F420104

General Info

Members Datasets Scaffolds Average Seq Length
355 186 710 194

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10282839|Ga0114129_102828392
Length 237
Sequence VERDRELGRDNDDEVGPQKGHKSTKKSFADCAFCASLWLKKLFEAEMDQLNIPVLLGTSRKLRKSSFVAKWLVSEMEKRPEIRTLLFDVVDFNLPHDDYGQEIKDLFPEWRDAIVQADGLVIVTPEYNHGYPGSLKAVLDLLLREYVHKAVAFVGVSAGPWGGTRVIEAMVPMVRELGLAVCFTDLNFPRVQTLFDEQGKLLDNAFEQRAKDFLDELVWMSRVLKWGRTNVPSKFHS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
155 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
159 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
162 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
169 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
170 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
171 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
172 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
173 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
174 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
175 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
176 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
177 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
178 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
179 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 25.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10282839 3300009147 Unclassified 2216
2 MRS1a_Contig_2295 2124908026 Bacteria 1031
3 CNBas_1003647 3300000531 Bacteria 863
4 JGI24034J14986_101112 3300001432 Unclassified 1578
5 JGI24748J21848_1000004 3300002074 Bacteria 262344
6 JGI24034J26672_10000001 3300002239 Bacteria 1118280
7 JGI25406J46586_10006204 3300003203 Bacteria 5519
8 rootH2_10228131 3300003320 Bacteria 1117
9 rootL2_10256707 3300003322 Bacteria 1257
10 Ga0065714_10064531 3300005288 Bacteria 40961
11 Ga0065704_10260022 3300005289 Unclassified 957
12 Ga0065712_10000123 3300005290 Bacteria 89338
13 Ga0065715_10000524 3300005293 Bacteria 17576
14 Ga0065715_10006762 3300005293 Bacteria 3451
15 Ga0065715_10193344 3300005293 Bacteria 1402
16 Ga0065715_10369995 3300005293 Bacteria 922
17 Ga0065715_10748844 3300005293 Unclassified 631
18 Ga0065707_10120220 3300005295 Bacteria 2140
19 Ga0065707_10213367 3300005295 Unclassified 1251
20 Ga0070690_100025723 3300005330 Bacteria 3625
21 Ga0070690_100530036 3300005330 Unclassified 885
22 Ga0070670_100002890 3300005331 Bacteria 14215
23 Ga0068869_100257580 3300005334 Bacteria 1396
24 Ga0070666_10014818 3300005335 Bacteria 4968
25 Ga0070682_100000127 3300005337 Bacteria 65316
26 Ga0068868_100208360 3300005338 Bacteria 1633
27 Ga0070689_100008641 3300005340 Bacteria 7185
28 Ga0070689_100171040 3300005340 Bacteria 1760
29 Ga0070689_100361754 3300005340 Unclassified 1219
30 Ga0070689_100431932 3300005340 Unclassified 1118
31 Ga0070669_100807074 3300005353 Bacteria 798
32 Ga0070675_100124660 3300005354 Unclassified 2191
33 Ga0070671_100019223 3300005355 Bacteria 5558
34 Ga0070671_101156820 3300005355 Bacteria 680
35 Ga0070673_100392430 3300005364 Bacteria 1239
36 Ga0070667_100290323 3300005367 Bacteria 1470
37 Ga0070667_100733783 3300005367 Bacteria 915
38 Ga0070703_10000356 3300005406 Bacteria 19880
39 Ga0070701_10801735 3300005438 Bacteria 642
40 Ga0070705_100048971 3300005440 Bacteria 2451
41 Ga0070705_100263199 3300005440 Bacteria 1217
42 Ga0070705_100754592 3300005440 Unclassified 770
43 Ga0070700_100000062 3300005441 Bacteria 79866
44 Ga0070700_100387670 3300005441 Unclassified 1047
45 Ga0070700_101065035 3300005441 Bacteria 668
46 Ga0070694_100001725 3300005444 Bacteria 12883
47 Ga0070694_100159887 3300005444 Bacteria 1652
48 Ga0070694_100170533 3300005444 Bacteria 1603
49 Ga0070694_100302508 3300005444 Bacteria 1226
50 Ga0070678_100289891 3300005456 Unclassified 1387
51 Ga0070662_100109188 3300005457 Bacteria 2105
52 Ga0070681_10996534 3300005458 Bacteria 757
53 Ga0068867_100869339 3300005459 Unclassified 809
54 Ga0068867_101095959 3300005459 Bacteria 727
55 Ga0070685_10181110 3300005466 Bacteria 1356
56 Ga0070706_100000137 3300005467 Bacteria 91778
57 Ga0070706_100240399 3300005467 Unclassified 1691
58 Ga0070707_100271086 3300005468 Bacteria 1650
59 Ga0070698_100109412 3300005471 Bacteria 2730
60 Ga0070698_100622891 3300005471 Unclassified 1020
61 Ga0070699_100012376 3300005518 Bacteria 7362
62 Ga0070699_100021456 3300005518 Bacteria 5570
63 Ga0070699_100170161 3300005518 Bacteria 1930
64 Ga0070684_100071520 3300005535 Bacteria 3053
65 Ga0070697_100001105 3300005536 Bacteria 20397
66 Ga0070697_100525808 3300005536 Unclassified 1036
67 Ga0070697_100571582 3300005536 Bacteria 992
68 Ga0070697_100796335 3300005536 Unclassified 836
69 Ga0070672_100675095 3300005543 Unclassified 903
70 Ga0070686_100352345 3300005544 Bacteria 1106
71 Ga0070695_100028954 3300005545 Unclassified 3439
72 Ga0070695_100502062 3300005545 Unclassified 938
73 Ga0070696_100156210 3300005546 Bacteria 1678
74 Ga0070696_100197253 3300005546 Bacteria 1501
75 Ga0070693_100002371 3300005547 Bacteria 8657
76 Ga0070693_100011362 3300005547 Bacteria 4484
77 Ga0070693_100100569 3300005547 Bacteria 1761
78 Ga0070693_100652695 3300005547 Unclassified 765
79 Ga0070704_100294568 3300005549 Bacteria 1349
80 Ga0070704_100403945 3300005549 Bacteria 1166
81 Ga0070704_100751510 3300005549 Unclassified 868
82 Ga0070704_100942890 3300005549 Unclassified 778
83 Ga0070704_101460966 3300005549 Unclassified 628
84 Ga0070664_100319469 3300005564 Bacteria 1406
85 Ga0068857_101384409 3300005577 Bacteria 684
86 Ga0068854_100309361 3300005578 Bacteria 1281
87 Ga0070702_100153299 3300005615 Unclassified 1482
88 Ga0070702_100867025 3300005615 Bacteria 704
89 Ga0068852_101070550 3300005616 Bacteria 826
90 Ga0068859_100003290 3300005617 Bacteria 16432
91 Ga0068859_100033712 3300005617 Bacteria 5141
92 Ga0068859_100046746 3300005617 Bacteria 4346
93 Ga0068859_100066616 3300005617 Bacteria 3636
94 Ga0068859_100141656 3300005617 Unclassified 2478
95 Ga0068859_100230151 3300005617 Bacteria 1941
96 Ga0068859_101368129 3300005617 Unclassified 781
97 Ga0068864_100045228 3300005618 Bacteria 3776
98 Ga0068864_100071593 3300005618 Bacteria 3019
99 Ga0068864_100107183 3300005618 Unclassified 2485
100 Ga0068864_100246337 3300005618 Bacteria 1657
101 Ga0068864_100457120 3300005618 Bacteria 1222
102 Ga0068864_100595359 3300005618 Bacteria 1072
103 Ga0068864_100693909 3300005618 Unclassified 994
104 Ga0068851_10120762 3300005834 Unclassified 1408
105 Ga0068870_10167732 3300005840 Bacteria 1307
106 Ga0068863_100207449 3300005841 Unclassified 1886
107 Ga0068858_100000076 3300005842 Bacteria 104002
108 Ga0068858_100212572 3300005842 Bacteria 1830
109 Ga0068860_100026089 3300005843 Bacteria 5636
110 Ga0068860_100137688 3300005843 Bacteria 2345
111 Ga0068860_100168228 3300005843 Bacteria 2117
112 Ga0068860_100192405 3300005843 Bacteria 1974
113 Ga0068860_101655148 3300005843 Bacteria 662
114 Ga0068862_100022746 3300005844 Bacteria 5245
115 Ga0068862_100313245 3300005844 Unclassified 1447
116 Ga0068862_101441763 3300005844 Unclassified 693
117 Ga0081539_10000422 3300005985 Bacteria 90043
118 Ga0081539_10002223 3300005985 Bacteria 28295
119 Ga0075428_100050402 3300006844 Bacteria 4566
120 Ga0075428_100802030 3300006844 Unclassified 1001
121 Ga0075433_10007504 3300006852 Bacteria 8655
122 Ga0075433_10050463 3300006852 Unclassified 3622
123 Ga0075434_100205428 3300006871 Unclassified 1990
124 Ga0075434_100472968 3300006871 Bacteria 1274
125 Ga0075429_100209863 3300006880 Unclassified 1706
126 Ga0068865_100057479 3300006881 Bacteria 2714
127 Ga0075436_100026664 3300006914 Unclassified 3979
128 Ga0097620_100003290 3300006931 Bacteria 16432
129 Ga0097620_100033708 3300006931 Bacteria 5141
130 Ga0097620_100046747 3300006931 Bacteria 4346
131 Ga0097620_100052337 3300006931 Bacteria 4105
132 Ga0097620_100066617 3300006931 Bacteria 3636
133 Ga0097620_100141656 3300006931 Unclassified 2478
134 Ga0097620_100228804 3300006931 Unclassified 1947
135 Ga0097620_100230176 3300006931 Bacteria 1941
136 Ga0097620_101368163 3300006931 Unclassified 781
137 Ga0075435_100031200 3300007076 Unclassified 4196
138 Ga0105251_10039504 3300009011 Unclassified 2305
139 Ga0105251_10040637 3300009011 Bacteria 2267
140 Ga0105250_10028380 3300009092 Archaea 2254
141 Ga0105240_10265334 3300009093 Unclassified 1979
142 Ga0111539_10030591 3300009094 Bacteria 6543
143 Ga0111539_10304824 3300009094 Bacteria 1853
144 Ga0111539_10581147 3300009094 Bacteria 1305
145 Ga0105247_10000002 3300009101 Bacteria 724587
146 Ga0105247_10012690 3300009101 Bacteria 5055
147 Ga0105247_10101486 3300009101 Bacteria 1840
148 Ga0114129_10994055 3300009147 Bacteria 1057
149 Ga0114129_11121732 3300009147 Unclassified 984
150 Ga0105243_10000187 3300009148 Bacteria 72048
151 Ga0105243_10507227 3300009148 Bacteria 1144
152 Ga0105241_10571013 3300009174 Bacteria 1018
153 Ga0105241_10763916 3300009174 Bacteria 887
154 Ga0105242_10000008 3300009176 Bacteria 172348
155 Ga0105242_10172191 3300009176 Bacteria 1903
156 Ga0105248_10010126 3300009177 Bacteria 10385
157 Ga0105248_10013210 3300009177 Bacteria 9091
158 Ga0105248_10228262 3300009177 Bacteria 2096
159 Ga0105248_10236817 3300009177 Bacteria 2055
160 Ga0105237_10000903 3300009545 Bacteria 39910
161 Ga0105249_10000052 3300009553 Bacteria 168047
162 Ga0105249_10117104 3300009553 Bacteria 2526
163 Ga0105246_10026260 3300011119 Unclassified 3802
164 Ga0157373_10019191 3300013100 Unclassified 4979
165 Ga0157378_10015334 3300013297 Bacteria 6711
166 Ga0163162_10000001 3300013306 Bacteria 751833
167 Ga0163162_10034999 3300013306 Bacteria 5000
168 Ga0163162_10047582 3300013306 Unclassified 4298
169 Ga0163162_10097002 3300013306 Bacteria 3036
170 Ga0163162_10211481 3300013306 Unclassified 2069
171 Ga0163162_10806540 3300013306 Bacteria 1056
172 Ga0157372_10513466 3300013307 Unclassified 1397
173 Ga0157375_10534604 3300013308 Unclassified 1335
174 Ga0163163_10096700 3300014325 Bacteria 2974
175 Ga0163163_10125971 3300014325 Bacteria 2599
176 Ga0163163_10149393 3300014325 Bacteria 2381
177 Ga0163163_10159315 3300014325 Bacteria 2302
178 Ga0157380_10017876 3300014326 Bacteria 5256
179 Ga0157380_10242800 3300014326 Unclassified 1625
180 Ga0157379_10034546 3300014968 Bacteria 4508
181 Ga0157379_10059879 3300014968 Bacteria 3405
182 Ga0157379_10150091 3300014968 Archaea 2102
183 Ga0157379_10349159 3300014968 Bacteria 1354
184 Ga0163161_10132959 3300017792 Bacteria 1878
185 Ga0163161_10274432 3300017792 Unclassified 1320
186 Ga0163161_10309032 3300017792 Bacteria 1247
187 Ga0207672_1000038 3300025223 Bacteria 17223
188 Ga0207653_10000121 3300025885 Bacteria 55532
189 Ga0207653_10000561 3300025885 Bacteria 13516
190 Ga0207653_10122873 3300025885 Bacteria 936
191 Ga0207710_10000002 3300025900 Bacteria 1251998
192 Ga0207710_10273736 3300025900 Unclassified 848
193 Ga0207680_10016591 3300025903 Bacteria 3871
194 Ga0207685_10208712 3300025905 Unclassified 922
195 Ga0207643_10031029 3300025908 Bacteria 2978
196 Ga0207684_10000314 3300025910 Bacteria 68706
197 Ga0207684_10005620 3300025910 Bacteria 11531
198 Ga0207684_10323996 3300025910 Bacteria 1328
199 Ga0207707_10804969 3300025912 Bacteria 783
200 Ga0207695_10023796 3300025913 Bacteria 6913
201 Ga0207671_10006486 3300025914 Bacteria 10414
202 Ga0207681_10002990 3300025923 Bacteria 10627
203 Ga0207681_10059782 3300025923 Unclassified 2614
204 Ga0207650_10375385 3300025925 Bacteria 1173
205 Ga0207659_10058552 3300025926 Bacteria 2766
206 Ga0207659_10300423 3300025926 Unclassified 1318
207 Ga0207644_10004938 3300025931 Bacteria 8698
208 Ga0207644_10016007 3300025931 Bacteria 5042
209 Ga0207644_10544953 3300025931 Bacteria 960
210 Ga0207644_10868937 3300025931 Bacteria 755
211 Ga0207644_11061594 3300025931 Bacteria 680
212 Ga0207690_10151607 3300025932 Bacteria 1719
213 Ga0207686_10000023 3300025934 Bacteria 172422
214 Ga0207686_10039759 3300025934 Unclassified 2855
215 Ga0207686_10295379 3300025934 Bacteria 1201
216 Ga0207709_10000062 3300025935 Bacteria 194534
217 Ga0207709_10074247 3300025935 Unclassified 2169
218 Ga0207709_10134442 3300025935 Bacteria 1690
219 Ga0207670_10184075 3300025936 Unclassified 1575
220 Ga0207670_10228560 3300025936 Bacteria 1428
221 Ga0207704_10079762 3300025938 Bacteria 2111
222 Ga0207665_10153390 3300025939 Bacteria 1652
223 Ga0207711_10017430 3300025941 Bacteria 5967
224 Ga0207711_10020539 3300025941 Bacteria 5509
225 Ga0207711_10124956 3300025941 Unclassified 2300
226 Ga0207711_10260994 3300025941 Bacteria 1592
227 Ga0207711_10292983 3300025941 Unclassified 1500
228 Ga0207689_10068886 3300025942 Bacteria 2907
229 Ga0207661_10643500 3300025944 Bacteria 974
230 Ga0207679_10253941 3300025945 Bacteria 1496
231 Ga0207712_10000925 3300025961 Bacteria 21172
232 Ga0207712_10019104 3300025961 Bacteria 4471
233 Ga0207712_10099270 3300025961 Bacteria 2161
234 Ga0207640_10776105 3300025981 Bacteria 828
235 Ga0207677_10187574 3300026023 Bacteria 1633
236 Ga0207703_10000097 3300026035 Bacteria 103983
237 Ga0207703_10008345 3300026035 Bacteria 8188
238 Ga0207703_10046326 3300026035 Bacteria 3501
239 Ga0207708_10000246 3300026075 Bacteria 42577
240 Ga0207708_10035406 3300026075 Unclassified 3799
241 Ga0207708_10039173 3300026075 Bacteria 3610
242 Ga0207708_10232793 3300026075 Unclassified 1479
243 Ga0207641_10091321 3300026088 Bacteria 2664
244 Ga0207641_11321295 3300026088 Unclassified 722
245 Ga0207641_11348920 3300026088 Unclassified 714
246 Ga0207676_10237074 3300026095 Bacteria 1634
247 Ga0207674_10014664 3300026116 Bacteria 8643
248 Ga0207674_10741569 3300026116 Unclassified 948
249 Ga0207675_100063289 3300026118 Bacteria 3456
250 Ga0207675_101063227 3300026118 Unclassified 829
251 Ga0207683_10433612 3300026121 Unclassified 1211
252 Ga0207428_10023686 3300027907 Bacteria 5159
253 Ga0207428_10436337 3300027907 Unclassified 956
254 Ga0268265_10098086 3300028380 Bacteria 2359
255 Ga0268265_10472446 3300028380 Bacteria 1176
256 Ga0268264_10124145 3300028381 Unclassified 2279
257 Ga0268264_10219540 3300028381 Bacteria 1749
258 Ga0307408_100009490 3300031548 Bacteria 6418
259 Ga0307408_100038123 3300031548 Bacteria 3389
260 Ga0307405_10004850 3300031731 Bacteria 6420
261 Ga0307405_10142911 3300031731 Bacteria 1671
262 Ga0307405_10384661 3300031731 Bacteria 1093
263 Ga0307413_10002210 3300031824 Bacteria 7833
264 Ga0307413_10029079 3300031824 Bacteria 3087
265 Ga0307413_10393751 3300031824 Bacteria 1083
266 Ga0307413_10439319 3300031824 Bacteria 1033
267 Ga0307413_10451169 3300031824 Bacteria 1021
268 Ga0307410_10007654 3300031852 Bacteria 5927
269 Ga0307410_10097828 3300031852 Bacteria 2097
270 Ga0307410_10140481 3300031852 Viruses 1786
271 Ga0307410_10355342 3300031852 Bacteria 1172
272 Ga0307406_10002198 3300031901 Bacteria 10620
273 Ga0307406_10094229 3300031901 Bacteria 2023
274 Ga0307407_10000561 3300031903 Bacteria 11669
275 Ga0307407_10011204 3300031903 Bacteria 4257
276 Ga0307412_10005400 3300031911 Bacteria 7170
277 Ga0307412_10012035 3300031911 Bacteria 5028
278 Ga0307412_10076788 3300031911 Bacteria 2296
279 Ga0307412_10218342 3300031911 Unclassified 1460
280 Ga0307409_100046338 3300031995 Bacteria 3290
281 Ga0307416_100016565 3300032002 Bacteria 5128
282 Ga0307416_100050907 3300032002 Bacteria 3305
283 Ga0307416_100053847 3300032002 Bacteria 3231
284 Ga0307416_100119289 3300032002 Bacteria 2346
285 Ga0307416_100408369 3300032002 Bacteria 1398
286 Ga0307416_101247243 3300032002 Bacteria 849
287 Ga0307416_101943445 3300032002 Unclassified 691
288 Ga0307414_10023060 3300032004 Unclassified 3939
289 Ga0307414_10380147 3300032004 Bacteria 1221
290 Ga0307411_10001147 3300032005 Bacteria 10387
291 Ga0307411_10353612 3300032005 Unclassified 1199
292 Ga0307415_100006399 3300032126 Bacteria 6346
293 Ga0307415_100035755 3300032126 Bacteria 3247
294 Ga0307415_100553769 3300032126 Bacteria 1015
295 Ga0373941_0058228 3300035115 Bacteria 1250
296 Ga0373937_0531906 3300036401 Bacteria 1117
297 Ga0395898_0303860 3300037466 Bacteria 1522
298 Ga0439458_0006021 3300042157 Bacteria 2712
299 Ga0495629_0306665 3300046459 Bacteria 1087
300 Ga0495663_0000174 3300046525 Bacteria 25945
301 Ga0495598_0000093 3300046537 Bacteria 14559
302 Ga0495621_0005211 3300046539 Bacteria 3722
303 Ga0495621_0024136 3300046539 Bacteria 2028
304 Ga0496104_0337519 3300048907 Bacteria 1420
305 Ga0496106_0021082 3300048909 Unclassified 4838
306 Ga0496109_0311564 3300048912 Bacteria 1485
307 Ga0496111_0325712 3300048914 Bacteria 1138
308 Ga0496112_0183058 3300048915 Viruses 2059
309 Ga0496112_0228258 3300048915 Bacteria 1817
310 Ga0501298_000491 3300049521 Bacteria 5323
311 Ga0501298_001877 3300049521 Unclassified 3121
312 Ga0501299_006869 3300049522 Bacteria 1797
313 Ga0501038_0002453 3300049574 Bacteria 17278
314 Ga0501072_0012162 3300049588 Bacteria 6577
315 Ga0501199_004640 3300049650 Bacteria 1358
316 Ga0501201_001504 3300049651 Bacteria 2173
317 Ga0501202_002595 3300049652 Bacteria 3046
318 Ga0501209_025784 3300049656 Viruses 1445
319 Ga0501209_177101 3300049656 Unclassified 650
320 Ga0501216_050037 3300049660 Unclassified 819
321 Ga0501217_000356 3300049661 Bacteria 7299
322 Ga0501217_110357 3300049661 Bacteria 790
323 Ga0501223_004047 3300049663 Unclassified 3155
324 Ga0501227_002390 3300049665 Unclassified 4145
325 Ga0501233_003011 3300049668 Unclassified 3010
326 Ga0501235_014817 3300049669 Bacteria 1718
327 Ga0501235_104268 3300049669 Unclassified 695
328 Ga0501246_001632 3300049676 Bacteria 1734
329 Ga0501247_021633 3300049677 Bacteria 838
330 Ga0501247_025631 3300049677 Unclassified 784
331 Ga0501249_013435 3300049679 Bacteria 1740
332 Ga0501249_028134 3300049679 Bacteria 1245
333 Ga0501249_069254 3300049679 Bacteria 823
334 Ga0501251_011780 3300049681 Bacteria 1047
335 Ga0501259_006956 3300049688 Viruses 1805
336 Ga0501225_0000634 3300049705 Bacteria 10969
337 Ga0501225_0004012 3300049705 Bacteria 4404
338 Ga0501234_001383 3300049707 Unclassified 3804
339 Ga0501245_037426 3300049708 Unclassified 823
340 Ga0501268_037111 3300049765 Bacteria 905
341 Ga0501283_002239 3300049779 Bacteria 2508
342 Ga0501212_051782 3300049851 Unclassified 697
343 Ga0501226_014132 3300049853 Unclassified 881
344 nmdc:mga05p37_656012_c1 3300050507 Unclassified 1174
345 nmdc:mga05p37_761926_c1 3300050507 Bacteria 1065
346 nmdc:mga09592_77406_c1 3300050508 Bacteria 2829
347 nmdc:mga08y16_507670_c1 3300050511 Bacteria 1224
348 nmdc:mga08y16_625119_c1 3300050511 Bacteria 1083
349 nmdc:mga08y16_62667_c1 3300050511 Bacteria 3884
350 nmdc:mga0n895_456069_c1 3300050512 Bacteria 1290
351 nmdc:mga0rr50_28622_c1 3300050513 Unclassified 3919
352 nmdc:mga08x19_21408_c1 3300050514 Unclassified 3991
353 nmdc:mga0a205_137785_c1 3300050515 Unclassified 2341
354 nmdc:mga0a205_20093_c1 3300050515 Bacteria 6301
355 nmdc:mga0a205_60078_c1 3300050515 Bacteria 3671
356 Ga0114129_10282839
357 MRS1a_Contig_2295
358 CNBas_1003647
359 JGI24034J14986_101112
360 JGI24748J21848_1000004
361 JGI24034J26672_10000001
362 JGI25406J46586_10006204
363 rootH2_10228131
364 rootL2_10256707
365 Ga0065714_10064531
366 Ga0065704_10260022
367 Ga0065712_10000123
368 Ga0065715_10000524
369 Ga0065715_10006762
370 Ga0065715_10193344
371 Ga0065715_10369995
372 Ga0065715_10748844
373 Ga0065707_10120220
374 Ga0065707_10213367
375 Ga0070690_100025723
376 Ga0070690_100530036
377 Ga0070670_100002890
378 Ga0068869_100257580
379 Ga0070666_10014818
380 Ga0070682_100000127
381 Ga0068868_100208360
382 Ga0070689_100008641
383 Ga0070689_100171040
384 Ga0070689_100361754
385 Ga0070689_100431932
386 Ga0070669_100807074
387 Ga0070675_100124660
388 Ga0070671_100019223
389 Ga0070671_101156820
390 Ga0070673_100392430
391 Ga0070667_100290323
392 Ga0070667_100733783
393 Ga0070703_10000356
394 Ga0070701_10801735
395 Ga0070705_100048971
396 Ga0070705_100263199
397 Ga0070705_100754592
398 Ga0070700_100000062
399 Ga0070700_100387670
400 Ga0070700_101065035
401 Ga0070694_100001725
402 Ga0070694_100159887
403 Ga0070694_100170533
404 Ga0070694_100302508
405 Ga0070678_100289891
406 Ga0070662_100109188
407 Ga0070681_10996534
408 Ga0068867_100869339
409 Ga0068867_101095959
410 Ga0070685_10181110
411 Ga0070706_100000137
412 Ga0070706_100240399
413 Ga0070707_100271086
414 Ga0070698_100109412
415 Ga0070698_100622891
416 Ga0070699_100012376
417 Ga0070699_100021456
418 Ga0070699_100170161
419 Ga0070684_100071520
420 Ga0070697_100001105
421 Ga0070697_100525808
422 Ga0070697_100571582
423 Ga0070697_100796335
424 Ga0070672_100675095
425 Ga0070686_100352345
426 Ga0070695_100028954
427 Ga0070695_100502062
428 Ga0070696_100156210
429 Ga0070696_100197253
430 Ga0070693_100002371
431 Ga0070693_100011362
432 Ga0070693_100100569
433 Ga0070693_100652695
434 Ga0070704_100294568
435 Ga0070704_100403945
436 Ga0070704_100751510
437 Ga0070704_100942890
438 Ga0070704_101460966
439 Ga0070664_100319469
440 Ga0068857_101384409
441 Ga0068854_100309361
442 Ga0070702_100153299
443 Ga0070702_100867025
444 Ga0068852_101070550
445 Ga0068859_100003290
446 Ga0068859_100033712
447 Ga0068859_100046746
448 Ga0068859_100066616
449 Ga0068859_100141656
450 Ga0068859_100230151
451 Ga0068859_101368129
452 Ga0068864_100045228
453 Ga0068864_100071593
454 Ga0068864_100107183
455 Ga0068864_100246337
456 Ga0068864_100457120
457 Ga0068864_100595359
458 Ga0068864_100693909
459 Ga0068851_10120762
460 Ga0068870_10167732
461 Ga0068863_100207449
462 Ga0068858_100000076
463 Ga0068858_100212572
464 Ga0068860_100026089
465 Ga0068860_100137688
466 Ga0068860_100168228
467 Ga0068860_100192405
468 Ga0068860_101655148
469 Ga0068862_100022746
470 Ga0068862_100313245
471 Ga0068862_101441763
472 Ga0081539_10000422
473 Ga0081539_10002223
474 Ga0075428_100050402
475 Ga0075428_100802030
476 Ga0075433_10007504
477 Ga0075433_10050463
478 Ga0075434_100205428
479 Ga0075434_100472968
480 Ga0075429_100209863
481 Ga0068865_100057479
482 Ga0075436_100026664
483 Ga0097620_100003290
484 Ga0097620_100033708
485 Ga0097620_100046747
486 Ga0097620_100052337
487 Ga0097620_100066617
488 Ga0097620_100141656
489 Ga0097620_100228804
490 Ga0097620_100230176
491 Ga0097620_101368163
492 Ga0075435_100031200
493 Ga0105251_10039504
494 Ga0105251_10040637
495 Ga0105250_10028380
496 Ga0105240_10265334
497 Ga0111539_10030591
498 Ga0111539_10304824
499 Ga0111539_10581147
500 Ga0105247_10000002
501 Ga0105247_10012690
502 Ga0105247_10101486
503 Ga0114129_10994055
504 Ga0114129_11121732
505 Ga0105243_10000187
506 Ga0105243_10507227
507 Ga0105241_10571013
508 Ga0105241_10763916
509 Ga0105242_10000008
510 Ga0105242_10172191
511 Ga0105248_10010126
512 Ga0105248_10013210
513 Ga0105248_10228262
514 Ga0105248_10236817
515 Ga0105237_10000903
516 Ga0105249_10000052
517 Ga0105249_10117104
518 Ga0105246_10026260
519 Ga0157373_10019191
520 Ga0157378_10015334
521 Ga0163162_10000001
522 Ga0163162_10034999
523 Ga0163162_10047582
524 Ga0163162_10097002
525 Ga0163162_10211481
526 Ga0163162_10806540
527 Ga0157372_10513466
528 Ga0157375_10534604
529 Ga0163163_10096700
530 Ga0163163_10125971
531 Ga0163163_10149393
532 Ga0163163_10159315
533 Ga0157380_10017876
534 Ga0157380_10242800
535 Ga0157379_10034546
536 Ga0157379_10059879
537 Ga0157379_10150091
538 Ga0157379_10349159
539 Ga0163161_10132959
540 Ga0163161_10274432
541 Ga0163161_10309032
542 Ga0207672_1000038
543 Ga0207653_10000121
544 Ga0207653_10000561
545 Ga0207653_10122873
546 Ga0207710_10000002
547 Ga0207710_10273736
548 Ga0207680_10016591
549 Ga0207685_10208712
550 Ga0207643_10031029
551 Ga0207684_10000314
552 Ga0207684_10005620
553 Ga0207684_10323996
554 Ga0207707_10804969
555 Ga0207695_10023796
556 Ga0207671_10006486
557 Ga0207681_10002990
558 Ga0207681_10059782
559 Ga0207650_10375385
560 Ga0207659_10058552
561 Ga0207659_10300423
562 Ga0207644_10004938
563 Ga0207644_10016007
564 Ga0207644_10544953
565 Ga0207644_10868937
566 Ga0207644_11061594
567 Ga0207690_10151607
568 Ga0207686_10000023
569 Ga0207686_10039759
570 Ga0207686_10295379
571 Ga0207709_10000062
572 Ga0207709_10074247
573 Ga0207709_10134442
574 Ga0207670_10184075
575 Ga0207670_10228560
576 Ga0207704_10079762
577 Ga0207665_10153390
578 Ga0207711_10017430
579 Ga0207711_10020539
580 Ga0207711_10124956
581 Ga0207711_10260994
582 Ga0207711_10292983
583 Ga0207689_10068886
584 Ga0207661_10643500
585 Ga0207679_10253941
586 Ga0207712_10000925
587 Ga0207712_10019104
588 Ga0207712_10099270
589 Ga0207640_10776105
590 Ga0207677_10187574
591 Ga0207703_10000097
592 Ga0207703_10008345
593 Ga0207703_10046326
594 Ga0207708_10000246
595 Ga0207708_10035406
596 Ga0207708_10039173
597 Ga0207708_10232793
598 Ga0207641_10091321
599 Ga0207641_11321295
600 Ga0207641_11348920
601 Ga0207676_10237074
602 Ga0207674_10014664
603 Ga0207674_10741569
604 Ga0207675_100063289
605 Ga0207675_101063227
606 Ga0207683_10433612
607 Ga0207428_10023686
608 Ga0207428_10436337
609 Ga0268265_10098086
610 Ga0268265_10472446
611 Ga0268264_10124145
612 Ga0268264_10219540
613 Ga0307408_100009490
614 Ga0307408_100038123
615 Ga0307405_10004850
616 Ga0307405_10142911
617 Ga0307405_10384661
618 Ga0307413_10002210
619 Ga0307413_10029079
620 Ga0307413_10393751
621 Ga0307413_10439319
622 Ga0307413_10451169
623 Ga0307410_10007654
624 Ga0307410_10097828
625 Ga0307410_10140481
626 Ga0307410_10355342
627 Ga0307406_10002198
628 Ga0307406_10094229
629 Ga0307407_10000561
630 Ga0307407_10011204
631 Ga0307412_10005400
632 Ga0307412_10012035
633 Ga0307412_10076788
634 Ga0307412_10218342
635 Ga0307409_100046338
636 Ga0307416_100016565
637 Ga0307416_100050907
638 Ga0307416_100053847
639 Ga0307416_100119289
640 Ga0307416_100408369
641 Ga0307416_101247243
642 Ga0307416_101943445
643 Ga0307414_10023060
644 Ga0307414_10380147
645 Ga0307411_10001147
646 Ga0307411_10353612
647 Ga0307415_100006399
648 Ga0307415_100035755
649 Ga0307415_100553769
650 Ga0373941_0058228
651 Ga0373937_0531906
652 Ga0395898_0303860
653 Ga0439458_0006021
654 Ga0495629_0306665
655 Ga0495663_0000174
656 Ga0495598_0000093
657 Ga0495621_0005211
658 Ga0495621_0024136
659 Ga0496104_0337519
660 Ga0496106_0021082
661 Ga0496109_0311564
662 Ga0496111_0325712
663 Ga0496112_0183058
664 Ga0496112_0228258
665 Ga0501298_000491
666 Ga0501298_001877
667 Ga0501299_006869
668 Ga0501038_0002453
669 Ga0501072_0012162
670 Ga0501199_004640
671 Ga0501201_001504
672 Ga0501202_002595
673 Ga0501209_025784
674 Ga0501209_177101
675 Ga0501216_050037
676 Ga0501217_000356
677 Ga0501217_110357
678 Ga0501223_004047
679 Ga0501227_002390
680 Ga0501233_003011
681 Ga0501235_014817
682 Ga0501235_104268
683 Ga0501246_001632
684 Ga0501247_021633
685 Ga0501247_025631
686 Ga0501249_013435
687 Ga0501249_028134
688 Ga0501249_069254
689 Ga0501251_011780
690 Ga0501259_006956
691 Ga0501225_0000634
692 Ga0501225_0004012
693 Ga0501234_001383
694 Ga0501245_037426
695 Ga0501268_037111
696 Ga0501283_002239
697 Ga0501212_051782
698 Ga0501226_014132
699 nmdc:mga05p37_656012_c1
700 nmdc:mga05p37_761926_c1
701 nmdc:mga09592_77406_c1
702 nmdc:mga08y16_507670_c1
703 nmdc:mga08y16_625119_c1
704 nmdc:mga08y16_62667_c1
705 nmdc:mga0n895_456069_c1
706 nmdc:mga0rr50_28622_c1
707 nmdc:mga08x19_21408_c1
708 nmdc:mga0a205_137785_c1
709 nmdc:mga0a205_20093_c1
710 nmdc:mga0a205_60078_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

50

192

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f76-assembly1.cif.gz_A crystal structure of fmn-dependent nadph-quinone reductase (azor) from bacillus cohnii 0.8665 4 179
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8665 7 177
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8659 6 174
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8644 7 176
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.8613 1 175
ID Description Score Start End Superfamily
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8522 8 176 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8479 4 172 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8381 8 176 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8372 2 175 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8304 4 188 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2V8RWH7-F1-model_v4 NADPH-dependent FMN reductase 0.9733 1 190 GO:0005829
GO:0010181
GO:0016491
AF-A0A2D6L7Z6-F1-model_v4 NADPH-dependent FMN reductase 0.9692 2 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A2H0UNR9-F1-model_v4 NADPH-dependent FMN reductase 0.9596 1 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A534QA18-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9565 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A538NKH2-F1-model_v4 NADPH-dependent FMN reductase 0.9563 77 187 GO:0005829
GO:0010181
GO:0016491

Map