F420164

General Info

Members Datasets Scaffolds Average Seq Length
355 213 710 173

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10896450|Ga0207670_108964501
Length 204
Sequence VTASTVERASLTKNHAASRKPEPLPSRLRRAARIKTMDRPYNVLFLCTGNSARSILAETILNREGRGNFRAFSAGSQPKGQVHPYALDLLRKMNFDVTALRSKSWNEFAGPGATPLDFVFTVCDNAAGETCPFWPGQPMTAHWGVPDPAAATGSEAEVRLAFADTFRRLSNRISLFVSLPLKSLDKLTLQRQLHSIGLSKGSAA

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
151 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
152 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
153 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
212 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
213 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.28
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0.28
Rhizoplane 10.14
Rhizosphere 84.79
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10896450 3300025936 Bacteria 743
2 MBSR1b_contig_8066827 2162886012 Bacteria 943
3 rootH2_10024030 3300003320 Unclassified 3175
4 Ga0065712_10177548 3300005290 Bacteria 1209
5 Ga0065715_10231152 3300005293 Bacteria 1233
6 Ga0065707_10000450 3300005295 Bacteria 70667
7 Ga0065707_10103182 3300005295 Bacteria 2762
8 Ga0065707_10213936 3300005295 Bacteria 1253
9 Ga0070676_10131841 3300005328 Bacteria 1581
10 Ga0070690_100139509 3300005330 Bacteria 1644
11 Ga0070670_100010203 3300005331 Bacteria 8015
12 Ga0070670_100049669 3300005331 Bacteria 3606
13 Ga0070670_100100675 3300005331 Bacteria 2488
14 Ga0070670_100783618 3300005331 Bacteria 860
15 Ga0068869_100134288 3300005334 Bacteria 1905
16 Ga0068869_100159929 3300005334 Bacteria 1753
17 Ga0070666_10060834 3300005335 Bacteria 2556
18 Ga0070682_100374932 3300005337 Bacteria 1068
19 Ga0068868_100502413 3300005338 Bacteria 1062
20 Ga0070689_100062696 3300005340 Bacteria 2893
21 Ga0070689_100155551 3300005340 Bacteria 1846
22 Ga0070689_100186988 3300005340 Bacteria 1685
23 Ga0070689_100353671 3300005340 Bacteria 1233
24 Ga0070687_100156712 3300005343 Bacteria 1342
25 Ga0070687_100594962 3300005343 Bacteria 759
26 Ga0070687_100618898 3300005343 Bacteria 746
27 Ga0070661_100165473 3300005344 Bacteria 1677
28 Ga0070668_100034798 3300005347 Bacteria 3839
29 Ga0070668_101621002 3300005347 Bacteria 593
30 Ga0070669_100090683 3300005353 Bacteria 2291
31 Ga0070669_100181647 3300005353 Bacteria 1646
32 Ga0070669_100262674 3300005353 Bacteria 1378
33 Ga0070669_100767095 3300005353 Bacteria 818
34 Ga0070675_100042836 3300005354 Bacteria 3699
35 Ga0070675_100428886 3300005354 Bacteria 1183
36 Ga0070675_101055677 3300005354 Bacteria 746
37 Ga0070675_101635526 3300005354 Bacteria 594
38 Ga0070671_100039385 3300005355 Bacteria 3923
39 Ga0070674_100150480 3300005356 Bacteria 1756
40 Ga0070673_100003812 3300005364 Bacteria 9455
41 Ga0070673_100912559 3300005364 Bacteria 815
42 Ga0070673_101131838 3300005364 Bacteria 732
43 Ga0070688_100016534 3300005365 Bacteria 4221
44 Ga0070667_100098253 3300005367 Bacteria 2526
45 Ga0070667_100200655 3300005367 Bacteria 1770
46 Ga0070701_10385150 3300005438 Bacteria 885
47 Ga0070705_100290320 3300005440 Bacteria 1167
48 Ga0070700_100044368 3300005441 Bacteria 2738
49 Ga0070708_101067049 3300005445 Bacteria 757
50 Ga0070663_100038812 3300005455 Bacteria 3324
51 Ga0070663_100153384 3300005455 Bacteria 1768
52 Ga0070678_100032214 3300005456 Bacteria 3626
53 Ga0070662_100470130 3300005457 Bacteria 1046
54 Ga0068867_100035074 3300005459 Bacteria 3637
55 Ga0068867_100819337 3300005459 Bacteria 831
56 Ga0070685_10304627 3300005466 Bacteria 1075
57 Ga0070684_100064419 3300005535 Bacteria 3215
58 Ga0068853_100028919 3300005539 Bacteria 4666
59 Ga0068853_101636604 3300005539 Bacteria 624
60 Ga0070672_100072962 3300005543 Bacteria 2734
61 Ga0070672_100167729 3300005543 Bacteria 1824
62 Ga0070672_100244430 3300005543 Bacteria 1510
63 Ga0070686_100166192 3300005544 Bacteria 1557
64 Ga0070695_100295638 3300005545 Bacteria 1195
65 Ga0070665_100038518 3300005548 Bacteria 4806
66 Ga0068855_100251414 3300005563 Bacteria 1972
67 Ga0070664_100468371 3300005564 Bacteria 1158
68 Ga0068857_100008746 3300005577 Bacteria 8769
69 Ga0068856_100068418 3300005614 Bacteria 3510
70 Ga0068856_101598679 3300005614 Bacteria 665
71 Ga0070702_100092317 3300005615 Bacteria 1838
72 Ga0070702_100469534 3300005615 Bacteria 917
73 Ga0068852_100098089 3300005616 Bacteria 2638
74 Ga0068852_101286009 3300005616 Bacteria 753
75 Ga0068859_100059400 3300005617 Bacteria 3852
76 Ga0068859_100136670 3300005617 Bacteria 2524
77 Ga0068859_100255821 3300005617 Bacteria 1842
78 Ga0068864_100041179 3300005618 Bacteria 3951
79 Ga0068864_100117966 3300005618 Bacteria 2369
80 Ga0068861_100019345 3300005719 Bacteria 4865
81 Ga0068861_100142669 3300005719 Bacteria 1956
82 Ga0068861_100829990 3300005719 Bacteria 870
83 Ga0068851_10022877 3300005834 Bacteria 3050
84 Ga0068863_100006356 3300005841 Bacteria 11586
85 Ga0068858_100002811 3300005842 Bacteria 17506
86 Ga0068858_100092576 3300005842 Bacteria 2814
87 Ga0068860_100123593 3300005843 Bacteria 2480
88 Ga0068860_100164355 3300005843 Bacteria 2142
89 Ga0068862_100213382 3300005844 Bacteria 1745
90 Ga0068862_100236108 3300005844 Bacteria 1660
91 Ga0081455_10001657 3300005937 Bacteria 26985
92 Ga0081455_10173844 3300005937 Bacteria 1637
93 Ga0081455_10261261 3300005937 Bacteria 1261
94 Ga0081455_10495968 3300005937 Bacteria 821
95 Ga0081538_10014917 3300005981 Bacteria 6051
96 Ga0081538_10044923 3300005981 Bacteria 2747
97 Ga0075365_10453413 3300006038 Bacteria 906
98 Ga0075364_10365226 3300006051 Bacteria 984
99 Ga0070716_100411966 3300006173 Bacteria 975
100 Ga0097621_100076061 3300006237 Bacteria 2784
101 Ga0097621_100413925 3300006237 Bacteria 1209
102 Ga0068871_100034856 3300006358 Bacteria 3996
103 Ga0068871_100112815 3300006358 Bacteria 2288
104 Ga0068871_100123007 3300006358 Bacteria 2194
105 Ga0075428_100073907 3300006844 Bacteria 3724
106 Ga0075428_100247218 3300006844 Bacteria 1923
107 Ga0075428_100278509 3300006844 Bacteria 1800
108 Ga0075428_100310512 3300006844 Bacteria 1695
109 Ga0075428_100750758 3300006844 Bacteria 1038
110 Ga0075430_100000276 3300006846 Bacteria 36027
111 Ga0075430_100417961 3300006846 Unclassified 1107
112 Ga0075434_100598701 3300006871 Bacteria 1121
113 Ga0068865_100329885 3300006881 Bacteria 1230
114 Ga0068865_101099143 3300006881 Bacteria 700
115 Ga0097620_100059400 3300006931 Bacteria 3852
116 Ga0097620_100136670 3300006931 Bacteria 2524
117 Ga0097620_100255812 3300006931 Bacteria 1842
118 Ga0105240_10067583 3300009093 Bacteria 4430
119 Ga0111539_10000273 3300009094 Bacteria 61676
120 Ga0111539_12578746 3300009094 Bacteria 589
121 Ga0105245_10165825 3300009098 Bacteria 2100
122 Ga0105247_10029610 3300009101 Bacteria 3319
123 Ga0114129_10154656 3300009147 Bacteria 3137
124 Ga0114129_10406824 3300009147 Bacteria 1793
125 Ga0114129_10645046 3300009147 Bacteria 1367
126 Ga0105243_10017778 3300009148 Bacteria 5379
127 Ga0105243_10040116 3300009148 Bacteria 3654
128 Ga0105243_11126980 3300009148 Bacteria 794
129 Ga0105241_10010389 3300009174 Bacteria 6832
130 Ga0105241_10145104 3300009174 Bacteria 1936
131 Ga0105242_10671822 3300009176 Bacteria 1010
132 Ga0105242_11375078 3300009176 Unclassified 732
133 Ga0105248_10005428 3300009177 Bacteria 14007
134 Ga0105248_10362687 3300009177 Bacteria 1631
135 Ga0105248_10624676 3300009177 Bacteria 1215
136 Ga0105238_10012617 3300009551 Bacteria 8529
137 Ga0105238_10318525 3300009551 Bacteria 1541
138 Ga0105249_10028354 3300009553 Bacteria 5054
139 Ga0105249_10213387 3300009553 Bacteria 1895
140 Ga0105249_10513050 3300009553 Bacteria 1245
141 Ga0105249_11077741 3300009553 Bacteria 873
142 Ga0099796_10000246 3300010159 Bacteria 8562
143 Ga0105239_10008773 3300010375 Bacteria 11443
144 Ga0105246_10056167 3300011119 Bacteria 2720
145 Ga0157374_10045456 3300013296 Bacteria 4064
146 Ga0157374_10261107 3300013296 Bacteria 1706
147 Ga0157378_10095413 3300013297 Bacteria 2709
148 Ga0157378_10253598 3300013297 Bacteria 1685
149 Ga0157378_10430553 3300013297 Bacteria 1306
150 Ga0163162_10002542 3300013306 Bacteria 17266
151 Ga0163162_10384953 3300013306 Bacteria 1536
152 Ga0163162_10460219 3300013306 Bacteria 1404
153 Ga0163162_10618389 3300013306 Bacteria 1209
154 Ga0157372_10701842 3300013307 Bacteria 1177
155 Ga0157375_10004280 3300013308 Bacteria 12382
156 Ga0157375_10014491 3300013308 Bacteria 7034
157 Ga0163163_10004598 3300014325 Bacteria 11784
158 Ga0163163_10031699 3300014325 Bacteria 5103
159 Ga0163163_10078160 3300014325 Bacteria 3305
160 Ga0157380_10000130 3300014326 Bacteria 41786
161 Ga0157380_10098791 3300014326 Bacteria 2426
162 Ga0157380_10270382 3300014326 Bacteria 1549
163 Ga0157379_10073025 3300014968 Bacteria 3070
164 Ga0157379_10178570 3300014968 Bacteria 1918
165 Ga0157379_10257159 3300014968 Bacteria 1586
166 Ga0157379_10351652 3300014968 Bacteria 1349
167 Ga0157376_10043871 3300014969 Bacteria 3672
168 Ga0157376_10199979 3300014969 Bacteria 1838
169 Ga0157376_10201268 3300014969 Bacteria 1832
170 Ga0163161_10039181 3300017792 Bacteria 3401
171 Ga0163161_10734420 3300017792 Bacteria 825
172 Ga0224572_1004446 3300024225 Bacteria 2439
173 Ga0209257_1000391 3300025304 Bacteria 87258
174 Ga0207656_10022691 3300025321 Bacteria 2521
175 Ga0207642_10051228 3300025899 Bacteria 1867
176 Ga0207680_10007774 3300025903 Bacteria 5239
177 Ga0207699_10143179 3300025906 Bacteria 1573
178 Ga0207699_10558221 3300025906 Bacteria 831
179 Ga0207645_10139315 3300025907 Bacteria 1580
180 Ga0207643_10031163 3300025908 Bacteria 2971
181 Ga0207707_11013001 3300025912 Bacteria 681
182 Ga0207662_10018188 3300025918 Bacteria 3983
183 Ga0207662_10595924 3300025918 Bacteria 768
184 Ga0207681_10133030 3300025923 Bacteria 1841
185 Ga0207681_10397810 3300025923 Bacteria 1112
186 Ga0207681_10529154 3300025923 Bacteria 968
187 Ga0207694_10301913 3300025924 Bacteria 1318
188 Ga0207650_10005392 3300025925 Bacteria 8726
189 Ga0207650_10118733 3300025925 Bacteria 2056
190 Ga0207650_10268666 3300025925 Bacteria 1385
191 Ga0207659_10011542 3300025926 Bacteria 5583
192 Ga0207659_10656771 3300025926 Bacteria 896
193 Ga0207644_10036704 3300025931 Bacteria 3442
194 Ga0207686_10735581 3300025934 Bacteria 786
195 Ga0207709_10018621 3300025935 Bacteria 3892
196 Ga0207670_10069032 3300025936 Bacteria 2437
197 Ga0207670_10286350 3300025936 Bacteria 1286
198 Ga0207670_10299038 3300025936 Bacteria 1260
199 Ga0207669_10629543 3300025937 Bacteria 875
200 Ga0207704_10017244 3300025938 Bacteria 3737
201 Ga0207704_11054514 3300025938 Bacteria 689
202 Ga0207691_10017863 3300025940 Bacteria 6721
203 Ga0207691_10132337 3300025940 Bacteria 2202
204 Ga0207691_10301643 3300025940 Bacteria 1376
205 Ga0207711_10006474 3300025941 Bacteria 9856
206 Ga0207711_10363705 3300025941 Bacteria 1341
207 Ga0207689_10083896 3300025942 Bacteria 2619
208 Ga0207689_10135612 3300025942 Bacteria 2026
209 Ga0207651_10008528 3300025960 Bacteria 5541
210 Ga0207651_10780002 3300025960 Bacteria 846
211 Ga0207712_10042741 3300025961 Bacteria 3123
212 Ga0207640_10114633 3300025981 Bacteria 1918
213 Ga0207658_10132394 3300025986 Bacteria 2005
214 Ga0207658_10370367 3300025986 Bacteria 1252
215 Ga0207703_10019243 3300026035 Bacteria 5332
216 Ga0207703_10130980 3300026035 Bacteria 2166
217 Ga0207639_10574996 3300026041 Bacteria 1037
218 Ga0207678_10446483 3300026067 Bacteria 1124
219 Ga0207678_10548503 3300026067 Bacteria 1011
220 Ga0207702_11927424 3300026078 Bacteria 582
221 Ga0207641_10057098 3300026088 Bacteria 3319
222 Ga0207648_10009696 3300026089 Bacteria 9209
223 Ga0207648_10155938 3300026089 Bacteria 2015
224 Ga0207648_10714344 3300026089 Bacteria 929
225 Ga0207676_10041061 3300026095 Bacteria 3548
226 Ga0207676_10251996 3300026095 Bacteria 1589
227 Ga0207674_10025848 3300026116 Bacteria 6251
228 Ga0207675_100011463 3300026118 Bacteria 8291
229 Ga0207675_100018767 3300026118 Bacteria 6454
230 Ga0207675_100748422 3300026118 Bacteria 988
231 Ga0207675_100752908 3300026118 Bacteria 985
232 Ga0207683_10006335 3300026121 Bacteria 10136
233 Ga0207428_10000053 3300027907 Bacteria 175238
234 Ga0268266_10856708 3300028379 Bacteria 878
235 Ga0268265_10036844 3300028380 Bacteria 3586
236 Ga0268264_10102009 3300028381 Bacteria 2496
237 Ga0268264_10156306 3300028381 Bacteria 2050
238 Ga0268264_11817239 3300028381 Bacteria 619
239 Ga0265760_10039397 3300031090 Bacteria 1406
240 Ga0265325_10009859 3300031241 Bacteria 5561
241 Ga0265331_10093933 3300031250 Bacteria 1385
242 Ga0265327_10004193 3300031251 Bacteria 12980
243 Ga0307513_10038819 3300031456 Bacteria 5285
244 Ga0307513_10149367 3300031456 Bacteria 2249
245 Ga0316575_10049991 3300031665 Bacteria 1664
246 Ga0316579_10012156 3300031691 Bacteria 3677
247 Ga0307412_11092814 3300031911 Bacteria 709
248 Ga0307409_100050142 3300031995 Bacteria 3187
249 Ga0307409_100710974 3300031995 Bacteria 1005
250 Ga0307409_101776622 3300031995 Bacteria 646
251 Ga0307416_100875906 3300032002 Bacteria 997
252 Ga0307416_103222380 3300032002 Bacteria 546
253 Ga0307414_10457243 3300032004 Bacteria 1121
254 Ga0307411_10398597 3300032005 Bacteria 1137
255 Ga0307415_100790575 3300032126 Bacteria 865
256 Ga0373958_0039246 3300034819 Bacteria 962
257 Ga0373928_0013910 3300035084 Bacteria 1620
258 Ga0373956_0072764 3300035119 Bacteria 1570
259 Ga0395900_0212206 3300037418 Bacteria 1954
260 Ga0395898_0077816 3300037466 Bacteria 3201
261 Ga0436364_0172492 3300037853 Bacteria 1150
262 Ga0395901_0153537 3300038443 Bacteria 2418
263 Ga0400489_12814 3300039093 Bacteria 4771
264 Ga0450913_021970 3300042117 Bacteria 591
265 Ga0450890_061711 3300042127 Bacteria 588
266 Ga0439459_0045030 3300042438 Bacteria 951
267 Ga0495592_0207381 3300046454 Bacteria 1318
268 Ga0495638_0003041 3300046460 Bacteria 13361
269 Ga0495605_0043537 3300046474 Bacteria 2225
270 Ga0495584_0017223 3300046491 Bacteria 3682
271 Ga0495663_0010587 3300046525 Bacteria 2566
272 Ga0495598_0128911 3300046537 Bacteria 865
273 Ga0495667_0139975 3300046559 Bacteria 1560
274 Ga0495588_0206237 3300046674 Bacteria 1038
275 Ga0495589_0059381 3300046794 Bacteria 1880
276 Ga0495672_0106808 3300047320 Bacteria 1509
277 Ga0496100_0043110 3300048903 Bacteria 2885
278 Ga0496100_0292299 3300048903 Bacteria 1218
279 Ga0496101_0176525 3300048904 Bacteria 1643
280 Ga0496101_0730182 3300048904 Bacteria 782
281 Ga0496101_1238497 3300048904 Bacteria 584
282 Ga0496102_0171047 3300048905 Bacteria 2045
283 Ga0496102_0376243 3300048905 Bacteria 1337
284 Ga0496103_0027306 3300048906 Bacteria 3458
285 Ga0496104_0073313 3300048907 Bacteria 3257
286 Ga0496104_0103330 3300048907 Bacteria 2730
287 Ga0496105_0000707 3300048908 Bacteria 22599
288 Ga0496106_0058271 3300048909 Bacteria 2924
289 Ga0496106_0176430 3300048909 Bacteria 1695
290 Ga0496107_0037816 3300048910 Bacteria 3464
291 Ga0496107_0174194 3300048910 Bacteria 1597
292 Ga0496107_0424244 3300048910 Bacteria 989
293 Ga0496108_0003990 3300048911 Bacteria 11846
294 Ga0496108_0028354 3300048911 Bacteria 4632
295 Ga0496108_0107963 3300048911 Bacteria 2377
296 Ga0496108_0291363 3300048911 Bacteria 1421
297 Ga0496108_0461444 3300048911 Bacteria 1110
298 Ga0496109_0008372 3300048912 Bacteria 8788
299 Ga0496109_0024763 3300048912 Bacteria 5338
300 Ga0496109_0106829 3300048912 Bacteria 2600
301 Ga0496109_0232920 3300048912 Bacteria 1733
302 Ga0496110_0058143 3300048913 Bacteria 3405
303 Ga0496110_0910404 3300048913 Bacteria 786
304 Ga0496110_1147476 3300048913 Bacteria 685
305 Ga0496111_0066503 3300048914 Bacteria 2618
306 Ga0496112_0004743 3300048915 Bacteria 11586
307 Ga0496112_0006836 3300048915 Bacteria 10054
308 Ga0496112_0329080 3300048915 Bacteria 1472
309 Ga0496113_0170342 3300048916 Bacteria 1724
310 Ga0496114_0045212 3300048917 Bacteria 3657
311 Ga0496115_0037425 3300048918 Bacteria 3845
312 Ga0496126_0231080 3300048929 Bacteria 1550
313 Ga0501034_0149016 3300049571 Bacteria 2316
314 Ga0501034_0292126 3300049571 Bacteria 1568
315 Ga0501036_0118001 3300049572 Unclassified 2241
316 Ga0501038_0153997 3300049574 Unclassified 1873
317 Ga0501042_0012003 3300049578 Bacteria 5858
318 Ga0501042_0119351 3300049578 Bacteria 1899
319 Ga0501048_0315182 3300049582 Bacteria 1114
320 Ga0501067_0145583 3300049583 Bacteria 1320
321 Ga0501071_0114883 3300049587 Unclassified 1992
322 Ga0501074_0349957 3300049590 Bacteria 1049
323 Ga0501077_0106155 3300049593 Unclassified 1780
324 Ga0501077_0318685 3300049593 Bacteria 991
325 Ga0501079_0172561 3300049741 Unclassified 1686
326 Ga0501080_0538202 3300049742 Unclassified 1041
327 Ga0501081_0029868 3300049743 Unclassified 3685
328 Ga0501081_0224121 3300049743 Bacteria 1368
329 Ga0501081_0485698 3300049743 Bacteria 920
330 Ga0501083_0421851 3300049744 Bacteria 868
331 Ga0501035_0780221 3300049822 Unclassified 765
332 Ga0501045_0162581 3300049824 Unclassified 1662
333 nmdc:mga00v17_146037_c1 3300050491 Bacteria 1518
334 nmdc:mga0yw44_3603_c1 3300050492 Bacteria 6909
335 nmdc:mga05p37_1110793_c1 3300050507 Bacteria 827
336 nmdc:mga05p37_132481_c2 3300050507 Bacteria 1781
337 nmdc:mga08y16_30_c1 3300050511 Bacteria 197110
338 nmdc:mga08y16_419911_c1 3300050511 Bacteria 1367
339 nmdc:mga0n895_215252_c1 3300050512 Bacteria 1951
340 nmdc:mga0rr50_886673_c1 3300050513 Bacteria 761
341 nmdc:mga0a205_378456_c1 3300050515 Bacteria 1281
342 Ga0495619_0027742 3300053085 Bacteria 3650
343 Ga0495619_0399660 3300053085 Bacteria 949
344 Ga0500592_001954 3300053116 Bacteria 3311
345 Ga0500658_0121014 3300053134 Bacteria 1160
346 Ga0500568_0219118 3300053139 Bacteria 695
347 Ga0500577_0143240 3300053142 Bacteria 1009
348 Ga0500577_0174070 3300053142 Bacteria 922
349 Ga0501084_0015930 3300054114 Bacteria 6237
350 Ga0501084_1165992 3300054114 Bacteria 646
351 Ga0501082_0196803 3300060353 Unclassified 1753
352 Ga0530510_0121695 3300061734 Bacteria 1916
353 2599937194 2599185301 Bacteria 6161860
354 2888337618 2888337043 Bacteria 6629336
355 2958070196 2958064165 Bacteria 7158582
356 Ga0207670_10896450
357 MBSR1b_contig_8066827
358 rootH2_10024030
359 Ga0065712_10177548
360 Ga0065715_10231152
361 Ga0065707_10000450
362 Ga0065707_10103182
363 Ga0065707_10213936
364 Ga0070676_10131841
365 Ga0070690_100139509
366 Ga0070670_100010203
367 Ga0070670_100049669
368 Ga0070670_100100675
369 Ga0070670_100783618
370 Ga0068869_100134288
371 Ga0068869_100159929
372 Ga0070666_10060834
373 Ga0070682_100374932
374 Ga0068868_100502413
375 Ga0070689_100062696
376 Ga0070689_100155551
377 Ga0070689_100186988
378 Ga0070689_100353671
379 Ga0070687_100156712
380 Ga0070687_100594962
381 Ga0070687_100618898
382 Ga0070661_100165473
383 Ga0070668_100034798
384 Ga0070668_101621002
385 Ga0070669_100090683
386 Ga0070669_100181647
387 Ga0070669_100262674
388 Ga0070669_100767095
389 Ga0070675_100042836
390 Ga0070675_100428886
391 Ga0070675_101055677
392 Ga0070675_101635526
393 Ga0070671_100039385
394 Ga0070674_100150480
395 Ga0070673_100003812
396 Ga0070673_100912559
397 Ga0070673_101131838
398 Ga0070688_100016534
399 Ga0070667_100098253
400 Ga0070667_100200655
401 Ga0070701_10385150
402 Ga0070705_100290320
403 Ga0070700_100044368
404 Ga0070708_101067049
405 Ga0070663_100038812
406 Ga0070663_100153384
407 Ga0070678_100032214
408 Ga0070662_100470130
409 Ga0068867_100035074
410 Ga0068867_100819337
411 Ga0070685_10304627
412 Ga0070684_100064419
413 Ga0068853_100028919
414 Ga0068853_101636604
415 Ga0070672_100072962
416 Ga0070672_100167729
417 Ga0070672_100244430
418 Ga0070686_100166192
419 Ga0070695_100295638
420 Ga0070665_100038518
421 Ga0068855_100251414
422 Ga0070664_100468371
423 Ga0068857_100008746
424 Ga0068856_100068418
425 Ga0068856_101598679
426 Ga0070702_100092317
427 Ga0070702_100469534
428 Ga0068852_100098089
429 Ga0068852_101286009
430 Ga0068859_100059400
431 Ga0068859_100136670
432 Ga0068859_100255821
433 Ga0068864_100041179
434 Ga0068864_100117966
435 Ga0068861_100019345
436 Ga0068861_100142669
437 Ga0068861_100829990
438 Ga0068851_10022877
439 Ga0068863_100006356
440 Ga0068858_100002811
441 Ga0068858_100092576
442 Ga0068860_100123593
443 Ga0068860_100164355
444 Ga0068862_100213382
445 Ga0068862_100236108
446 Ga0081455_10001657
447 Ga0081455_10173844
448 Ga0081455_10261261
449 Ga0081455_10495968
450 Ga0081538_10014917
451 Ga0081538_10044923
452 Ga0075365_10453413
453 Ga0075364_10365226
454 Ga0070716_100411966
455 Ga0097621_100076061
456 Ga0097621_100413925
457 Ga0068871_100034856
458 Ga0068871_100112815
459 Ga0068871_100123007
460 Ga0075428_100073907
461 Ga0075428_100247218
462 Ga0075428_100278509
463 Ga0075428_100310512
464 Ga0075428_100750758
465 Ga0075430_100000276
466 Ga0075430_100417961
467 Ga0075434_100598701
468 Ga0068865_100329885
469 Ga0068865_101099143
470 Ga0097620_100059400
471 Ga0097620_100136670
472 Ga0097620_100255812
473 Ga0105240_10067583
474 Ga0111539_10000273
475 Ga0111539_12578746
476 Ga0105245_10165825
477 Ga0105247_10029610
478 Ga0114129_10154656
479 Ga0114129_10406824
480 Ga0114129_10645046
481 Ga0105243_10017778
482 Ga0105243_10040116
483 Ga0105243_11126980
484 Ga0105241_10010389
485 Ga0105241_10145104
486 Ga0105242_10671822
487 Ga0105242_11375078
488 Ga0105248_10005428
489 Ga0105248_10362687
490 Ga0105248_10624676
491 Ga0105238_10012617
492 Ga0105238_10318525
493 Ga0105249_10028354
494 Ga0105249_10213387
495 Ga0105249_10513050
496 Ga0105249_11077741
497 Ga0099796_10000246
498 Ga0105239_10008773
499 Ga0105246_10056167
500 Ga0157374_10045456
501 Ga0157374_10261107
502 Ga0157378_10095413
503 Ga0157378_10253598
504 Ga0157378_10430553
505 Ga0163162_10002542
506 Ga0163162_10384953
507 Ga0163162_10460219
508 Ga0163162_10618389
509 Ga0157372_10701842
510 Ga0157375_10004280
511 Ga0157375_10014491
512 Ga0163163_10004598
513 Ga0163163_10031699
514 Ga0163163_10078160
515 Ga0157380_10000130
516 Ga0157380_10098791
517 Ga0157380_10270382
518 Ga0157379_10073025
519 Ga0157379_10178570
520 Ga0157379_10257159
521 Ga0157379_10351652
522 Ga0157376_10043871
523 Ga0157376_10199979
524 Ga0157376_10201268
525 Ga0163161_10039181
526 Ga0163161_10734420
527 Ga0224572_1004446
528 Ga0209257_1000391
529 Ga0207656_10022691
530 Ga0207642_10051228
531 Ga0207680_10007774
532 Ga0207699_10143179
533 Ga0207699_10558221
534 Ga0207645_10139315
535 Ga0207643_10031163
536 Ga0207707_11013001
537 Ga0207662_10018188
538 Ga0207662_10595924
539 Ga0207681_10133030
540 Ga0207681_10397810
541 Ga0207681_10529154
542 Ga0207694_10301913
543 Ga0207650_10005392
544 Ga0207650_10118733
545 Ga0207650_10268666
546 Ga0207659_10011542
547 Ga0207659_10656771
548 Ga0207644_10036704
549 Ga0207686_10735581
550 Ga0207709_10018621
551 Ga0207670_10069032
552 Ga0207670_10286350
553 Ga0207670_10299038
554 Ga0207669_10629543
555 Ga0207704_10017244
556 Ga0207704_11054514
557 Ga0207691_10017863
558 Ga0207691_10132337
559 Ga0207691_10301643
560 Ga0207711_10006474
561 Ga0207711_10363705
562 Ga0207689_10083896
563 Ga0207689_10135612
564 Ga0207651_10008528
565 Ga0207651_10780002
566 Ga0207712_10042741
567 Ga0207640_10114633
568 Ga0207658_10132394
569 Ga0207658_10370367
570 Ga0207703_10019243
571 Ga0207703_10130980
572 Ga0207639_10574996
573 Ga0207678_10446483
574 Ga0207678_10548503
575 Ga0207702_11927424
576 Ga0207641_10057098
577 Ga0207648_10009696
578 Ga0207648_10155938
579 Ga0207648_10714344
580 Ga0207676_10041061
581 Ga0207676_10251996
582 Ga0207674_10025848
583 Ga0207675_100011463
584 Ga0207675_100018767
585 Ga0207675_100748422
586 Ga0207675_100752908
587 Ga0207683_10006335
588 Ga0207428_10000053
589 Ga0268266_10856708
590 Ga0268265_10036844
591 Ga0268264_10102009
592 Ga0268264_10156306
593 Ga0268264_11817239
594 Ga0265760_10039397
595 Ga0265325_10009859
596 Ga0265331_10093933
597 Ga0265327_10004193
598 Ga0307513_10038819
599 Ga0307513_10149367
600 Ga0316575_10049991
601 Ga0316579_10012156
602 Ga0307412_11092814
603 Ga0307409_100050142
604 Ga0307409_100710974
605 Ga0307409_101776622
606 Ga0307416_100875906
607 Ga0307416_103222380
608 Ga0307414_10457243
609 Ga0307411_10398597
610 Ga0307415_100790575
611 Ga0373958_0039246
612 Ga0373928_0013910
613 Ga0373956_0072764
614 Ga0395900_0212206
615 Ga0395898_0077816
616 Ga0436364_0172492
617 Ga0395901_0153537
618 Ga0400489_12814
619 Ga0450913_021970
620 Ga0450890_061711
621 Ga0439459_0045030
622 Ga0495592_0207381
623 Ga0495638_0003041
624 Ga0495605_0043537
625 Ga0495584_0017223
626 Ga0495663_0010587
627 Ga0495598_0128911
628 Ga0495667_0139975
629 Ga0495588_0206237
630 Ga0495589_0059381
631 Ga0495672_0106808
632 Ga0496100_0043110
633 Ga0496100_0292299
634 Ga0496101_0176525
635 Ga0496101_0730182
636 Ga0496101_1238497
637 Ga0496102_0171047
638 Ga0496102_0376243
639 Ga0496103_0027306
640 Ga0496104_0073313
641 Ga0496104_0103330
642 Ga0496105_0000707
643 Ga0496106_0058271
644 Ga0496106_0176430
645 Ga0496107_0037816
646 Ga0496107_0174194
647 Ga0496107_0424244
648 Ga0496108_0003990
649 Ga0496108_0028354
650 Ga0496108_0107963
651 Ga0496108_0291363
652 Ga0496108_0461444
653 Ga0496109_0008372
654 Ga0496109_0024763
655 Ga0496109_0106829
656 Ga0496109_0232920
657 Ga0496110_0058143
658 Ga0496110_0910404
659 Ga0496110_1147476
660 Ga0496111_0066503
661 Ga0496112_0004743
662 Ga0496112_0006836
663 Ga0496112_0329080
664 Ga0496113_0170342
665 Ga0496114_0045212
666 Ga0496115_0037425
667 Ga0496126_0231080
668 Ga0501034_0149016
669 Ga0501034_0292126
670 Ga0501036_0118001
671 Ga0501038_0153997
672 Ga0501042_0012003
673 Ga0501042_0119351
674 Ga0501048_0315182
675 Ga0501067_0145583
676 Ga0501071_0114883
677 Ga0501074_0349957
678 Ga0501077_0106155
679 Ga0501077_0318685
680 Ga0501079_0172561
681 Ga0501080_0538202
682 Ga0501081_0029868
683 Ga0501081_0224121
684 Ga0501081_0485698
685 Ga0501083_0421851
686 Ga0501035_0780221
687 Ga0501045_0162581
688 nmdc:mga00v17_146037_c1
689 nmdc:mga0yw44_3603_c1
690 nmdc:mga05p37_1110793_c1
691 nmdc:mga05p37_132481_c2
692 nmdc:mga08y16_30_c1
693 nmdc:mga08y16_419911_c1
694 nmdc:mga0n895_215252_c1
695 nmdc:mga0rr50_886673_c1
696 nmdc:mga0a205_378456_c1
697 Ga0495619_0027742
698 Ga0495619_0399660
699 Ga0500592_001954
700 Ga0500658_0121014
701 Ga0500568_0219118
702 Ga0500577_0143240
703 Ga0500577_0174070
704 Ga0501084_0015930
705 Ga0501084_1165992
706 Ga0501082_0196803
707 Ga0530510_0121695
708 2599937194
709 2888337618
710 2958070196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

43

177

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9407 10 148
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9202 10 148
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9125 10 153
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9047 10 148
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.899 10 153
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8914 10 146 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8589 11 146 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8562 12 148 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.855 10 146 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8501 9 146 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6G6WN77-F1-model_v4 Arsenate reductase ArsC 0.9967 7 168 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1F4ARG2-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9938 9 169 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1Q3JQI2-F1-model_v4 ArsR family transcriptional regulator 0.9925 7 149 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A434U3P1-F1-model_v4 Arsenate reductase ArsC 0.992 6 167 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A0P1EPZ7-F1-model_v4 Arsenate reductase (EC 1.20.4.-) 0.9906 6 170 GO:0004726
GO:0016491
GO:0030946
GO:0046685
GO:0140793

Map