F420189

General Info

Members Datasets Scaffolds Average Seq Length
355 268 335 112

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100523907|Ga0307408_1005239072
Length 121
Sequence MSALPMNSTDSLDWTDICAVDDILPNTGVCALVADLHVAVFRTGSDQFFAIDNVDPKSGASVLSRGLIGSLSGRVVVASPLYKNHFDLQTGECLEMPEHSVRTYSVRAVRGRVSVACAPAA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
6 2643221658 Variovorax sp. Root411 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2643221683 Variovorax sp. Root473 Isolate Unclassified
9 2643221717 Acidovorax sp. Root267 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2738543019 Variovorax sp. GV040 Isolate Unclassified
15 2816332133 Acidovorax radicis 2721A Isolate Unclassified
16 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
17 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
18 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
19 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
20 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
162 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
163 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
164 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
167 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
168 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
169 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
170 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
171 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
172 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
173 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
231 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
232 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
233 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
234 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
235 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
236 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
238 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
239 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
244 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
245 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
246 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
247 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
250 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
251 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
252 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
253 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
254 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
255 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
256 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
257 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
258 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
265 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
266 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.56
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.59
Nodule 0.56
Rhizoplane 7.89
Rhizosphere 61.69
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10008387 3300003187 Bacteria 4974
2 JGI25151J46595_10119379 3300003187 Bacteria 674
3 Ga0055524_1000097 3300003775 Bacteria 108145
4 Ga0055536_1000866 3300003781 Bacteria 19673
5 Ga0055536_1011456 3300003781 Bacteria 3400
6 Ga0055534_1001970 3300003784 Bacteria 7513
7 Ga0055534_1025278 3300003784 Bacteria 955
8 Ga0055530_10000258 3300003791 Bacteria 47803
9 Ga0055530_10070956 3300003791 Bacteria 751
10 Ga0055540_1000023 3300003792 Bacteria 201131
11 Ga0055540_1001938 3300003792 Bacteria 11571
12 Ga0055540_1002300 3300003792 Bacteria 10269
13 Ga0055540_1019820 3300003792 Bacteria 1801
14 Ga0055540_1071784 3300003792 Bacteria 675
15 Ga0055531_10000089 3300003794 Bacteria 100485
16 Ga0055531_10001399 3300003794 Bacteria 17860
17 Ga0055531_10004171 3300003794 Bacteria 8907
18 Ga0065165_1048254 3300005262 Bacteria 1224
19 Ga0065714_10173615 3300005288 Bacteria 993
20 Ga0070658_11302962 3300005327 Bacteria 631
21 Ga0070690_100478318 3300005330 Bacteria 928
22 Ga0070670_101104617 3300005331 Bacteria 723
23 Ga0070677_10386631 3300005333 Bacteria 734
24 Ga0068869_100914604 3300005334 Bacteria 760
25 Ga0070666_10470997 3300005335 Bacteria 909
26 Ga0070682_100043143 3300005337 Bacteria 2788
27 Ga0070668_100999238 3300005347 Bacteria 752
28 Ga0070675_100351091 3300005354 Bacteria 1308
29 Ga0070671_101436930 3300005355 Bacteria 610
30 Ga0070674_100074936 3300005356 Bacteria 2402
31 Ga0070673_100335311 3300005364 Bacteria 1339
32 Ga0070659_100152682 3300005366 Bacteria 1885
33 Ga0070667_100009271 3300005367 Bacteria 8155
34 Ga0070663_100048284 3300005455 Bacteria 3018
35 Ga0070678_101015632 3300005456 Bacteria 763
36 Ga0070678_101217832 3300005456 Bacteria 698
37 Ga0070678_101718280 3300005456 Bacteria 591
38 Ga0070662_100016291 3300005457 Bacteria 4988
39 Ga0070685_10135167 3300005466 Bacteria 1546
40 Ga0068853_100084538 3300005539 Bacteria 2780
41 Ga0070672_100019299 3300005543 Bacteria 4946
42 Ga0070672_100612794 3300005543 Bacteria 949
43 Ga0070665_100213874 3300005548 Bacteria 1929
44 Ga0068856_100283636 3300005614 Bacteria 1673
45 Ga0068852_100015025 3300005616 Bacteria 5985
46 Ga0068864_100371889 3300005618 Bacteria 1353
47 Ga0075364_10178838 3300006051 Bacteria 1435
48 Ga0075367_10611538 3300006178 Bacteria 693
49 Ga0075366_10354701 3300006195 Bacteria 900
50 Ga0075366_10578480 3300006195 Bacteria 696
51 Ga0097621_100105313 3300006237 Bacteria 2378
52 Ga0097621_101379176 3300006237 Bacteria 667
53 Ga0075370_10031710 3300006353 Bacteria 2951
54 Ga0075370_10041970 3300006353 Bacteria 2583
55 Ga0068871_100112673 3300006358 Bacteria 2290
56 Ga0068865_100305935 3300006881 Bacteria 1274
57 Ga0075436_100531624 3300006914 Bacteria 862
58 Ga0079104_1000019 3300006946 Bacteria 269313
59 Ga0105244_10005964 3300009036 Bacteria 7986
60 Ga0105245_10868164 3300009098 Bacteria 943
61 Ga0105245_10993297 3300009098 Bacteria 883
62 Ga0105243_10013431 3300009148 Bacteria 6193
63 Ga0105243_10019807 3300009148 Bacteria 5102
64 Ga0105243_10111720 3300009148 Bacteria 2288
65 Ga0105243_11093256 3300009148 Bacteria 805
66 Ga0105243_11288786 3300009148 Bacteria 747
67 Ga0105243_12310170 3300009148 Bacteria 575
68 Ga0105241_10212351 3300009174 Bacteria 1622
69 Ga0105242_10627766 3300009176 Bacteria 1042
70 Ga0105242_11896018 3300009176 Bacteria 636
71 Ga0105248_10768284 3300009177 Bacteria 1087
72 Ga0105237_10042835 3300009545 Bacteria 4563
73 Ga0105238_10022486 3300009551 Bacteria 6427
74 Ga0105238_10837939 3300009551 Bacteria 936
75 Ga0105249_11968476 3300009553 Bacteria 657
76 Ga0105239_10237048 3300010375 Bacteria 2048
77 Ga0105246_10018369 3300011119 Bacteria 4456
78 Ga0157347_1000106 3300012502 Bacteria 4016
79 Ga0157373_10053282 3300013100 Bacteria 2877
80 Ga0157371_10573915 3300013102 Bacteria 837
81 Ga0157370_10254862 3300013104 Bacteria 1623
82 Ga0157378_11397007 3300013297 Bacteria 743
83 Ga0163162_10155841 3300013306 Bacteria 2404
84 Ga0182008_10008359 3300014497 Bacteria 5652
85 Ga0182008_10066822 3300014497 Bacteria 1769
86 Ga0157376_10539017 3300014969 Bacteria 1153
87 Ga0157376_11570849 3300014969 Bacteria 692
88 Ga0182006_1002881 3300015261 Bacteria 9141
89 Ga0182006_1025466 3300015261 Bacteria 2430
90 Ga0182007_10001242 3300015262 Bacteria 13839
91 Ga0182007_10001836 3300015262 Bacteria 11069
92 Ga0182005_1105959 3300015265 Bacteria 791
93 Ga0183362_10002 3300015683 Bacteria 1432711
94 Ga0163161_10084413 3300017792 Bacteria 2342
95 Ga0209565_1015126 3300025263 Bacteria 1748
96 Ga0209673_1012540 3300025273 Bacteria 3408
97 Ga0209675_1002411 3300025291 Bacteria 9642
98 Ga0209675_1003753 3300025291 Bacteria 7036
99 Ga0209675_1011387 3300025291 Bacteria 2954
100 Ga0209676_1000420 3300025292 Bacteria 74714
101 Ga0209676_1001131 3300025292 Bacteria 29266
102 Ga0209676_1005349 3300025292 Bacteria 6756
103 Ga0209025_1000694 3300025294 Bacteria 57446
104 Ga0209025_1015444 3300025294 Bacteria 4604
105 Ga0209564_1081157 3300025295 Bacteria 633
106 Ga0209050_1000447 3300025298 Bacteria 74743
107 Ga0209050_1004659 3300025298 Bacteria 9122
108 Ga0209050_1005003 3300025298 Bacteria 8616
109 Ga0209050_1013101 3300025298 Bacteria 3724
110 Ga0209050_1026263 3300025298 Bacteria 1955
111 Ga0209050_1038161 3300025298 Bacteria 1374
112 Ga0209256_1000051 3300025299 Bacteria 307241
113 Ga0209051_1000079 3300025303 Bacteria 201183
114 Ga0209051_1000285 3300025303 Bacteria 82429
115 Ga0209051_1001282 3300025303 Bacteria 22316
116 Ga0209051_1011655 3300025303 Bacteria 4320
117 Ga0209051_1076790 3300025303 Bacteria 980
118 Ga0209257_1000021 3300025304 Bacteria 771986
119 Ga0209257_1000183 3300025304 Bacteria 156618
120 Ga0209257_1000417 3300025304 Bacteria 82249
121 Ga0209257_1004570 3300025304 Bacteria 10587
122 Ga0209257_1037105 3300025304 Bacteria 1489
123 Ga0209257_1048898 3300025304 Bacteria 1207
124 Ga0207655_1004540 3300025728 Bacteria 9787
125 Ga0207680_10234959 3300025903 Bacteria 1261
126 Ga0207647_10125135 3300025904 Bacteria 1513
127 Ga0207671_10072333 3300025914 Bacteria 2573
128 Ga0207694_10055019 3300025924 Bacteria 3089
129 Ga0207694_10084977 3300025924 Bacteria 2490
130 Ga0207687_11166729 3300025927 Bacteria 662
131 Ga0207644_11457519 3300025931 Bacteria 575
132 Ga0207690_10092012 3300025932 Bacteria 2145
133 Ga0207706_10010058 3300025933 Bacteria 8664
134 Ga0207709_10001611 3300025935 Bacteria 15373
135 Ga0207709_10002063 3300025935 Bacteria 12988
136 Ga0207669_10025596 3300025937 Bacteria 3193
137 Ga0207691_10498018 3300025940 Bacteria 1035
138 Ga0207691_10915922 3300025940 Bacteria 733
139 Ga0207689_10794612 3300025942 Bacteria 799
140 Ga0207679_10009449 3300025945 Bacteria 6247
141 Ga0207651_10425884 3300025960 Bacteria 1134
142 Ga0207640_10018827 3300025981 Bacteria 4065
143 Ga0207658_10016169 3300025986 Bacteria 5127
144 Ga0207639_10076889 3300026041 Bacteria 2630
145 Ga0207678_10229806 3300026067 Bacteria 1588
146 Ga0207702_10131418 3300026078 Bacteria 2253
147 Ga0207648_10471751 3300026089 Bacteria 1145
148 Ga0207683_11005656 3300026121 Bacteria 774
149 Ga0207683_12144110 3300026121 Bacteria 507
150 Ga0207698_10188090 3300026142 Bacteria 1836
151 Ga0209281_1000160 3300027111 Bacteria 161071
152 Ga0209983_1089049 3300027665 Bacteria 694
153 Ga0209974_10004821 3300027876 Bacteria 4782
154 Ga0268266_10113906 3300028379 Bacteria 2399
155 Ga0268266_10381177 3300028379 Bacteria 1330
156 Ga0268264_11004655 3300028381 Bacteria 841
157 Ga0307515_10000757 3300028794 Bacteria 74840
158 Ga0307515_10116054 3300028794 Bacteria 3077
159 Ga0265332_10001890 3300031238 Bacteria 11103
160 Ga0307513_10006906 3300031456 Bacteria 14776
161 Ga0307513_10056339 3300031456 Bacteria 4197
162 Ga0307408_100000554 3300031548 Bacteria 32251
163 Ga0307408_100523907 3300031548 Bacteria 1041
164 Ga0307408_102347548 3300031548 Bacteria 517
165 Ga0307514_10001530 3300031649 Bacteria 27605
166 Ga0307405_10003092 3300031731 Bacteria 7553
167 Ga0307405_10138913 3300031731 Bacteria 1691
168 Ga0307405_10554250 3300031731 Bacteria 931
169 Ga0307405_11678020 3300031731 Bacteria 562
170 Ga0307406_10001437 3300031901 Bacteria 13193
171 Ga0307412_10943443 3300031911 Bacteria 759
172 Ga0307412_11208551 3300031911 Bacteria 677
173 Ga0307409_100168878 3300031995 Bacteria 1923
174 Ga0307416_101127119 3300032002 Bacteria 889
175 Ga0307414_10002946 3300032004 Bacteria 8998
176 Ga0307411_10001757 3300032005 Bacteria 9141
177 Ga0307411_10240663 3300032005 Bacteria 1416
178 Ga0307510_10253706 3300033180 Bacteria 1245
179 Ga0373948_0046067 3300034817 Bacteria 925
180 Ga0373959_0025486 3300034820 Bacteria 1162
181 Ga0373940_0009067 3300035088 Bacteria 2302
182 Ga0373939_0000008 3300035114 Bacteria 77597
183 Ga0373960_0004335 3300035121 Bacteria 3245
184 Ga0373961_0188803 3300035241 Bacteria 721
185 Ga0373962_0033033 3300035242 Bacteria 1426
186 Ga0373931_0000530 3300035691 Bacteria 15634
187 Ga0395905_0002115 3300037471 Bacteria 22548
188 Ga0395905_0029372 3300037471 Bacteria 5180
189 Ga0436361_0624890 3300039447 Bacteria 6693
190 Ga0451791_1293207 3300041451 Bacteria 555
191 Ga0451793_1892597 3300041452 Bacteria 813
192 Ga0451797_0199688 3300041453 Bacteria 1145
193 Ga0451797_0676736 3300041453 Bacteria 862
194 Ga0451795_1117004 3300041456 Bacteria 641
195 Ga0451807_0732298 3300041486 Bacteria 735
196 Ga0451807_0895353 3300041486 Bacteria 928
197 Ga0451841_0218182 3300041498 Bacteria 520
198 Ga0451847_0136608 3300041503 Bacteria 682
199 Ga0451853_0633760 3300041512 Bacteria 607
200 Ga0439431_0116288 3300041997 Bacteria 744
201 Ga0439445_0058177 3300042004 Bacteria 1053
202 Ga0439445_0098487 3300042004 Bacteria 828
203 Ga0439449_0278773 3300042007 Bacteria 630
204 Ga0439455_0009298 3300042012 Bacteria 2128
205 Ga0439463_174154 3300042016 Bacteria 558
206 Ga0450911_000187 3300042115 Bacteria 24656
207 Ga0450917_004808 3300042120 Bacteria 994
208 Ga0450919_001957 3300042121 Bacteria 2677
209 Ga0450888_019304 3300042126 Bacteria 858
210 Ga0450890_001477 3300042127 Bacteria 3379
211 Ga0450891_000116 3300042129 Bacteria 7147
212 Ga0450892_001314 3300042130 Bacteria 2503
213 Ga0450895_010072 3300042132 Bacteria 804
214 Ga0450898_001671 3300042134 Bacteria 2979
215 Ga0450900_006447 3300042136 Bacteria 1419
216 Ga0450902_051955 3300042137 Bacteria 704
217 Ga0450903_009820 3300042138 Bacteria 1556
218 Ga0450889_002716 3300042144 Bacteria 1757
219 Ga0439446_0133018 3300042156 Bacteria 808
220 Ga0439458_0073100 3300042157 Bacteria 868
221 Ga0450908_043697 3300042184 Bacteria 777
222 Ga0439460_0181515 3300042461 Bacteria 712
223 Ga0450916_029840 3300042530 Bacteria 790
224 Ga0450918_000184 3300042531 Bacteria 13905
225 Ga0450893_0005395 3300042532 Bacteria 2052
226 Ga0450893_0031467 3300042532 Bacteria 947
227 Ga0450893_0072685 3300042532 Bacteria 670
228 Ga0451576_0472347 3300045051 Bacteria 1317
229 Ga0451576_1121544 3300045051 Bacteria 823
230 Ga0495592_0818687 3300046454 Bacteria 552
231 Ga0495629_0450162 3300046459 Bacteria 872
232 Ga0495639_0108674 3300046475 Bacteria 1314
233 Ga0495610_0079114 3300046512 Bacteria 1514
234 Ga0495628_0468327 3300046516 Bacteria 913
235 Ga0495637_0008465 3300046520 Bacteria 5049
236 Ga0495642_0090467 3300046528 Bacteria 1295
237 Ga0495654_0032789 3300046530 Bacteria 2632
238 Ga0495640_0275461 3300046533 Bacteria 1049
239 Ga0495587_0386923 3300046536 Bacteria 778
240 Ga0495633_0469601 3300046558 Bacteria 568
241 Ga0495667_0431717 3300046559 Bacteria 829
242 Ga0495634_0190945 3300046642 Bacteria 1278
243 Ga0495635_0709595 3300046663 Bacteria 652
244 Ga0495659_0297824 3300046664 Bacteria 681
245 Ga0495588_0059318 3300046674 Bacteria 1979
246 Ga0495657_0673613 3300046675 Bacteria 595
247 Ga0495599_0174661 3300046678 Bacteria 1325
248 Ga0495624_0463059 3300046690 Bacteria 759
249 Ga0495670_0712206 3300046691 Bacteria 547
250 Ga0495600_0271344 3300046809 Bacteria 1076
251 Ga0495680_0167401 3300047322 Bacteria 1593
252 Ga0495681_0164247 3300047470 Bacteria 923
253 Ga0496100_0046910 3300048903 Bacteria 2781
254 Ga0496101_0292115 3300048904 Bacteria 1275
255 Ga0496101_0505820 3300048904 Bacteria 954
256 Ga0496102_0747915 3300048905 Bacteria 900
257 Ga0496102_0785875 3300048905 Bacteria 874
258 Ga0496103_0198723 3300048906 Bacteria 1289
259 Ga0496103_0388038 3300048906 Bacteria 897
260 Ga0496104_0091541 3300048907 Bacteria 2907
261 Ga0496105_0019808 3300048908 Bacteria 5428
262 Ga0496106_0193388 3300048909 Bacteria 1618
263 Ga0496107_0378815 3300048910 Bacteria 1052
264 Ga0496108_0885091 3300048911 Bacteria 767
265 Ga0496109_0486175 3300048912 Bacteria 1165
266 Ga0496109_0851082 3300048912 Bacteria 850
267 Ga0496110_0057836 3300048913 Bacteria 3414
268 Ga0496110_0103961 3300048913 Bacteria 2548
269 Ga0496111_0031246 3300048914 Bacteria 3793
270 Ga0496112_0481362 3300048915 Bacteria 1178
271 Ga0496113_1082829 3300048916 Bacteria 629
272 Ga0496114_0265742 3300048917 Bacteria 1511
273 Ga0496114_0494936 3300048917 Bacteria 1081
274 Ga0496116_0015864 3300048919 Bacteria 5929
275 Ga0496116_0026974 3300048919 Bacteria 4188
276 Ga0496117_0038743 3300048920 Bacteria 3528
277 Ga0496117_0163564 3300048920 Bacteria 1301
278 Ga0496118_0006216 3300048921 Bacteria 13214
279 Ga0496121_0050978 3300048924 Bacteria 3490
280 Ga0496121_0102159 3300048924 Bacteria 2209
281 Ga0496121_0218453 3300048924 Bacteria 1344
282 Ga0496122_0475585 3300048925 Bacteria 613
283 Ga0496123_0148007 3300048926 Bacteria 1272
284 Ga0496123_0161878 3300048926 Bacteria 1192
285 Ga0496124_0088207 3300048927 Bacteria 2536
286 Ga0496124_0248670 3300048927 Bacteria 1317
287 Ga0496125_0086075 3300048928 Bacteria 2379
288 Ga0496125_0281659 3300048928 Bacteria 1029
289 Ga0496126_0664077 3300048929 Bacteria 814
290 Ga0501310_010119 3300049130 Bacteria 1048
291 Ga0501291_062217 3300049514 Bacteria 705
292 Ga0501293_014572 3300049516 Bacteria 716
293 Ga0501294_013441 3300049517 Bacteria 830
294 Ga0501299_145136 3300049522 Bacteria 594
295 Ga0501300_020049 3300049523 Bacteria 975
296 Ga0501301_032434 3300049524 Bacteria 560
297 Ga0501316_073969 3300049532 Bacteria 519
298 Ga0501207_004305 3300049654 Bacteria 1929
299 Ga0501211_007769 3300049658 Bacteria 1048
300 Ga0501222_008546 3300049662 Bacteria 1358
301 Ga0501235_031917 3300049669 Bacteria 1190
302 Ga0501235_186111 3300049669 Bacteria 556
303 Ga0501242_024386 3300049674 Bacteria 792
304 Ga0501249_003562 3300049679 Bacteria 3129
305 Ga0501249_123076 3300049679 Bacteria 634
306 Ga0501252_001309 3300049682 Bacteria 2256
307 Ga0501253_024831 3300049683 Bacteria 1090
308 Ga0501255_006094 3300049684 Bacteria 1231
309 Ga0501259_210631 3300049688 Bacteria 501
310 Ga0501221_029757 3300049704 Bacteria 1131
311 Ga0501225_0099645 3300049705 Bacteria 848
312 Ga0501229_003162 3300049706 Bacteria 1962
313 Ga0501232_077676 3300049757 Bacteria 557
314 Ga0501262_007865 3300049759 Bacteria 1297
315 Ga0501266_000372 3300049763 Bacteria 5986
316 Ga0501267_000272 3300049764 Bacteria 3777
317 Ga0501268_056944 3300049765 Bacteria 768
318 Ga0501269_029880 3300049766 Bacteria 697
319 Ga0501272_008491 3300049769 Bacteria 1128
320 Ga0501275_029120 3300049772 Bacteria 722
321 Ga0501204_037886 3300049850 Bacteria 695
322 nmdc:mga00v17_383776_c1 3300050491 Bacteria 913
323 nmdc:mga0k408_418445_c1 3300050493 Bacteria 797
324 nmdc:mga0k408_627188_c1 3300050493 Bacteria 633
325 nmdc:mga0k408_820940_c1 3300050493 Bacteria 541
326 nmdc:mga06z11_593519_c1 3300050494 Bacteria 673
327 nmdc:mga07m45_2133_c1 3300050496 Bacteria 9204
328 nmdc:mga07m45_2799_c1 3300050496 Bacteria 8251
329 nmdc:mga07m45_5683_c1 3300050496 Bacteria 6235
330 Ga0495619_0632339 3300053085 Bacteria 731
331 Ga0500607_145922 3300053121 Bacteria 1105
332 Ga0500608_046769 3300053122 Bacteria 2079
333 Ga0500618_097477 3300053125 Bacteria 661
334 Ga0500625_174616 3300053729 Bacteria 765
335 Ga0500596_081012 3300053735 Bacteria 565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049679 Ga0501249_003562 Ga0501249_003562_2504_2845 102
2 3300031548 Ga0307408_100000554 Ga0307408_1000005549 103
3 3300031901 Ga0307406_10001437 Ga0307406_100014375 103
4 3300042136 Ga0450900_006447 Ga0450900_006447_390_767 103
5 3300014969 Ga0157376_10539017 Ga0157376_105390171 104
6 3300041486 Ga0451807_0895353 Ga0451807_0895353_261_614 104
7 3300048926 Ga0496123_0161878 Ga0496123_0161878_500_865 104
8 3300053121 Ga0500607_145922 Ga0500607_145922_291_650 104
9 3300053729 Ga0500625_174616 Ga0500625_174616_263_622 104
10 3300053735 Ga0500596_081012 Ga0500596_081012_160_519 104
11 3300003791 Ga0055530_10070956 Ga0055530_100709562 106
12 3300003792 Ga0055540_1071784 Ga0055540_10717841 106
13 3300003794 Ga0055531_10000089 Ga0055531_1000008993 106
14 3300005337 Ga0070682_100043143 Ga0070682_1000431433 106
15 3300005614 Ga0068856_100283636 Ga0068856_1002836362 106
16 3300006195 Ga0075366_10578480 Ga0075366_105784802 106
17 3300025298 Ga0209050_1013101 Ga0209050_10131013 106
18 3300025303 Ga0209051_1011655 Ga0209051_10116552 106
19 3300025304 Ga0209257_1000021 Ga0209257_1000021406 106
20 3300025304 Ga0209257_1048898 Ga0209257_10488982 106
21 3300026078 Ga0207702_10131418 Ga0207702_101314182 106
22 3300028794 Ga0307515_10116054 Ga0307515_101160542 106
23 3300031731 Ga0307405_11678020 Ga0307405_116780202 106
24 3300031995 Ga0307409_100168878 Ga0307409_1001688782 106
25 3300032004 Ga0307414_10002946 Ga0307414_100029467 106
26 3300032005 Ga0307411_10001757 Ga0307411_100017574 106
27 3300037471 Ga0395905_0002115 Ga0395905_0002115_20046_20369 106
28 3300039447 Ga0436361_0624890 Ga0436361_0624890_2691_3014 106
29 3300041453 Ga0451797_0676736 Ga0451797_0676736_234_557 106
30 3300041512 Ga0451853_0633760 Ga0451853_0633760_117_440 106
31 3300042004 Ga0439445_0098487 Ga0439445_0098487_350_673 106
32 3300042137 Ga0450902_051955 Ga0450902_051955_76_399 106
33 3300042138 Ga0450903_009820 Ga0450903_009820_534_857 106
34 3300042530 Ga0450916_029840 Ga0450916_029840_402_725 106
35 3300045051 Ga0451576_1121544 Ga0451576_1121544_452_775 106
36 3300046558 Ga0495633_0469601 Ga0495633_0469601_202_546 106
37 3300049130 Ga0501310_010119 Ga0501310_010119_567_890 106
38 3300049514 Ga0501291_062217 Ga0501291_062217_45_368 106
39 3300049516 Ga0501293_014572 Ga0501293_014572_257_580 106
40 3300049517 Ga0501294_013441 Ga0501294_013441_373_696 106
41 3300049522 Ga0501299_145136 Ga0501299_145136_156_479 106
42 3300049523 Ga0501300_020049 Ga0501300_020049_209_532 106
43 3300049524 Ga0501301_032434 Ga0501301_032434_153_476 106
44 3300049532 Ga0501316_073969 Ga0501316_073969_146_469 106
45 3300049654 Ga0501207_004305 Ga0501207_004305_912_1235 106
46 3300049658 Ga0501211_007769 Ga0501211_007769_262_585 106
47 3300049662 Ga0501222_008546 Ga0501222_008546_418_741 106
48 3300049669 Ga0501235_031917 Ga0501235_031917_80_403 106
49 3300049674 Ga0501242_024386 Ga0501242_024386_335_658 106
50 3300049679 Ga0501249_123076 Ga0501249_123076_154_477 106
51 3300049682 Ga0501252_001309 Ga0501252_001309_1293_1616 106
52 3300049683 Ga0501253_024831 Ga0501253_024831_363_686 106
53 3300049684 Ga0501255_006094 Ga0501255_006094_446_769 106
54 3300049688 Ga0501259_210631 Ga0501259_210631_148_471 106
55 3300049704 Ga0501221_029757 Ga0501221_029757_68_391 106
56 3300049705 Ga0501225_0099645 Ga0501225_0099645_509_832 106
57 3300049706 Ga0501229_003162 Ga0501229_003162_835_1158 106
58 3300049757 Ga0501232_077676 Ga0501232_077676_92_415 106
59 3300049759 Ga0501262_007865 Ga0501262_007865_174_497 106
60 3300049763 Ga0501266_000372 Ga0501266_000372_832_1155 106
61 3300049764 Ga0501267_000272 Ga0501267_000272_3308_3631 106
62 3300049765 Ga0501268_056944 Ga0501268_056944_238_561 106
63 3300049766 Ga0501269_029880 Ga0501269_029880_83_406 106
64 3300049769 Ga0501272_008491 Ga0501272_008491_188_511 106
65 3300049772 Ga0501275_029120 Ga0501275_029120_163_486 106
66 3300049850 Ga0501204_037886 Ga0501204_037886_314_637 106
67 iso_pu_bacteria 2643221644 2644245734 107
68 3300005354 Ga0070675_100351091 Ga0070675_1003510912 108
69 3300006353 Ga0075370_10041970 Ga0075370_100419702 108
70 3300009148 Ga0105243_11093256 Ga0105243_110932562 108
71 3300034817 Ga0373948_0046067 Ga0373948_0046067_66_395 108
72 3300034820 Ga0373959_0025486 Ga0373959_0025486_250_579 108
73 3300035088 Ga0373940_0009067 Ga0373940_0009067_789_1118 108
74 3300035114 Ga0373939_0000008 Ga0373939_0000008_52501_52830 108
75 3300035121 Ga0373960_0004335 Ga0373960_0004335_66_395 108
76 3300035241 Ga0373961_0188803 Ga0373961_0188803_192_521 108
77 3300035242 Ga0373962_0033033 Ga0373962_0033033_874_1203 108
78 3300035691 Ga0373931_0000530 Ga0373931_0000530_6811_7140 108
79 3300041503 Ga0451847_0136608 Ga0451847_0136608_276_605 108
80 3300045051 Ga0451576_0472347 Ga0451576_0472347_525_854 108
81 3300048904 Ga0496101_0505820 Ga0496101_0505820_85_432 108
82 3300050493 nmdc:mga0k408_418445_c1 nmdc:mga0k408_418445_c1_93_422 108
83 3300050493 nmdc:mga0k408_627188_c1 nmdc:mga0k408_627188_c1_71_400 108
84 3300050496 nmdc:mga07m45_2799_c1 nmdc:mga07m45_2799_c1_1367_1696 108
85 iso_pu_bacteria 2928115317 2928119614 108
86 iso_pu_bacteria 2513020051 2513226481 109
87 iso_pu_bacteria 2643221658 2644326754 109
88 iso_pu_bacteria 2643221672 2644399990 109
89 iso_pu_bacteria 2643221683 2644466610 109
90 iso_pu_bacteria 2738543013 2739249679 109
91 iso_pu_bacteria 2904541872 2904547268 109
92 iso_pu_bacteria 2929160207 2929165781 109
93 iso_pu_bacteria 2945909444 2945912732 109
94 iso_pu_bacteria 2945984333 2945985004 109
95 iso_pu_bacteria 2738541277 2738721580 110
96 iso_pu_bacteria 2738543019 2739281249 110
97 3300003775 Ga0055524_1000097 Ga0055524_100009722 111
98 3300005262 Ga0065165_1048254 Ga0065165_10482542 111
99 3300006946 Ga0079104_1000019 Ga0079104_100001974 111
100 3300025263 Ga0209565_1015126 Ga0209565_10151261 111
101 3300025291 Ga0209675_1011387 Ga0209675_10113873 111
102 3300025298 Ga0209050_1026263 Ga0209050_10262631 111
103 3300025299 Ga0209256_1000051 Ga0209256_100005177 111
104 3300027111 Ga0209281_1000160 Ga0209281_100016074 111
105 3300027665 Ga0209983_1089049 Ga0209983_10890492 111
106 3300027876 Ga0209974_10004821 Ga0209974_100048212 111
107 3300031548 Ga0307408_100523907 Ga0307408_1005239072 111
108 3300031548 Ga0307408_102347548 Ga0307408_1023475481 111
109 3300031911 Ga0307412_11208551 Ga0307412_112085511 111
110 3300041451 Ga0451791_1293207 Ga0451791_1293207_34_375 111
111 3300041997 Ga0439431_0116288 Ga0439431_0116288_45_398 111
112 3300042121 Ga0450919_001957 Ga0450919_001957_1798_2136 111
113 3300042531 Ga0450918_000184 Ga0450918_000184_2698_3036 111
114 3300042532 Ga0450893_0031467 Ga0450893_0031467_271_621 111
115 3300042532 Ga0450893_0072685 Ga0450893_0072685_58_405 111
116 3300048911 Ga0496108_0885091 Ga0496108_0885091_75_413 111
117 3300048917 Ga0496114_0265742 Ga0496114_0265742_763_1101 111
118 3300049669 Ga0501235_186111 Ga0501235_186111_189_527 111
119 3300050493 nmdc:mga0k408_820940_c1 nmdc:mga0k408_820940_c1_190_528 111
120 iso_pu_bacteria 2547132374 2548501139 111
121 iso_pu_bacteria 2816332133 2816471738 111
122 3300003784 Ga0055534_1001970 Ga0055534_10019703 112
123 3300003791 Ga0055530_10000258 Ga0055530_1000025843 112
124 3300003792 Ga0055540_1000023 Ga0055540_1000023110 112
125 3300003794 Ga0055531_10004171 Ga0055531_100041713 112
126 3300005456 Ga0070678_101015632 Ga0070678_1010156322 112
127 3300009148 Ga0105243_12310170 Ga0105243_123101702 112
128 3300025273 Ga0209673_1012540 Ga0209673_10125402 112
129 3300025291 Ga0209675_1002411 Ga0209675_10024116 112
130 3300025292 Ga0209676_1005349 Ga0209676_10053494 112
131 3300025295 Ga0209564_1081157 Ga0209564_10811571 112
132 3300025298 Ga0209050_1004659 Ga0209050_10046599 112
133 3300025303 Ga0209051_1000079 Ga0209051_100007977 112
134 3300025303 Ga0209051_1076790 Ga0209051_10767902 112
135 3300025304 Ga0209257_1000183 Ga0209257_100018335 112
136 3300025304 Ga0209257_1037105 Ga0209257_10371052 112
137 3300026089 Ga0207648_10471751 Ga0207648_104717512 112
138 3300026121 Ga0207683_12144110 Ga0207683_121441101 112
139 3300028794 Ga0307515_10000757 Ga0307515_100007572 112
140 3300031238 Ga0265332_10001890 Ga0265332_100018907 112
141 3300031456 Ga0307513_10006906 Ga0307513_100069063 112
142 3300031456 Ga0307513_10056339 Ga0307513_100563393 112
143 3300031649 Ga0307514_10001530 Ga0307514_100015302 112
144 3300031731 Ga0307405_10138913 Ga0307405_101389133 112
145 3300031731 Ga0307405_10554250 Ga0307405_105542502 112
146 3300031911 Ga0307412_10943443 Ga0307412_109434432 112
147 3300033180 Ga0307510_10253706 Ga0307510_102537062 112
148 3300037471 Ga0395905_0029372 Ga0395905_0029372_997_1335 112
149 3300041498 Ga0451841_0218182 Ga0451841_0218182_126_476 112
150 3300042004 Ga0439445_0058177 Ga0439445_0058177_343_681 112
151 3300042007 Ga0439449_0278773 Ga0439449_0278773_13_354 112
152 3300042012 Ga0439455_0009298 Ga0439455_0009298_367_717 112
153 3300042016 Ga0439463_174154 Ga0439463_174154_40_378 112
154 3300042115 Ga0450911_000187 Ga0450911_000187_413_751 112
155 3300042120 Ga0450917_004808 Ga0450917_004808_42_407 112
156 3300042126 Ga0450888_019304 Ga0450888_019304_162_527 112
157 3300042127 Ga0450890_001477 Ga0450890_001477_1185_1550 112
158 3300042129 Ga0450891_000116 Ga0450891_000116_3670_4035 112
159 3300042130 Ga0450892_001314 Ga0450892_001314_887_1252 112
160 3300042132 Ga0450895_010072 Ga0450895_010072_396_740 112
161 3300042134 Ga0450898_001671 Ga0450898_001671_318_662 112
162 3300042144 Ga0450889_002716 Ga0450889_002716_1370_1735 112
163 3300042156 Ga0439446_0133018 Ga0439446_0133018_288_626 112
164 3300042157 Ga0439458_0073100 Ga0439458_0073100_205_555 112
165 3300042184 Ga0450908_043697 Ga0450908_043697_126_464 112
166 3300042461 Ga0439460_0181515 Ga0439460_0181515_303_647 112
167 3300042532 Ga0450893_0005395 Ga0450893_0005395_141_506 112
168 3300046530 Ga0495654_0032789 Ga0495654_0032789_2022_2381 112
169 3300048912 Ga0496109_0486175 Ga0496109_0486175_212_550 112
170 3300048913 Ga0496110_0103961 Ga0496110_0103961_1854_2192 112
171 3300048924 Ga0496121_0102159 Ga0496121_0102159_552_890 112
172 3300048927 Ga0496124_0248670 Ga0496124_0248670_445_783 112
173 3300048928 Ga0496125_0281659 Ga0496125_0281659_350_688 112
174 3300048929 Ga0496126_0664077 Ga0496126_0664077_160_498 112
175 iso_pu_bacteria 2643221609 2644057217 112
176 iso_pu_bacteria 2643221611 2644071961 112
177 iso_pu_bacteria 2643221717 2644645767 112
178 iso_pu_bacteria 2738543012 2739246022 112
179 3300003187 JGI25151J46595_10008387 JGI25151J46595_100083873 113
180 3300003187 JGI25151J46595_10119379 JGI25151J46595_101193791 113
181 3300003781 Ga0055536_1000866 Ga0055536_10008668 113
182 3300003781 Ga0055536_1011456 Ga0055536_10114563 113
183 3300003784 Ga0055534_1025278 Ga0055534_10252782 113
184 3300003792 Ga0055540_1001938 Ga0055540_100193813 113
185 3300003792 Ga0055540_1002300 Ga0055540_10023006 113
186 3300003792 Ga0055540_1019820 Ga0055540_10198201 113
187 3300003794 Ga0055531_10001399 Ga0055531_100013999 113
188 3300005288 Ga0065714_10173615 Ga0065714_101736152 113
189 3300005327 Ga0070658_11302962 Ga0070658_113029621 113
190 3300005330 Ga0070690_100478318 Ga0070690_1004783182 113
191 3300005331 Ga0070670_101104617 Ga0070670_1011046171 113
192 3300005333 Ga0070677_10386631 Ga0070677_103866312 113
193 3300005334 Ga0068869_100914604 Ga0068869_1009146042 113
194 3300005335 Ga0070666_10470997 Ga0070666_104709972 113
195 3300005347 Ga0070668_100999238 Ga0070668_1009992382 113
196 3300005355 Ga0070671_101436930 Ga0070671_1014369301 113
197 3300005356 Ga0070674_100074936 Ga0070674_1000749362 113
198 3300005364 Ga0070673_100335311 Ga0070673_1003353112 113
199 3300005366 Ga0070659_100152682 Ga0070659_1001526822 113
200 3300005367 Ga0070667_100009271 Ga0070667_1000092712 113
201 3300005455 Ga0070663_100048284 Ga0070663_1000482842 113
202 3300005456 Ga0070678_101217832 Ga0070678_1012178321 113
203 3300005456 Ga0070678_101718280 Ga0070678_1017182801 113
204 3300005457 Ga0070662_100016291 Ga0070662_1000162912 113
205 3300005466 Ga0070685_10135167 Ga0070685_101351672 113
206 3300005539 Ga0068853_100084538 Ga0068853_1000845383 113
207 3300005543 Ga0070672_100019299 Ga0070672_1000192993 113
208 3300005543 Ga0070672_100612794 Ga0070672_1006127942 113
209 3300005548 Ga0070665_100213874 Ga0070665_1002138741 113
210 3300005616 Ga0068852_100015025 Ga0068852_1000150252 113
211 3300005618 Ga0068864_100371889 Ga0068864_1003718892 113
212 3300006051 Ga0075364_10178838 Ga0075364_101788382 113
213 3300006178 Ga0075367_10611538 Ga0075367_106115382 113
214 3300006195 Ga0075366_10354701 Ga0075366_103547012 113
215 3300006237 Ga0097621_100105313 Ga0097621_1001053132 113
216 3300006237 Ga0097621_101379176 Ga0097621_1013791762 113
217 3300006353 Ga0075370_10031710 Ga0075370_100317102 113
218 3300006358 Ga0068871_100112673 Ga0068871_1001126732 113
219 3300006881 Ga0068865_100305935 Ga0068865_1003059352 113
220 3300006914 Ga0075436_100531624 Ga0075436_1005316242 113
221 3300009036 Ga0105244_10005964 Ga0105244_100059647 113
222 3300009098 Ga0105245_10868164 Ga0105245_108681642 113
223 3300009098 Ga0105245_10993297 Ga0105245_109932971 113
224 3300009148 Ga0105243_10013431 Ga0105243_100134316 113
225 3300009148 Ga0105243_10019807 Ga0105243_100198072 113
226 3300009148 Ga0105243_10111720 Ga0105243_101117202 113
227 3300009148 Ga0105243_11288786 Ga0105243_112887862 113
228 3300009174 Ga0105241_10212351 Ga0105241_102123512 113
229 3300009176 Ga0105242_10627766 Ga0105242_106277662 113
230 3300009176 Ga0105242_11896018 Ga0105242_118960181 113
231 3300009177 Ga0105248_10768284 Ga0105248_107682841 113
232 3300009545 Ga0105237_10042835 Ga0105237_100428352 113
233 3300009551 Ga0105238_10022486 Ga0105238_100224863 113
234 3300009551 Ga0105238_10837939 Ga0105238_108379392 113
235 3300009553 Ga0105249_11968476 Ga0105249_119684761 113
236 3300010375 Ga0105239_10237048 Ga0105239_102370482 113
237 3300011119 Ga0105246_10018369 Ga0105246_100183692 113
238 3300012502 Ga0157347_1000106 Ga0157347_10001062 113
239 3300013100 Ga0157373_10053282 Ga0157373_100532822 113
240 3300013102 Ga0157371_10573915 Ga0157371_105739152 113
241 3300013104 Ga0157370_10254862 Ga0157370_102548622 113
242 3300013297 Ga0157378_11397007 Ga0157378_113970071 113
243 3300013306 Ga0163162_10155841 Ga0163162_101558412 113
244 3300014497 Ga0182008_10008359 Ga0182008_100083592 113
245 3300014497 Ga0182008_10066822 Ga0182008_100668222 113
246 3300014969 Ga0157376_11570849 Ga0157376_115708492 113
247 3300015261 Ga0182006_1002881 Ga0182006_10028816 113
248 3300015261 Ga0182006_1025466 Ga0182006_10254662 113
249 3300015262 Ga0182007_10001242 Ga0182007_1000124212 113
250 3300015262 Ga0182007_10001836 Ga0182007_100018366 113
251 3300015265 Ga0182005_1105959 Ga0182005_11059592 113
252 3300015683 Ga0183362_10002 Ga0183362_10002850 113
253 3300017792 Ga0163161_10084413 Ga0163161_100844132 113
254 3300025291 Ga0209675_1003753 Ga0209675_10037537 113
255 3300025292 Ga0209676_1000420 Ga0209676_100042047 113
256 3300025292 Ga0209676_1001131 Ga0209676_100113115 113
257 3300025294 Ga0209025_1000694 Ga0209025_100069410 113
258 3300025294 Ga0209025_1015444 Ga0209025_10154442 113
259 3300025298 Ga0209050_1000447 Ga0209050_10004476 113
260 3300025298 Ga0209050_1005003 Ga0209050_10050034 113
261 3300025298 Ga0209050_1038161 Ga0209050_10381612 113
262 3300025303 Ga0209051_1000285 Ga0209051_100028520 113
263 3300025303 Ga0209051_1001282 Ga0209051_10012829 113
264 3300025304 Ga0209257_1000417 Ga0209257_10004179 113
265 3300025304 Ga0209257_1004570 Ga0209257_10045702 113
266 3300025728 Ga0207655_1004540 Ga0207655_10045407 113
267 3300025903 Ga0207680_10234959 Ga0207680_102349592 113
268 3300025904 Ga0207647_10125135 Ga0207647_101251352 113
269 3300025914 Ga0207671_10072333 Ga0207671_100723333 113
270 3300025924 Ga0207694_10055019 Ga0207694_100550193 113
271 3300025924 Ga0207694_10084977 Ga0207694_100849773 113
272 3300025927 Ga0207687_11166729 Ga0207687_111667291 113
273 3300025931 Ga0207644_11457519 Ga0207644_114575191 113
274 3300025932 Ga0207690_10092012 Ga0207690_100920122 113
275 3300025933 Ga0207706_10010058 Ga0207706_100100584 113
276 3300025935 Ga0207709_10001611 Ga0207709_100016118 113
277 3300025935 Ga0207709_10002063 Ga0207709_100020636 113
278 3300025937 Ga0207669_10025596 Ga0207669_100255963 113
279 3300025940 Ga0207691_10498018 Ga0207691_104980182 113
280 3300025940 Ga0207691_10915922 Ga0207691_109159221 113
281 3300025942 Ga0207689_10794612 Ga0207689_107946122 113
282 3300025945 Ga0207679_10009449 Ga0207679_100094493 113
283 3300025960 Ga0207651_10425884 Ga0207651_104258842 113
284 3300025981 Ga0207640_10018827 Ga0207640_100188272 113
285 3300025986 Ga0207658_10016169 Ga0207658_100161693 113
286 3300026041 Ga0207639_10076889 Ga0207639_100768892 113
287 3300026067 Ga0207678_10229806 Ga0207678_102298062 113
288 3300026121 Ga0207683_11005656 Ga0207683_110056562 113
289 3300026142 Ga0207698_10188090 Ga0207698_101880902 113
290 3300028379 Ga0268266_10113906 Ga0268266_101139063 113
291 3300028379 Ga0268266_10381177 Ga0268266_103811772 113
292 3300028381 Ga0268264_11004655 Ga0268264_110046552 113
293 3300031731 Ga0307405_10003092 Ga0307405_100030927 113
294 3300032002 Ga0307416_101127119 Ga0307416_1011271192 113
295 3300032005 Ga0307411_10240663 Ga0307411_102406632 113
296 3300041452 Ga0451793_1892597 Ga0451793_1892597_11_367 113
297 3300041453 Ga0451797_0199688 Ga0451797_0199688_90_431 113
298 3300041456 Ga0451795_1117004 Ga0451795_1117004_104_451 113
299 3300041486 Ga0451807_0732298 Ga0451807_0732298_177_518 113
300 3300046454 Ga0495592_0818687 Ga0495592_0818687_176_520 113
301 3300046459 Ga0495629_0450162 Ga0495629_0450162_60_404 113
302 3300046475 Ga0495639_0108674 Ga0495639_0108674_397_741 113
303 3300046512 Ga0495610_0079114 Ga0495610_0079114_85_426 113
304 3300046516 Ga0495628_0468327 Ga0495628_0468327_472_870 113
305 3300046520 Ga0495637_0008465 Ga0495637_0008465_4161_4502 113
306 3300046528 Ga0495642_0090467 Ga0495642_0090467_511_855 113
307 3300046533 Ga0495640_0275461 Ga0495640_0275461_152_496 113
308 3300046536 Ga0495587_0386923 Ga0495587_0386923_332_676 113
309 3300046559 Ga0495667_0431717 Ga0495667_0431717_346_690 113
310 3300046642 Ga0495634_0190945 Ga0495634_0190945_519_863 113
311 3300046663 Ga0495635_0709595 Ga0495635_0709595_293_637 113
312 3300046664 Ga0495659_0297824 Ga0495659_0297824_199_540 113
313 3300046674 Ga0495588_0059318 Ga0495588_0059318_367_711 113
314 3300046675 Ga0495657_0673613 Ga0495657_0673613_34_378 113
315 3300046678 Ga0495599_0174661 Ga0495599_0174661_635_979 113
316 3300046690 Ga0495624_0463059 Ga0495624_0463059_267_611 113
317 3300046691 Ga0495670_0712206 Ga0495670_0712206_193_537 113
318 3300046809 Ga0495600_0271344 Ga0495600_0271344_618_962 113
319 3300047322 Ga0495680_0167401 Ga0495680_0167401_1152_1550 113
320 3300047470 Ga0495681_0164247 Ga0495681_0164247_236_580 113
321 3300048903 Ga0496100_0046910 Ga0496100_0046910_385_729 113
322 3300048904 Ga0496101_0292115 Ga0496101_0292115_471_815 113
323 3300048905 Ga0496102_0747915 Ga0496102_0747915_70_414 113
324 3300048905 Ga0496102_0785875 Ga0496102_0785875_345_686 113
325 3300048906 Ga0496103_0198723 Ga0496103_0198723_576_920 113
326 3300048906 Ga0496103_0388038 Ga0496103_0388038_289_630 113
327 3300048907 Ga0496104_0091541 Ga0496104_0091541_2242_2586 113
328 3300048908 Ga0496105_0019808 Ga0496105_0019808_344_688 113
329 3300048909 Ga0496106_0193388 Ga0496106_0193388_275_619 113
330 3300048910 Ga0496107_0378815 Ga0496107_0378815_448_792 113
331 3300048912 Ga0496109_0851082 Ga0496109_0851082_361_702 113
332 3300048913 Ga0496110_0057836 Ga0496110_0057836_2700_3047 113
333 3300048914 Ga0496111_0031246 Ga0496111_0031246_2486_2830 113
334 3300048915 Ga0496112_0481362 Ga0496112_0481362_200_544 113
335 3300048916 Ga0496113_1082829 Ga0496113_1082829_148_492 113
336 3300048917 Ga0496114_0494936 Ga0496114_0494936_328_672 113
337 3300048919 Ga0496116_0015864 Ga0496116_0015864_4988_5329 113
338 3300048919 Ga0496116_0026974 Ga0496116_0026974_2806_3147 113
339 3300048920 Ga0496117_0038743 Ga0496117_0038743_704_1045 113
340 3300048920 Ga0496117_0163564 Ga0496117_0163564_464_805 113
341 3300048921 Ga0496118_0006216 Ga0496118_0006216_10391_10732 113
342 3300048924 Ga0496121_0050978 Ga0496121_0050978_2670_3011 113
343 3300048924 Ga0496121_0218453 Ga0496121_0218453_359_700 113
344 3300048925 Ga0496122_0475585 Ga0496122_0475585_195_536 113
345 3300048926 Ga0496123_0148007 Ga0496123_0148007_372_713 113
346 3300048927 Ga0496124_0088207 Ga0496124_0088207_1801_2142 113
347 3300048928 Ga0496125_0086075 Ga0496125_0086075_913_1254 113
348 3300050491 nmdc:mga00v17_383776_c1 nmdc:mga00v17_383776_c1_123_464 113
349 3300050494 nmdc:mga06z11_593519_c1 nmdc:mga06z11_593519_c1_202_543 113
350 3300050496 nmdc:mga07m45_2133_c1 nmdc:mga07m45_2133_c1_3483_3824 113
351 3300050496 nmdc:mga07m45_5683_c1 nmdc:mga07m45_5683_c1_134_478 113
352 3300053085 Ga0495619_0632339 Ga0495619_0632339_274_618 113
353 3300053122 Ga0500608_046769 Ga0500608_046769_1311_1652 113
354 3300053125 Ga0500618_097477 Ga0500618_097477_168_518 113
355 iso_pu_bacteria 2738541307 2738885463 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

13

116

0.99

PF00355

Rieske

Rieske [2Fe-2S] domain

13

105

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aiv-assembly1.cif.gz_A crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis 0.9367 6 113
2jo6-assembly1.cif.gz_A nmr structure of the e.coli protein nird, northeast structural genomics target et100 0.924 7 110
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.9072 6 113
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.8992 6 113
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.8871 8 113
ID Description Score Start End Superfamily
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9697 6 111 2.102.10.10
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9436 6 111 2.102.10.10
4aivA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9367 6 113 2.102.10.10
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.923 7 111 2.102.10.10
3c0dC00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.903 6 113 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3YMD2-F1-model_v4 Nitrite reductase small subunit NirD 0.9964 9 113 GO:0042128
GO:0046872
GO:0051537
AF-A0A0Q6UF97-F1-model_v4 Nitrite reductase small subunit 0.9943 6 113 GO:0042128
GO:0046872
GO:0051537
AF-A0A254N7U4-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9933 5 113 GO:0042128
GO:0046872
GO:0051537
AF-A0A397QW15-F1-model_v4 deleted 0.9933 6 113
AF-A0A1F4MTD5-F1-model_v4 Nitrite reductase small subunit 0.9904 8 113 GO:0042128
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.85 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map