 Bacteria 2396
91 Ga0105238_10132860 3300009551 Bacteria 2467
92 Ga0105249_10000043 3300009553 Bacteria 192155
93 Ga0105239_10595319 3300010375 Bacteria 1261
94 Ga0157373_10045842 3300013100 Bacteria 3121
95 Ga0157373_10081302 3300013100 Bacteria 2284
96 Ga0157373_10090735 3300013100 Bacteria 2152
97 Ga0157373_10093586 3300013100 Bacteria 2117
98 Ga0157371_10336383 3300013102 Bacteria 1097
99 Ga0157370_10003139 3300013104 Bacteria 19568
100 Ga0157370_10039747 3300013104 Bacteria 4545
101 Ga0157370_10050352 3300013104 Bacteria 3982
102 Ga0157370_10198146 3300013104 Unclassified 1863
103 Ga0157369_10038034 3300013105 Bacteria 5264
104 Ga0157369_10047702 3300013105 Bacteria 4649
105 Ga0157369_10078332 3300013105 Bacteria 3541
106 Ga0157369_10262971 3300013105 Bacteria 1799
107 Ga0157369_10344552 3300013105 Bacteria 1548
108 Ga0157372_10047207 3300013307 Bacteria 4784
109 Ga0157372_10050670 3300013307 Bacteria 4617
110 Ga0157372_10285849 3300013307 Bacteria 1918
111 Ga0157372_10652909 3300013307 Bacteria 1225
112 Ga0182008_10072375 3300014497 Bacteria 1696
113 Ga0213876_10081146 3300021384 Bacteria 1715
114 Ga0207656_10105211 3300025321 Bacteria 1298
115 Ga0207647_10057545 3300025904 Bacteria 2383
116 Ga0207647_10208830 3300025904 Bacteria 1128
117 Ga0207645_10046980 3300025907 Bacteria 2757
118 Ga0207705_10010791 3300025909 Bacteria 6632
119 Ga0207705_10021476 3300025909 Bacteria 4608
120 Ga0207705_10060126 3300025909 Bacteria 2744
121 Ga0207705_10069071 3300025909 Bacteria 2558
122 Ga0207705_10078700 3300025909 Bacteria 2400
123 Ga0207705_10148611 3300025909 Bacteria 1754
124 Ga0207705_10310699 3300025909 Bacteria 1210
125 Ga0207705_10431032 3300025909 Bacteria 1021
126 Ga0207705_10527608 3300025909 Bacteria 918
127 Ga0207707_10060449 3300025912 Bacteria 3296
128 Ga0207707_10118993 3300025912 Bacteria 2309
129 Ga0207695_10038379 3300025913 Bacteria 5158
130 Ga0207695_10402815 3300025913 Bacteria 1253
131 Ga0207657_10000695 3300025919 Bacteria 35770
132 Ga0207657_10003079 3300025919 Bacteria 17838
133 Ga0207657_10005314 3300025919 Bacteria 13495
134 Ga0207657_10012786 3300025919 Bacteria 8261
135 Ga0207657_10047294 3300025919 Bacteria 3763
136 Ga0207657_10060263 3300025919 Bacteria 3257
137 Ga0207657_10102996 3300025919 Bacteria 2367
138 Ga0207657_10626958 3300025919 Bacteria 838
139 Ga0207649_10010537 3300025920 Bacteria 5082
140 Ga0207649_10024619 3300025920 Bacteria 3501
141 Ga0207649_10040102 3300025920 Bacteria 2843
142 Ga0207649_10083210 3300025920 Bacteria 2077
143 Ga0207652_10035959 3300025921 Bacteria 4185
144 Ga0207659_10077028 3300025926 Bacteria 2453
145 Ga0207687_10184829 3300025927 Bacteria 1617
146 Ga0207700_10089918 3300025928 Bacteria 2421
147 Ga0207664_10070051 3300025929 Bacteria 2821
148 Ga0207664_10197045 3300025929 Bacteria 1737
149 Ga0207644_10013812 3300025931 Bacteria 5394
150 Ga0207644_10017089 3300025931 Bacteria 4892
151 Ga0207690_10000002 3300025932 Bacteria 807473
152 Ga0207690_10000033 3300025932 Bacteria 149705
153 Ga0207690_10003116 3300025932 Bacteria 9987
154 Ga0207690_10240755 3300025932 Bacteria 1393
155 Ga0207706_10014531 3300025933 Bacteria 7136
156 Ga0207706_10022505 3300025933 Bacteria 5656
157 Ga0207706_10074085 3300025933 Bacteria 2994
158 Ga0207691_10080230 3300025940 Bacteria 2935
159 Ga0207711_10003863 3300025941 Bacteria 12888
160 Ga0207679_10002922 3300025945 Bacteria 10586
161 Ga0207667_10143700 3300025949 Bacteria 2456
162 Ga0207667_10770716 3300025949 Unclassified 960
163 Ga0207651_10126984 3300025960 Bacteria 1945
164 Ga0207712_10000057 3300025961 Bacteria 142874
165 Ga0207640_10258666 3300025981 Bacteria 1355
166 Ga0207658_10248682 3300025986 Bacteria 1510
167 Ga0207677_10000043 3300026023 Bacteria 110161
168 Ga0207639_10123655 3300026041 Bacteria 2130
169 Ga0207639_10232671 3300026041 Bacteria 1598
170 Ga0207678_10092507 3300026067 Bacteria 2585
171 Ga0207678_10098378 3300026067 Bacteria 2500
172 Ga0207678_10131806 3300026067 Bacteria 2133
173 Ga0207678_10143134 3300026067 Bacteria 2041
174 Ga0207702_10079508 3300026078 Bacteria 2842
175 Ga0207702_10100560 3300026078 Bacteria 2551
176 Ga0207702_10209268 3300026078 Bacteria 1812
177 Ga0207702_10254935 3300026078 Bacteria 1649
178 Ga0207702_10402574 3300026078 Bacteria 1320
179 Ga0207641_10002843 3300026088 Bacteria 15732
180 Ga0207641_10010980 3300026088 Bacteria 7424
181 Ga0207648_10198996 3300026089 Bacteria 1777
182 Ga0207676_10005397 3300026095 Bacteria 9048
183 Ga0207674_10059769 3300026116 Bacteria 3856
184 Ga0207674_10123927 3300026116 Bacteria 2550
185 Ga0207683_10003531 3300026121 Bacteria 13640
186 Ga0207683_10047103 3300026121 Bacteria 3775
187 Ga0207683_10179405 3300026121 Bacteria 1920
188 Ga0207698_10013923 3300026142 Bacteria 5327
189 Ga0207698_10028197 3300026142 Bacteria 4000
190 Ga0207698_10309069 3300026142 Bacteria 1475
191 Ga0207698_10343892 3300026142 Bacteria 1406
192 Ga0268266_10000173 3300028379 Bacteria 117695
193 Ga0268265_10000120 3300028380 Bacteria 98362
194 Ga0268264_10003978 3300028381 Bacteria 12648
195 Ga0307513_10012571 3300031456 Bacteria 10438
196 Ga0307405_10122518 3300031731 Bacteria 1781
197 Ga0307413_10295600 3300031824 Bacteria 1226
198 Ga0307413_10368303 3300031824 Bacteria 1115
199 Ga0307413_10808427 3300031824 Unclassified 788
200 Ga0307410_10013917 3300031852 Bacteria 4713
201 Ga0307410_10092414 3300031852 Bacteria 2151
202 Ga0307406_10014350 3300031901 Bacteria 4556
203 Ga0307406_10338711 3300031901 Bacteria 1171
204 Ga0307407_10002267 3300031903 Bacteria 7448
205 Ga0307412_10009076 3300031911 Bacteria 5698
206 Ga0307409_100005411 3300031995 Bacteria 7342
207 Ga0307416_100046760 3300032002 Bacteria 3418
208 Ga0307416_100238431 3300032002 Bacteria 1760
209 Ga0307414_10055458 3300032004 Bacteria 2775
210 Ga0307414_10185430 3300032004 Bacteria 1678
211 Ga0307411_10128490 3300032005 Bacteria 1848
212 Ga0307411_10140228 3300032005 Bacteria 1781
213 Ga0307411_10662374 3300032005 Bacteria 905
214 Ga0307415_100140530 3300032126 Bacteria 1843
215 Ga0307415_100750443 3300032126 Bacteria 886
216 Ga0373946_0005280 3300035171 Bacteria 4660
217 Ga0395899_0005589 3300037312 Bacteria 9749
218 Ga0395899_0018878 3300037312 Bacteria 5240
219 Ga0395899_0026827 3300037312 Bacteria 4345
220 Ga0395899_0076157 3300037312 Bacteria 2449
221 Ga0395899_0092255 3300037312 Bacteria 2193
222 Ga0395899_0112139 3300037312 Bacteria 1959
223 Ga0395899_0153280 3300037312 Bacteria 1632
224 Ga0395899_0258428 3300037312 Bacteria 1192
225 Ga0395899_0277196 3300037312 Bacteria 1142
226 Ga0395899_0331193 3300037312 Bacteria 1023
227 Ga0395900_0046080 3300037418 Bacteria 4490
228 Ga0395900_0076171 3300037418 Bacteria 3449
229 Ga0395900_0081720 3300037418 Bacteria 3319
230 Ga0395900_0091383 3300037418 Bacteria 3128
231 Ga0395900_0099219 3300037418 Bacteria 2992
232 Ga0395900_0124681 3300037418 Bacteria 2641
233 Ga0395900_0131966 3300037418 Bacteria 2559
234 Ga0395900_0134331 3300037418 Bacteria 2534
235 Ga0395900_0137253 3300037418 Bacteria 2505
236 Ga0395900_0143204 3300037418 Bacteria 2446
237 Ga0395900_0145949 3300037418 Bacteria 2419
238 Ga0395900_0150944 3300037418 Bacteria 2374
239 Ga0395900_0204997 3300037418 Bacteria 1993
240 Ga0395900_0235278 3300037418 Bacteria 1840
241 Ga0395900_0304828 3300037418 Bacteria 1578
242 Ga0395900_0385070 3300037418 Bacteria 1369
243 Ga0395900_0919778 3300037418 Bacteria 797
244 Ga0395898_0009072 3300037466 Bacteria 10473
245 Ga0395898_0026096 3300037466 Bacteria 5882
246 Ga0395898_0073299 3300037466 Bacteria 3307
247 Ga0395898_0096647 3300037466 Bacteria 2837
248 Ga0395898_0214289 3300037466 Bacteria 1837
249 Ga0395898_0304060 3300037466 Bacteria 1521
250 Ga0395898_0325101 3300037466 Bacteria 1467
251 Ga0395898_0346375 3300037466 Bacteria 1417
252 Ga0395898_0398913 3300037466 Bacteria 1311
253 Ga0395898_0421118 3300037466 Bacteria 1272
254 Ga0395905_0004174 3300037471 Bacteria 15108
255 Ga0395905_0015279 3300037471 Bacteria 7299
256 Ga0395905_0024357 3300037471 Bacteria 5713
257 Ga0395905_0061445 3300037471 Bacteria 3514
258 Ga0395905_0063967 3300037471 Bacteria 3442
259 Ga0395905_0066299 3300037471 Bacteria 3381
260 Ga0395905_0096591 3300037471 Bacteria 2774
261 Ga0395905_0105845 3300037471 Bacteria 2641
262 Ga0395905_0122545 3300037471 Bacteria 2444
263 Ga0395905_0138201 3300037471 Bacteria 2292
264 Ga0395905_0194322 3300037471 Bacteria 1903
265 Ga0395905_0229434 3300037471 Bacteria 1736
266 Ga0395905_0237154 3300037471 Bacteria 1705
267 Ga0395905_0259186 3300037471 Bacteria 1623
268 Ga0395905_0317534 3300037471 Bacteria 1447
269 Ga0395905_0403840 3300037471 Bacteria 1261
270 Ga0395905_0427793 3300037471 Bacteria 1220
271 Ga0395905_0500808 3300037471 Bacteria 1115
272 Ga0395905_0661546 3300037471 Unclassified 946
273 Ga0395901_0039226 3300038443 Bacteria 4900
274 Ga0395901_0043249 3300038443 Bacteria 4673
275 Ga0395901_0056637 3300038443 Bacteria 4078
276 Ga0395901_0064691 3300038443 Bacteria 3807
277 Ga0395901_0073396 3300038443 Bacteria 3568
278 Ga0395901_0122965 3300038443 Bacteria 2727
279 Ga0395901_0130405 3300038443 Bacteria 2641
280 Ga0395901_0138369 3300038443 Bacteria 2559
281 Ga0395901_0222548 3300038443 Bacteria 1972
282 Ga0395901_0300203 3300038443 Bacteria 1665
283 Ga0395901_0321836 3300038443 Bacteria 1600
284 Ga0395901_0388975 3300038443 Bacteria 1434
285 Ga0395901_0404881 3300038443 Bacteria 1401
286 Ga0395901_0474033 3300038443 Unclassified 1277
287 Ga0395901_0517783 3300038443 Bacteria 1212
288 Ga0395901_0542703 3300038443 Bacteria 1179
289 Ga0436365_0751207 3300039437 Bacteria 13250
290 Ga0439432_020148 3300042006 Bacteria 2219
291 Ga0439449_0020072 3300042007 Bacteria 2504
292 Ga0439458_0000471 3300042157 Bacteria 10281
293 Ga0466972_0056195 3300044658 Unclassified 1893
294 Ga0466966_0009390 3300044684 Bacteria 6475
295 Ga0466966_0052448 3300044684 Bacteria 2590
296 Ga0466966_0192459 3300044684 Bacteria 1236
297 Ga0466961_0069307 3300044693 Bacteria 2239
298 Ga0466961_0093983 3300044693 Bacteria 1892
299 Ga0466961_0125073 3300044693 Bacteria 1613
300 Ga0466963_0014340 3300044694 Bacteria 4886
301 Ga0466963_0060669 3300044694 Bacteria 2526
302 Ga0466963_0086031 3300044694 Bacteria 2135
303 Ga0466964_0196383 3300044706 Bacteria 966
304 Ga0466970_0064585 3300044765 Bacteria 1963
305 Ga0466957_0088673 3300044842 Bacteria 1936
306 Ga0466957_0140227 3300044842 Bacteria 1557
307 Ga0466957_0158488 3300044842 Bacteria 1468
308 Ga0466959_0048629 3300045049 Bacteria 3116
309 Ga0466959_0097876 3300045049 Bacteria 2102
310 Ga0466958_0025449 3300045836 Bacteria 3491
311 Ga0466958_0076880 3300045836 Bacteria 2049
312 Ga0466967_0018793 3300045976 Bacteria 5537
313 Ga0466967_0079795 3300045976 Bacteria 2951
314 Ga0466967_0090215 3300045976 Bacteria 2784
315 Ga0466967_0197316 3300045976 Bacteria 1905
316 Ga0466967_0218706 3300045976 Bacteria 1809
317 Ga0466967_0266876 3300045976 Bacteria 1639
318 Ga0466967_0553305 3300045976 Bacteria 1132
319 Ga0466967_0795176 3300045976 Archaea 939
320 Ga0466967_1026223 3300045976 Bacteria 821
321 Ga0495663_0054718 3300046525 Bacteria 1243
322 Ga0495621_0042913 3300046539 Bacteria 1594
323 Ga0495668_0283501 3300046616 Bacteria 908
324 Ga0495669_0003751 3300046684 Bacteria 6244
325 Ga0495669_0009849 3300046684 Bacteria 4037
326 Ga0495649_0054661 3300046694 Bacteria 2158
327 Ga0495677_0141935 3300047445 Bacteria 922
328 Ga0496100_0057735 3300048903 Bacteria 2543
329 Ga0496101_0003378 3300048904 Bacteria 9953
330 Ga0496101_0018826 3300048904 Bacteria 4703
331 Ga0496106_0001967 3300048909 Bacteria 15448
332 Ga0496107_0003252 3300048910 Bacteria 10813
333 Ga0496107_0225074 3300048910 Bacteria 1396
334 Ga0496108_0001159 3300048911 Bacteria 20578
335 Ga0496108_0013345 3300048911 Bacteria 6699
336 Ga0496109_0049299 3300048912 Bacteria 3833
337 Ga0496109_0253075 3300048912 Bacteria 1659
338 Ga0496110_0038573 3300048913 Bacteria 4157
339 Ga0496111_0004837 3300048914 Bacteria 8544
340 Ga0496111_0285841 3300048914 Bacteria 1223
341 Ga0496112_0002151 3300048915 Bacteria 15652
342 Ga0496112_0011908 3300048915 Bacteria 7966
343 Ga0496113_0004345 3300048916 Bacteria 8685
344 Ga0496114_0034621 3300048917 Bacteria 4168
345 Ga0496115_0002137 3300048918 Bacteria 14132
346 Ga0501199_002416 3300049650 Bacteria 1745
347 Ga0501207_036368 3300049654 Unclassified 844
348 Ga0501217_051752 3300049661 Unclassified 1076
349 Ga0501227_081235 3300049665 Unclassified 850
350 Ga0501233_032981 3300049668 Unclassified 1181
351 Ga0501258_003041 3300049687 Bacteria 1515
352 Ga0501262_019487 3300049759 Unclassified 919
353 nmdc:mga0n895_606747_c1 3300050512 Bacteria 1096
354 Ga0466962_0044294 3300061719 Bacteria 2128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0197316 Ga0466967_0197316_641_1372 212
2 3300005327 Ga0070658_10027893 Ga0070658_100278934 214
3 3300025909 Ga0207705_10021476 Ga0207705_100214764 214
4 3300045976 Ga0466967_0553305 Ga0466967_0553305_429_1097 214
5 3300035171 Ga0373946_0005280 Ga0373946_0005280_2951_3682 217
6 3300025919 Ga0207657_10626958 Ga0207657_106269581 219
7 3300037312 Ga0395899_0258428 Ga0395899_0258428_210_941 220
8 3300037471 Ga0395905_0066299 Ga0395905_0066299_1864_2595 220
9 3300038443 Ga0395901_0542703 Ga0395901_0542703_97_828 220
10 3300045976 Ga0466967_0266876 Ga0466967_0266876_230_937 220
11 3300025909 Ga0207705_10310699 Ga0207705_103106991 222
12 3300025919 Ga0207657_10060263 Ga0207657_100602631 222
13 3300025929 Ga0207664_10197045 Ga0207664_101970452 222
14 3300026067 Ga0207678_10092507 Ga0207678_100925072 222
15 3300005329 Ga0070683_100828654 Ga0070683_1008286541 224
16 3300005331 Ga0070670_100485360 Ga0070670_1004853601 224
17 3300005333 Ga0070677_10087786 Ga0070677_100877862 224
18 3300005366 Ga0070659_100547866 Ga0070659_1005478662 224
19 3300005456 Ga0070678_100005221 Ga0070678_1000052216 224
20 3300005456 Ga0070678_100302349 Ga0070678_1003023491 224
21 3300005564 Ga0070664_100028236 Ga0070664_1000282364 224
22 3300005618 Ga0068864_100012151 Ga0068864_1000121516 224
23 3300006237 Ga0097621_100151043 Ga0097621_1001510431 224
24 3300009177 Ga0105248_10178148 Ga0105248_101781482 224
25 3300025920 Ga0207649_10010537 Ga0207649_100105375 224
26 3300025933 Ga0207706_10014531 Ga0207706_100145316 224
27 3300025933 Ga0207706_10022505 Ga0207706_100225052 224
28 3300025940 Ga0207691_10080230 Ga0207691_100802303 224
29 3300025945 Ga0207679_10002922 Ga0207679_1000292210 224
30 3300026067 Ga0207678_10143134 Ga0207678_101431343 224
31 3300026121 Ga0207683_10003531 Ga0207683_100035318 224
32 3300026121 Ga0207683_10047103 Ga0207683_100471034 224
33 3300044684 Ga0466966_0009390 Ga0466966_0009390_1921_2652 224
34 3300013105 Ga0157369_10047702 Ga0157369_100477024 225
35 3300005327 Ga0070658_10524303 Ga0070658_105243031 226
36 3300005344 Ga0070661_100148845 Ga0070661_1001488453 226
37 3300005356 Ga0070674_100031382 Ga0070674_1000313822 226
38 3300005539 Ga0068853_100221959 Ga0068853_1002219591 226
39 3300005577 Ga0068857_100173877 Ga0068857_1001738772 226
40 3300005614 Ga0068856_100169665 Ga0068856_1001696652 226
41 3300005616 Ga0068852_100699583 Ga0068852_1006995831 226
42 3300009551 Ga0105238_10132860 Ga0105238_101328603 226
43 3300010375 Ga0105239_10595319 Ga0105239_105953192 226
44 3300013307 Ga0157372_10050670 Ga0157372_100506701 226
45 3300025904 Ga0207647_10057545 Ga0207647_100575452 226
46 3300025909 Ga0207705_10148611 Ga0207705_101486112 226
47 3300025912 Ga0207707_10118993 Ga0207707_101189931 226
48 3300025919 Ga0207657_10102996 Ga0207657_101029962 226
49 3300026067 Ga0207678_10098378 Ga0207678_100983782 226
50 3300026078 Ga0207702_10209268 Ga0207702_102092682 226
51 3300037418 Ga0395900_0150944 Ga0395900_0150944_774_1505 226
52 3300038443 Ga0395901_0138369 Ga0395901_0138369_720_1451 226
53 3300005614 Ga0068856_100176309 Ga0068856_1001763091 227
54 3300031731 Ga0307405_10122518 Ga0307405_101225182 227
55 3300031824 Ga0307413_10808427 Ga0307413_108084271 227
56 3300031901 Ga0307406_10014350 Ga0307406_100143503 227
57 3300031903 Ga0307407_10002267 Ga0307407_100022675 227
58 3300031911 Ga0307412_10009076 Ga0307412_100090765 227
59 3300031995 Ga0307409_100005411 Ga0307409_1000054113 227
60 3300032002 Ga0307416_100046760 Ga0307416_1000467603 227
61 3300032005 Ga0307411_10140228 Ga0307411_101402282 227
62 3300032126 Ga0307415_100140530 Ga0307415_1001405302 227
63 3300042006 Ga0439432_020148 Ga0439432_020148_1437_2168 227
64 3300042007 Ga0439449_0020072 Ga0439449_0020072_284_1015 227
65 3300049650 Ga0501199_002416 Ga0501199_002416_571_1302 227
66 3300049654 Ga0501207_036368 Ga0501207_036368_67_798 227
67 3300049661 Ga0501217_051752 Ga0501217_051752_77_808 227
68 3300049665 Ga0501227_081235 Ga0501227_081235_88_819 227
69 3300049668 Ga0501233_032981 Ga0501233_032981_337_1068 227
70 3300049687 Ga0501258_003041 Ga0501258_003041_311_1042 227
71 3300049759 Ga0501262_019487 Ga0501262_019487_53_784 227
72 3300005356 Ga0070674_100052637 Ga0070674_1000526372 228
73 3300005617 Ga0068859_100442171 Ga0068859_1004421712 228
74 3300005841 Ga0068863_100003472 Ga0068863_10000347212 228
75 3300005843 Ga0068860_100005276 Ga0068860_1000052767 228
76 3300005844 Ga0068862_100000461 Ga0068862_10000046121 228
77 3300006931 Ga0097620_100442163 Ga0097620_1004421632 228
78 3300009553 Ga0105249_10000043 Ga0105249_10000043173 228
79 3300025961 Ga0207712_10000057 Ga0207712_1000005764 228
80 3300026088 Ga0207641_10002843 Ga0207641_100028433 228
81 3300028380 Ga0268265_10000120 Ga0268265_1000012040 228
82 3300028381 Ga0268264_10003978 Ga0268264_100039786 228
83 3300031456 Ga0307513_10012571 Ga0307513_100125715 228
84 3300044693 Ga0466961_0069307 Ga0466961_0069307_1444_2175 228
85 3300046684 Ga0495669_0003751 Ga0495669_0003751_2415_3143 228
86 3300037471 Ga0395905_0194322 Ga0395905_0194322_429_1166 229
87 3300044694 Ga0466963_0086031 Ga0466963_0086031_342_1157 233
88 3300045049 Ga0466959_0097876 Ga0466959_0097876_776_1519 233
89 iso_pu_bacteria 2896429255 2896431688 234
90 3300005337 Ga0070682_100184800 Ga0070682_1001848003 235
91 3300005339 Ga0070660_100043181 Ga0070660_1000431812 235
92 3300005344 Ga0070661_100023470 Ga0070661_1000234704 235
93 3300005355 Ga0070671_100009253 Ga0070671_1000092534 235
94 3300005364 Ga0070673_100060752 Ga0070673_1000607522 235
95 3300005366 Ga0070659_100046514 Ga0070659_1000465144 235
96 3300005455 Ga0070663_100589082 Ga0070663_1005890822 235
97 3300005530 Ga0070679_100043335 Ga0070679_1000433353 235
98 3300005539 Ga0068853_100034504 Ga0068853_1000345043 235
99 3300005543 Ga0070672_100209756 Ga0070672_1002097562 235
100 3300005564 Ga0070664_100152365 Ga0070664_1001523653 235
101 3300005618 Ga0068864_100012283 Ga0068864_1000122833 235
102 3300009177 Ga0105248_10000790 Ga0105248_100007908 235
103 3300013100 Ga0157373_10081302 Ga0157373_100813023 235
104 3300013102 Ga0157371_10336383 Ga0157371_103363832 235
105 3300025904 Ga0207647_10208830 Ga0207647_102088302 235
106 3300025909 Ga0207705_10010791 Ga0207705_100107914 235
107 3300025912 Ga0207707_10060449 Ga0207707_100604494 235
108 3300025919 Ga0207657_10005314 Ga0207657_1000531410 235
109 3300025921 Ga0207652_10035959 Ga0207652_100359594 235
110 3300025931 Ga0207644_10013812 Ga0207644_100138123 235
111 3300025932 Ga0207690_10240755 Ga0207690_102407552 235
112 3300025941 Ga0207711_10003863 Ga0207711_100038632 235
113 3300025960 Ga0207651_10126984 Ga0207651_101269842 235
114 3300026095 Ga0207676_10005397 Ga0207676_100053979 235
115 3300037418 Ga0395900_0304828 Ga0395900_0304828_829_1554 235
116 3300044842 Ga0466957_0088673 Ga0466957_0088673_233_958 235
117 3300048903 Ga0496100_0057735 Ga0496100_0057735_733_1458 235
118 3300048904 Ga0496101_0003378 Ga0496101_0003378_2299_3024 235
119 3300048909 Ga0496106_0001967 Ga0496106_0001967_3077_3802 235
120 3300048910 Ga0496107_0003252 Ga0496107_0003252_3185_3910 235
121 3300048911 Ga0496108_0013345 Ga0496108_0013345_1962_2687 235
122 3300048912 Ga0496109_0049299 Ga0496109_0049299_188_913 235
123 3300048913 Ga0496110_0038573 Ga0496110_0038573_2948_3673 235
124 3300048914 Ga0496111_0004837 Ga0496111_0004837_4716_5441 235
125 3300048915 Ga0496112_0011908 Ga0496112_0011908_3534_4259 235
126 3300048916 Ga0496113_0004345 Ga0496113_0004345_391_1116 235
127 3300005327 Ga0070658_10215655 Ga0070658_102156553 236
128 3300005331 Ga0070670_100252742 Ga0070670_1002527422 236
129 3300005338 Ga0068868_100000006 Ga0068868_100000006113 236
130 3300005338 Ga0068868_100137793 Ga0068868_1001377933 236
131 3300005339 Ga0070660_100007343 Ga0070660_1000073438 236
132 3300005339 Ga0070660_100346112 Ga0070660_1003461121 236
133 3300005339 Ga0070660_100532561 Ga0070660_1005325611 236
134 3300005354 Ga0070675_100007132 Ga0070675_1000071324 236
135 3300005366 Ga0070659_100000005 Ga0070659_10000000517 236
136 3300005435 Ga0070714_100040856 Ga0070714_1000408564 236
137 3300005457 Ga0070662_100341715 Ga0070662_1003417152 236
138 3300005539 Ga0068853_100415138 Ga0068853_1004151382 236
139 3300005544 Ga0070686_100000180 Ga0070686_10000018044 236
140 3300005546 Ga0070696_100373202 Ga0070696_1003732022 236
141 3300005548 Ga0070665_100000145 Ga0070665_100000145124 236
142 3300005614 Ga0068856_100123647 Ga0068856_1001236473 236
143 3300005841 Ga0068863_100012682 Ga0068863_1000126823 236
144 3300006358 Ga0068871_100420864 Ga0068871_1004208642 236
145 3300009098 Ga0105245_10026769 Ga0105245_100267692 236
146 3300009098 Ga0105245_10385962 Ga0105245_103859622 236
147 3300013100 Ga0157373_10090735 Ga0157373_100907353 236
148 3300013105 Ga0157369_10344552 Ga0157369_103445522 236
149 3300013307 Ga0157372_10652909 Ga0157372_106529092 236
150 3300021384 Ga0213876_10081146 Ga0213876_100811462 236
151 3300025907 Ga0207645_10046980 Ga0207645_100469803 236
152 3300025909 Ga0207705_10431032 Ga0207705_104310322 236
153 3300025909 Ga0207705_10527608 Ga0207705_105276082 236
154 3300025919 Ga0207657_10000695 Ga0207657_1000069551 236
155 3300025919 Ga0207657_10012786 Ga0207657_100127867 236
156 3300025920 Ga0207649_10040102 Ga0207649_100401023 236
157 3300025926 Ga0207659_10077028 Ga0207659_100770282 236
158 3300025927 Ga0207687_10184829 Ga0207687_101848292 236
159 3300025932 Ga0207690_10000002 Ga0207690_10000002662 236
160 3300025932 Ga0207690_10000033 Ga0207690_1000003317 236
161 3300026023 Ga0207677_10000043 Ga0207677_1000004399 236
162 3300026041 Ga0207639_10232671 Ga0207639_102326712 236
163 3300026067 Ga0207678_10131806 Ga0207678_101318063 236
164 3300026078 Ga0207702_10402574 Ga0207702_104025742 236
165 3300026088 Ga0207641_10010980 Ga0207641_100109802 236
166 3300026142 Ga0207698_10343892 Ga0207698_103438922 236
167 3300028379 Ga0268266_10000173 Ga0268266_1000017325 236
168 3300031824 Ga0307413_10295600 Ga0307413_102956002 236
169 3300031824 Ga0307413_10368303 Ga0307413_103683032 236
170 3300031852 Ga0307410_10092414 Ga0307410_100924142 236
171 3300032004 Ga0307414_10055458 Ga0307414_100554583 236
172 3300032004 Ga0307414_10185430 Ga0307414_101854302 236
173 3300032005 Ga0307411_10128490 Ga0307411_101284902 236
174 3300032126 Ga0307415_100750443 Ga0307415_1007504432 236
175 3300039437 Ga0436365_0751207 Ga0436365_0751207_841_1569 236
176 3300044706 Ga0466964_0196383 Ga0466964_0196383_109_837 236
177 3300044842 Ga0466957_0140227 Ga0466957_0140227_94_837 236
178 3300046616 Ga0495668_0283501 Ga0495668_0283501_89_826 236
179 3300046694 Ga0495649_0054661 Ga0495649_0054661_877_1605 236
180 3300048910 Ga0496107_0225074 Ga0496107_0225074_168_911 236
181 3300048914 Ga0496111_0285841 Ga0496111_0285841_160_888 236
182 3300050512 nmdc:mga0n895_606747_c1 nmdc:mga0n895_606747_c1_19_747 236
183 3300005327 Ga0070658_10212478 Ga0070658_102124782 237
184 3300005339 Ga0070660_100089429 Ga0070660_1000894292 237
185 3300005339 Ga0070660_100125882 Ga0070660_1001258822 237
186 3300005339 Ga0070660_100221084 Ga0070660_1002210842 237
187 3300005341 Ga0070691_10001627 Ga0070691_100016279 237
188 3300005344 Ga0070661_100085637 Ga0070661_1000856372 237
189 3300005355 Ga0070671_100092177 Ga0070671_1000921771 237
190 3300005435 Ga0070714_100103995 Ga0070714_1001039951 237
191 3300005436 Ga0070713_100018111 Ga0070713_1000181113 237
192 3300005455 Ga0070663_100334133 Ga0070663_1003341332 237
193 3300005456 Ga0070678_100165193 Ga0070678_1001651932 237
194 3300005457 Ga0070662_100123435 Ga0070662_1001234353 237
195 3300005539 Ga0068853_100044692 Ga0068853_1000446923 237
196 3300005563 Ga0068855_100116879 Ga0068855_1001168791 237
197 3300005563 Ga0068855_100303123 Ga0068855_1003031232 237
198 3300005577 Ga0068857_100066083 Ga0068857_1000660832 237
199 3300005578 Ga0068854_100013602 Ga0068854_1000136025 237
200 3300005614 Ga0068856_100221058 Ga0068856_1002210582 237
201 3300005614 Ga0068856_100343679 Ga0068856_1003436792 237
202 3300005614 Ga0068856_100615922 Ga0068856_1006159222 237
203 3300005616 Ga0068852_100014775 Ga0068852_1000147753 237
204 3300005616 Ga0068852_100039967 Ga0068852_1000399673 237
205 3300005985 Ga0081539_10035565 Ga0081539_100355653 237
206 3300006028 Ga0070717_10005021 Ga0070717_100050218 237
207 3300009093 Ga0105240_10097594 Ga0105240_100975943 237
208 3300009093 Ga0105240_10504577 Ga0105240_105045772 237
209 3300009176 Ga0105242_10321618 Ga0105242_103216182 237
210 3300013100 Ga0157373_10045842 Ga0157373_100458422 237
211 3300013100 Ga0157373_10093586 Ga0157373_100935862 237
212 3300013104 Ga0157370_10003139 Ga0157370_100031396 237
213 3300013104 Ga0157370_10039747 Ga0157370_100397472 237
214 3300013104 Ga0157370_10198146 Ga0157370_101981462 237
215 3300013105 Ga0157369_10038034 Ga0157369_100380342 237
216 3300013105 Ga0157369_10078332 Ga0157369_100783321 237
217 3300013105 Ga0157369_10262971 Ga0157369_102629712 237
218 3300013307 Ga0157372_10047207 Ga0157372_100472073 237
219 3300013307 Ga0157372_10285849 Ga0157372_102858492 237
220 3300014497 Ga0182008_10072375 Ga0182008_100723751 237
221 3300025321 Ga0207656_10105211 Ga0207656_101052112 237
222 3300025909 Ga0207705_10060126 Ga0207705_100601262 237
223 3300025909 Ga0207705_10078700 Ga0207705_100787002 237
224 3300025913 Ga0207695_10038379 Ga0207695_100383794 237
225 3300025913 Ga0207695_10402815 Ga0207695_104028152 237
226 3300025919 Ga0207657_10047294 Ga0207657_100472942 237
227 3300025920 Ga0207649_10024619 Ga0207649_100246193 237
228 3300025920 Ga0207649_10083210 Ga0207649_100832102 237
229 3300025928 Ga0207700_10089918 Ga0207700_100899182 237
230 3300025929 Ga0207664_10070051 Ga0207664_100700513 237
231 3300025932 Ga0207690_10003116 Ga0207690_100031163 237
232 3300025933 Ga0207706_10074085 Ga0207706_100740853 237
233 3300025949 Ga0207667_10143700 Ga0207667_101437002 237
234 3300025949 Ga0207667_10770716 Ga0207667_107707161 237
235 3300025981 Ga0207640_10258666 Ga0207640_102586661 237
236 3300025986 Ga0207658_10248682 Ga0207658_102486822 237
237 3300026041 Ga0207639_10123655 Ga0207639_101236552 237
238 3300026078 Ga0207702_10079508 Ga0207702_100795082 237
239 3300026078 Ga0207702_10100560 Ga0207702_101005602 237
240 3300026078 Ga0207702_10254935 Ga0207702_102549352 237
241 3300026089 Ga0207648_10198996 Ga0207648_101989962 237
242 3300026116 Ga0207674_10059769 Ga0207674_100597693 237
243 3300026116 Ga0207674_10123927 Ga0207674_101239272 237
244 3300026121 Ga0207683_10179405 Ga0207683_101794051 237
245 3300026142 Ga0207698_10013923 Ga0207698_100139233 237
246 3300026142 Ga0207698_10028197 Ga0207698_100281973 237
247 3300026142 Ga0207698_10309069 Ga0207698_103090691 237
248 3300031852 Ga0307410_10013917 Ga0307410_100139171 237
249 3300031901 Ga0307406_10338711 Ga0307406_103387112 237
250 3300032002 Ga0307416_100238431 Ga0307416_1002384312 237
251 3300032005 Ga0307411_10662374 Ga0307411_106623741 237
252 3300037312 Ga0395899_0005589 Ga0395899_0005589_6717_7448 237
253 3300037312 Ga0395899_0018878 Ga0395899_0018878_1388_2119 237
254 3300037312 Ga0395899_0076157 Ga0395899_0076157_147_878 237
255 3300037312 Ga0395899_0112139 Ga0395899_0112139_416_1147 237
256 3300037312 Ga0395899_0153280 Ga0395899_0153280_68_799 237
257 3300037312 Ga0395899_0277196 Ga0395899_0277196_375_1106 237
258 3300037418 Ga0395900_0076171 Ga0395900_0076171_982_1713 237
259 3300037418 Ga0395900_0081720 Ga0395900_0081720_1720_2451 237
260 3300037418 Ga0395900_0091383 Ga0395900_0091383_955_1686 237
261 3300037418 Ga0395900_0099219 Ga0395900_0099219_929_1660 237
262 3300037418 Ga0395900_0143204 Ga0395900_0143204_706_1437 237
263 3300037418 Ga0395900_0145949 Ga0395900_0145949_599_1330 237
264 3300037418 Ga0395900_0204997 Ga0395900_0204997_398_1129 237
265 3300037418 Ga0395900_0235278 Ga0395900_0235278_605_1336 237
266 3300037418 Ga0395900_0385070 Ga0395900_0385070_350_1081 237
267 3300037418 Ga0395900_0919778 Ga0395900_0919778_56_787 237
268 3300037466 Ga0395898_0026096 Ga0395898_0026096_1792_2523 237
269 3300037466 Ga0395898_0073299 Ga0395898_0073299_2528_3259 237
270 3300037466 Ga0395898_0214289 Ga0395898_0214289_109_840 237
271 3300037466 Ga0395898_0304060 Ga0395898_0304060_448_1179 237
272 3300037466 Ga0395898_0325101 Ga0395898_0325101_703_1434 237
273 3300037466 Ga0395898_0346375 Ga0395898_0346375_616_1347 237
274 3300037466 Ga0395898_0421118 Ga0395898_0421118_192_923 237
275 3300037471 Ga0395905_0004174 Ga0395905_0004174_1369_2100 237
276 3300037471 Ga0395905_0015279 Ga0395905_0015279_77_808 237
277 3300037471 Ga0395905_0024357 Ga0395905_0024357_1672_2403 237
278 3300037471 Ga0395905_0063967 Ga0395905_0063967_1944_2675 237
279 3300037471 Ga0395905_0229434 Ga0395905_0229434_870_1601 237
280 3300037471 Ga0395905_0237154 Ga0395905_0237154_362_1093 237
281 3300037471 Ga0395905_0317534 Ga0395905_0317534_626_1357 237
282 3300037471 Ga0395905_0403840 Ga0395905_0403840_77_808 237
283 3300037471 Ga0395905_0427793 Ga0395905_0427793_350_1081 237
284 3300037471 Ga0395905_0661546 Ga0395905_0661546_140_871 237
285 3300038443 Ga0395901_0039226 Ga0395901_0039226_1503_2234 237
286 3300038443 Ga0395901_0043249 Ga0395901_0043249_2028_2759 237
287 3300038443 Ga0395901_0056637 Ga0395901_0056637_1967_2698 237
288 3300038443 Ga0395901_0064691 Ga0395901_0064691_364_1095 237
289 3300038443 Ga0395901_0222548 Ga0395901_0222548_445_1176 237
290 3300038443 Ga0395901_0388975 Ga0395901_0388975_563_1294 237
291 3300038443 Ga0395901_0517783 Ga0395901_0517783_388_1119 237
292 3300042157 Ga0439458_0000471 Ga0439458_0000471_8082_8813 237
293 3300044684 Ga0466966_0052448 Ga0466966_0052448_1300_2031 237
294 3300044684 Ga0466966_0192459 Ga0466966_0192459_250_981 237
295 3300044693 Ga0466961_0093983 Ga0466961_0093983_863_1594 237
296 3300044693 Ga0466961_0125073 Ga0466961_0125073_233_964 237
297 3300044694 Ga0466963_0060669 Ga0466963_0060669_894_1625 237
298 3300044765 Ga0466970_0064585 Ga0466970_0064585_233_964 237
299 3300044842 Ga0466957_0158488 Ga0466957_0158488_672_1403 237
300 3300045049 Ga0466959_0048629 Ga0466959_0048629_539_1270 237
301 3300045836 Ga0466958_0025449 Ga0466958_0025449_1291_2022 237
302 3300045836 Ga0466958_0076880 Ga0466958_0076880_642_1373 237
303 3300045976 Ga0466967_0090215 Ga0466967_0090215_308_1039 237
304 3300045976 Ga0466967_0795176 Ga0466967_0795176_191_922 237
305 3300046525 Ga0495663_0054718 Ga0495663_0054718_56_787 237
306 3300046539 Ga0495621_0042913 Ga0495621_0042913_552_1283 237
307 3300046684 Ga0495669_0009849 Ga0495669_0009849_976_1707 237
308 3300047445 Ga0495677_0141935 Ga0495677_0141935_121_852 237
309 3300048912 Ga0496109_0253075 Ga0496109_0253075_545_1276 237
310 3300048915 Ga0496112_0002151 Ga0496112_0002151_5668_6399 237
311 3300061719 Ga0466962_0044294 Ga0466962_0044294_183_914 237
312 3300005327 Ga0070658_10010986 Ga0070658_100109866 238
313 3300005327 Ga0070658_10059559 Ga0070658_100595592 238
314 3300005327 Ga0070658_10343348 Ga0070658_103433482 238
315 3300005339 Ga0070660_100127468 Ga0070660_1001274683 238
316 3300005355 Ga0070671_100018915 Ga0070671_1000189152 238
317 3300013104 Ga0157370_10050352 Ga0157370_100503524 238
318 3300025909 Ga0207705_10069071 Ga0207705_100690712 238
319 3300025919 Ga0207657_10003079 Ga0207657_1000307912 238
320 3300025931 Ga0207644_10017089 Ga0207644_100170896 238
321 3300037312 Ga0395899_0026827 Ga0395899_0026827_73_813 238
322 3300037312 Ga0395899_0092255 Ga0395899_0092255_118_852 238
323 3300037312 Ga0395899_0331193 Ga0395899_0331193_99_857 238
324 3300037418 Ga0395900_0046080 Ga0395900_0046080_3473_4207 238
325 3300037418 Ga0395900_0124681 Ga0395900_0124681_566_1300 238
326 3300037418 Ga0395900_0131966 Ga0395900_0131966_484_1218 238
327 3300037418 Ga0395900_0134331 Ga0395900_0134331_222_956 238
328 3300037418 Ga0395900_0137253 Ga0395900_0137253_1367_2107 238
329 3300037466 Ga0395898_0009072 Ga0395898_0009072_9645_10385 238
330 3300037466 Ga0395898_0096647 Ga0395898_0096647_308_1042 238
331 3300037466 Ga0395898_0398913 Ga0395898_0398913_483_1223 238
332 3300037471 Ga0395905_0061445 Ga0395905_0061445_1367_2107 238
333 3300037471 Ga0395905_0096591 Ga0395905_0096591_215_949 238
334 3300037471 Ga0395905_0105845 Ga0395905_0105845_1342_2076 238
335 3300037471 Ga0395905_0122545 Ga0395905_0122545_369_1103 238
336 3300037471 Ga0395905_0138201 Ga0395905_0138201_145_885 238
337 3300037471 Ga0395905_0259186 Ga0395905_0259186_70_804 238
338 3300037471 Ga0395905_0500808 Ga0395905_0500808_50_790 238
339 3300038443 Ga0395901_0073396 Ga0395901_0073396_1421_2161 238
340 3300038443 Ga0395901_0122965 Ga0395901_0122965_1596_2330 238
341 3300038443 Ga0395901_0130405 Ga0395901_0130405_566_1300 238
342 3300038443 Ga0395901_0300203 Ga0395901_0300203_820_1554 238
343 3300038443 Ga0395901_0321836 Ga0395901_0321836_422_1180 238
344 3300038443 Ga0395901_0404881 Ga0395901_0404881_556_1290 238
345 3300038443 Ga0395901_0474033 Ga0395901_0474033_250_984 238
346 3300044658 Ga0466972_0056195 Ga0466972_0056195_39_779 238
347 3300044694 Ga0466963_0014340 Ga0466963_0014340_2856_3599 238
348 3300045976 Ga0466967_0018793 Ga0466967_0018793_1405_2145 238
349 3300045976 Ga0466967_0079795 Ga0466967_0079795_139_882 238
350 3300045976 Ga0466967_0218706 Ga0466967_0218706_882_1622 238
351 3300045976 Ga0466967_1026223 Ga0466967_1026223_49_789 238
352 3300048904 Ga0496101_0018826 Ga0496101_0018826_3601_4341 238
353 3300048911 Ga0496108_0001159 Ga0496108_0001159_14081_14830 238
354 3300048917 Ga0496114_0034621 Ga0496114_0034621_1094_1834 238
355 3300048918 Ga0496115_0002137 Ga0496115_0002137_12953_13693 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

62

152

0.88

PF13649

Methyltransf_25

Methyltransferase domain

61

148

0.82

PF08242

Methyltransf_12

Methyltransferase domain

62

150

0.79

PF13489

Methyltransf_23

Methyltransferase domain

38

193

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8486 27 170
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.8413 26 169
6kji-assembly3.cif.gz_C crystal structure of psof with sah 0.8363 23 163
6kji-assembly2.cif.gz_B crystal structure of psof with sah 0.8312 23 163
7nmk-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis with bound methylation product 1-methoxyquinolin-4(1h)-one 0.8272 26 169
ID Description Score Start End Superfamily
af_P71805_5_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8868 40 169 3.40.50.150
af_Q8IJC4_363_592_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8781 26 137 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8746 36 133 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8693 37 136 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8621 23 173 3.40.50.150
ID Description Score Start End GO Terms
AF-Q9A4E3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9388 1 235 GO:0008168
AF-Q9A4E3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9236 1 235 GO:0008168
AF-A0A2K8L3V0-F1-model_v4 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1, 4-benzoquinol methylase 0.9189 1 236 GO:0008168
GO:0032259
AF-A0A440CX53-F1-model_v4 deleted 0.9177 1 233
AF-A0A7V1FW38-F1-model_v4 Class I SAM-dependent methyltransferase 0.9166 1 236 GO:0008757
GO:0016020
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.13 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map