F420048

General Info

Members Datasets Scaffolds Average Seq Length
355 178 710 204

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100219171|Ga0070697_1002191712
Length 228
Sequence MDGRGADRRMSAPAVKEDAMAATTRSHSNARNGSTDGSSRRAKRPSPQPRLGQRGPELQPFGKLRLLPIALASTARSESCRLLNEVLADTTILYALYKKAHWNVAGPTFYQLHLLFDKHAAEQLELVDAIAERVQMLGGISVGDPRHAAELTTIPRPPDGSEELSVTIDRLLDAHEIILEKVREAIDKTEKSGDSGTNDLLMSDVLRRHEMQVWFLAEHVVRVPLVEA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.96
Metatranscriptomes 7.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.2
Rhizosphere 93.24
Stem 0
Stem Tuber 0
Unclassified 27.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100219171 3300005536 Bacteria 1621
2 rootL2_10244308 3300003322 Bacteria 2090
3 Ga0058861_10022824 3300004800 Unclassified 903
4 Ga0058862_10046026 3300004803 Bacteria 797
5 Ga0070683_100108310 3300005329 Bacteria 2620
6 Ga0070683_100826049 3300005329 Unclassified 889
7 Ga0070690_100233047 3300005330 Bacteria 1295
8 Ga0068869_100043505 3300005334 Plasmid 3226
9 Ga0070666_10061259 3300005335 Bacteria 2548
10 Ga0070680_100054371 3300005336 Unclassified 3269
11 Ga0070680_100107381 3300005336 Bacteria 2322
12 Ga0070680_100393788 3300005336 Unclassified 1180
13 Ga0068868_100032763 3300005338 Unclassified 3999
14 Ga0068868_100523130 3300005338 Bacteria 1042
15 Ga0070689_100233697 3300005340 Unclassified 1512
16 Ga0070674_100564582 3300005356 Bacteria 957
17 Ga0070709_10000170 3300005434 Bacteria 41030
18 Ga0070714_100041001 3300005435 Bacteria 3905
19 Ga0070714_100108438 3300005435 Bacteria 2455
20 Ga0070714_100210392 3300005435 Bacteria 1782
21 Ga0070714_100671391 3300005435 Bacteria 998
22 Ga0070713_100042259 3300005436 Bacteria 3719
23 Ga0070713_100160718 3300005436 Unclassified 2005
24 Ga0070713_100461081 3300005436 Bacteria 1195
25 Ga0070710_10134642 3300005437 Bacteria 1510
26 Ga0070710_10173484 3300005437 Unclassified 1345
27 Ga0070710_10232352 3300005437 Unclassified 1178
28 Ga0070711_100000379 3300005439 Bacteria 22906
29 Ga0070711_100252035 3300005439 Bacteria 1385
30 Ga0070711_100304847 3300005439 Unclassified 1268
31 Ga0070711_100630799 3300005439 Bacteria 897
32 Ga0070705_100074366 3300005440 Unclassified 2065
33 Ga0070694_100615658 3300005444 Bacteria 876
34 Ga0070708_100000392 3300005445 Bacteria 33124
35 Ga0070708_100002645 3300005445 Bacteria 13870
36 Ga0070708_100007829 3300005445 Bacteria 8561
37 Ga0070708_100015609 3300005445 Bacteria 6277
38 Ga0070708_100022929 3300005445 Bacteria 5302
39 Ga0070708_100144345 3300005445 Bacteria 2210
40 Ga0070708_100150315 3300005445 Unclassified 2165
41 Ga0070708_100208299 3300005445 Bacteria 1832
42 Ga0070708_100364695 3300005445 Unclassified 1361
43 Ga0070663_100053607 3300005455 Bacteria 2880
44 Ga0070681_10013466 3300005458 Bacteria 8127
45 Ga0070681_10016184 3300005458 Bacteria 7436
46 Ga0070681_10161294 3300005458 Bacteria 2166
47 Ga0070706_100001692 3300005467 Bacteria 22966
48 Ga0070706_100043765 3300005467 Unclassified 4136
49 Ga0070706_100062827 3300005467 Bacteria 3431
50 Ga0070706_100177667 3300005467 Bacteria 1987
51 Ga0070707_100004546 3300005468 Bacteria 12991
52 Ga0070707_100019655 3300005468 Bacteria 6366
53 Ga0070707_100110736 3300005468 Bacteria 2663
54 Ga0070707_100114364 3300005468 Unclassified 2618
55 Ga0070707_100168286 3300005468 Bacteria 2136
56 Ga0070707_100310958 3300005468 Unclassified 1531
57 Ga0070707_100829246 3300005468 Unclassified 889
58 Ga0070698_100000870 3300005471 Bacteria 33169
59 Ga0070698_100000922 3300005471 Bacteria 32132
60 Ga0070698_100065010 3300005471 Bacteria 3674
61 Ga0070698_100188007 3300005471 Bacteria 2003
62 Ga0070698_100326441 3300005471 Unclassified 1465
63 Ga0070698_100764441 3300005471 Unclassified 909
64 Ga0070699_100000502 3300005518 Bacteria 37239
65 Ga0070699_100022922 3300005518 Bacteria 5379
66 Ga0070699_100030280 3300005518 Bacteria 4671
67 Ga0070699_100236708 3300005518 Archaea 1629
68 Ga0070699_100540061 3300005518 Bacteria 1061
69 Ga0070679_100001509 3300005530 Bacteria 20695
70 Ga0070679_100067350 3300005530 Bacteria 3570
71 Ga0070679_100268798 3300005530 Unclassified 1659
72 Ga0070679_100270884 3300005530 Bacteria 1652
73 Ga0070684_100026304 3300005535 Bacteria 4901
74 Ga0070697_100002721 3300005536 Bacteria 13623
75 Ga0070697_100026347 3300005536 Bacteria 4644
76 Ga0070697_100035699 3300005536 Bacteria 4012
77 Ga0070697_100039377 3300005536 Bacteria 3821
78 Ga0070697_100057834 3300005536 Unclassified 3155
79 Ga0070697_100102969 3300005536 Unclassified 2372
80 Ga0070697_100115864 3300005536 Bacteria 2238
81 Ga0070697_100460330 3300005536 Bacteria 1109
82 Ga0068853_100403919 3300005539 Unclassified 1279
83 Ga0070686_100183114 3300005544 Bacteria 1490
84 Ga0070695_100008728 3300005545 Bacteria 6023
85 Ga0070695_100073187 3300005545 Bacteria 2248
86 Ga0070695_100412860 3300005545 Viruses 1026
87 Ga0070696_100005745 3300005546 Bacteria 8281
88 Ga0070696_100377160 3300005546 Unclassified 1104
89 Ga0070693_100168596 3300005547 Bacteria 1400
90 Ga0070665_100444232 3300005548 Bacteria 1306
91 Ga0070704_100350873 3300005549 Unclassified 1245
92 Ga0068855_100226683 3300005563 Unclassified 2094
93 Ga0068855_100301389 3300005563 Bacteria 1775
94 Ga0068855_100849498 3300005563 Bacteria 967
95 Ga0068855_100999887 3300005563 Bacteria 879
96 Ga0068855_101334375 3300005563 Bacteria 741
97 Ga0070664_100094932 3300005564 Bacteria 2586
98 Ga0068857_100378720 3300005577 Bacteria 1314
99 Ga0068854_100072023 3300005578 Unclassified 2530
100 Ga0068854_100384035 3300005578 Bacteria 1158
101 Ga0068856_100088361 3300005614 Bacteria 3081
102 Ga0068852_100045600 3300005616 Bacteria 3730
103 Ga0068859_100246006 3300005617 Bacteria 1878
104 Ga0068864_100224356 3300005618 Unclassified 1735
105 Ga0068864_100422671 3300005618 Bacteria 1270
106 Ga0068863_100561236 3300005841 Bacteria 1128
107 Ga0068863_100939439 3300005841 Unclassified 866
108 Ga0068858_100024222 3300005842 Bacteria 5656
109 Ga0068858_101289298 3300005842 Bacteria 719
110 Ga0081455_10130836 3300005937 Bacteria 1962
111 Ga0070717_10079724 3300006028 Bacteria 2746
112 Ga0070717_10166892 3300006028 Unclassified 1913
113 Ga0070717_10222699 3300006028 Bacteria 1659
114 Ga0070717_10344449 3300006028 Bacteria 1331
115 Ga0070717_10643214 3300006028 Unclassified 962
116 Ga0070717_10669047 3300006028 Bacteria 943
117 Ga0070717_10937027 3300006028 Unclassified 788
118 Ga0070715_10126519 3300006163 Bacteria 1225
119 Ga0070715_10177488 3300006163 Bacteria 1066
120 Ga0070716_100042067 3300006173 Bacteria 2549
121 Ga0070716_100221251 3300006173 Unclassified 1272
122 Ga0070712_100000355 3300006175 Bacteria 25961
123 Ga0070712_100102864 3300006175 Unclassified 2117
124 Ga0070712_100294763 3300006175 Bacteria 1311
125 Ga0070712_100505905 3300006175 Bacteria 1013
126 Ga0070712_100614806 3300006175 Unclassified 921
127 Ga0070712_100748417 3300006175 Bacteria 836
128 Ga0097621_100158451 3300006237 Bacteria 1944
129 Ga0097621_101217813 3300006237 Unclassified 709
130 Ga0068871_100020368 3300006358 Bacteria 5080
131 Ga0075428_100399268 3300006844 Unclassified 1474
132 Ga0075433_10206102 3300006852 Bacteria 1748
133 Ga0075433_10517777 3300006852 Unclassified 1049
134 Ga0075434_100040060 3300006871 Bacteria 4640
135 Ga0075434_100158196 3300006871 Bacteria 2285
136 Ga0075434_100354367 3300006871 Unclassified 1488
137 Ga0075436_100000370 3300006914 Bacteria 28728
138 Ga0075436_100043251 3300006914 Unclassified 3105
139 Ga0075436_100355866 3300006914 Bacteria 1055
140 Ga0075436_100387067 3300006914 Bacteria 1012
141 Ga0097620_100246015 3300006931 Bacteria 1878
142 Ga0075435_100471151 3300007076 Unclassified 1084
143 Ga0099794_10054275 3300007265 Bacteria 1934
144 Ga0099794_10092216 3300007265 Unclassified 1504
145 Ga0099795_10234803 3300007788 Bacteria 785
146 Ga0105240_10131865 3300009093 Bacteria 2997
147 Ga0105240_10278489 3300009093 Bacteria 1923
148 Ga0111539_10060445 3300009094 Bacteria 4491
149 Ga0105245_10000076 3300009098 Bacteria 102308
150 Ga0105245_10352832 3300009098 Bacteria 1458
151 Ga0105245_11034608 3300009098 Bacteria 866
152 Ga0114129_10125965 3300009147 Unclassified 3521
153 Ga0114129_10209326 3300009147 Bacteria 2637
154 Ga0114129_10488645 3300009147 Unclassified 1610
155 Ga0114129_10489475 3300009147 Unclassified 1608
156 Ga0114129_11019242 3300009147 Bacteria 1041
157 Ga0105243_10034108 3300009148 Bacteria 3938
158 Ga0105241_10000492 3300009174 Bacteria 29822
159 Ga0105241_10206940 3300009174 Bacteria 1642
160 Ga0105241_10660996 3300009174 Unclassified 950
161 Ga0105241_10672495 3300009174 Unclassified 942
162 Ga0105248_10025691 3300009177 Bacteria 6550
163 Ga0105248_10514077 3300009177 Bacteria 1350
164 Ga0105248_10653067 3300009177 Bacteria 1187
165 Ga0105237_10119179 3300009545 Bacteria 2633
166 Ga0105237_10608737 3300009545 Unclassified 1099
167 Ga0105238_10100474 3300009551 Bacteria 2876
168 Ga0105249_10050500 3300009553 Unclassified 3791
169 Ga0105239_10344593 3300010375 Bacteria 1682
170 Ga0157373_10028437 3300013100 Bacteria 4033
171 Ga0157373_10059875 3300013100 Bacteria 2698
172 Ga0157370_10042182 3300013104 Bacteria 4398
173 Ga0157369_10001530 3300013105 Bacteria 28340
174 Ga0157369_10058324 3300013105 Bacteria 4164
175 Ga0157369_10832271 3300013105 Bacteria 948
176 Ga0157369_10994654 3300013105 Bacteria 859
177 Ga0157374_10017700 3300013296 Bacteria 6280
178 Ga0157374_10104048 3300013296 Bacteria 2725
179 Ga0157378_10019433 3300013297 Bacteria 5973
180 Ga0163162_10026012 3300013306 Bacteria 5783
181 Ga0157372_10034335 3300013307 Bacteria 5575
182 Ga0157372_10600440 3300013307 Bacteria 1283
183 Ga0157372_11285164 3300013307 Bacteria 844
184 Ga0157379_10231897 3300014968 Bacteria 1673
185 Ga0197907_10020291 3300020069 Bacteria 731
186 Ga0197907_10316134 3300020069 Bacteria 3612
187 Ga0206356_10149905 3300020070 Bacteria 3415
188 Ga0206349_1523792 3300020075 Bacteria 689
189 Ga0206351_10888997 3300020077 Bacteria 692
190 Ga0206350_11252976 3300020080 Bacteria 1203
191 Ga0206353_10300102 3300020082 Bacteria 1325
192 Ga0206353_10926881 3300020082 Unclassified 782
193 Ga0224712_10038630 3300022467 Unclassified 1784
194 Ga0224712_10214377 3300022467 Unclassified 879
195 Ga0224712_10311221 3300022467 Unclassified 738
196 Ga0224712_10349910 3300022467 Unclassified 698
197 Ga0228598_1000036 3300024227 Bacteria 18755
198 Ga0207653_10046777 3300025885 Bacteria 1431
199 Ga0207692_10312512 3300025898 Unclassified 959
200 Ga0207685_10170153 3300025905 Unclassified 1002
201 Ga0207699_10000023 3300025906 Bacteria 172262
202 Ga0207699_10055757 3300025906 Bacteria 2353
203 Ga0207699_10140957 3300025906 Bacteria 1584
204 Ga0207699_10164262 3300025906 Bacteria 1480
205 Ga0207699_10319138 3300025906 Unclassified 1089
206 Ga0207705_10439955 3300025909 Unclassified 1010
207 Ga0207684_10000375 3300025910 Bacteria 60578
208 Ga0207684_10017589 3300025910 Bacteria 6131
209 Ga0207684_10026878 3300025910 Bacteria 4907
210 Ga0207684_10029631 3300025910 Unclassified 4659
211 Ga0207684_10086392 3300025910 Bacteria 2672
212 Ga0207654_10131313 3300025911 Bacteria 1586
213 Ga0207707_10002698 3300025912 Bacteria 15859
214 Ga0207707_10002759 3300025912 Bacteria 15660
215 Ga0207707_10075025 3300025912 Bacteria 2950
216 Ga0207707_10111558 3300025912 Bacteria 2391
217 Ga0207695_10319992 3300025913 Unclassified 1441
218 Ga0207671_10046376 3300025914 Bacteria 3215
219 Ga0207671_10705950 3300025914 Bacteria 802
220 Ga0207693_10000478 3300025915 Bacteria 36490
221 Ga0207693_10091221 3300025915 Unclassified 2389
222 Ga0207693_10178774 3300025915 Unclassified 1669
223 Ga0207663_10073492 3300025916 Bacteria 2213
224 Ga0207663_10239708 3300025916 Unclassified 1329
225 Ga0207663_10302469 3300025916 Bacteria 1196
226 Ga0207660_10000557 3300025917 Bacteria 25041
227 Ga0207660_10057207 3300025917 Bacteria 2793
228 Ga0207660_10172558 3300025917 Bacteria 1675
229 Ga0207652_10002297 3300025921 Bacteria 16205
230 Ga0207652_10035693 3300025921 Bacteria 4198
231 Ga0207652_10074351 3300025921 Bacteria 2959
232 Ga0207652_10228043 3300025921 Bacteria 1679
233 Ga0207652_10485010 3300025921 Bacteria 1113
234 Ga0207646_10000657 3300025922 Bacteria 44736
235 Ga0207646_10001061 3300025922 Bacteria 34965
236 Ga0207646_10048899 3300025922 Bacteria 3789
237 Ga0207646_10071842 3300025922 Bacteria 3091
238 Ga0207646_10081255 3300025922 Bacteria 2898
239 Ga0207646_10157135 3300025922 Bacteria 2051
240 Ga0207646_10499360 3300025922 Bacteria 1096
241 Ga0207694_10213722 3300025924 Bacteria 1571
242 Ga0207687_10000104 3300025927 Bacteria 61420
243 Ga0207700_10096338 3300025928 Bacteria 2349
244 Ga0207700_10207591 3300025928 Bacteria 1654
245 Ga0207664_10293878 3300025929 Viruses 1428
246 Ga0207664_10588278 3300025929 Bacteria 999
247 Ga0207664_10738456 3300025929 Unclassified 885
248 Ga0207664_10778916 3300025929 Bacteria 860
249 Ga0207709_10280362 3300025935 Unclassified 1231
250 Ga0207709_10613823 3300025935 Unclassified 862
251 Ga0207665_10073929 3300025939 Bacteria 2332
252 Ga0207665_10126631 3300025939 Bacteria 1809
253 Ga0207665_10204103 3300025939 Unclassified 1441
254 Ga0207665_10418447 3300025939 Unclassified 1023
255 Ga0207665_10703721 3300025939 Unclassified 794
256 Ga0207711_10106880 3300025941 Bacteria 2484
257 Ga0207711_11190660 3300025941 Bacteria 703
258 Ga0207661_10021403 3300025944 Unclassified 4844
259 Ga0207661_10055030 3300025944 Bacteria 3190
260 Ga0207679_10557908 3300025945 Bacteria 1028
261 Ga0207667_10102798 3300025949 Bacteria 2947
262 Ga0207667_10156312 3300025949 Bacteria 2346
263 Ga0207667_10584057 3300025949 Bacteria 1128
264 Ga0207667_11002709 3300025949 Unclassified 822
265 Ga0207712_10102994 3300025961 Unclassified 2126
266 Ga0207640_10578772 3300025981 Bacteria 947
267 Ga0207677_10188997 3300026023 Bacteria 1627
268 Ga0207703_10022188 3300026035 Bacteria 4977
269 Ga0207639_10477203 3300026041 Unclassified 1136
270 Ga0207678_10111215 3300026067 Bacteria 2337
271 Ga0207702_10089093 3300026078 Bacteria 2697
272 Ga0207702_11067535 3300026078 Bacteria 801
273 Ga0207674_10061193 3300026116 Bacteria 3805
274 Ga0268264_10018173 3300028381 Bacteria 5750
275 Ga0268264_10613436 3300028381 Bacteria 1073
276 Ga0265326_10020142 3300028558 Bacteria 1913
277 Ga0265319_1011685 3300028563 Bacteria 3578
278 Ga0265338_10006903 3300028800 Bacteria 14283
279 Ga0265324_10072089 3300029957 Bacteria 1177
280 Ga0265770_1004033 3300030878 Bacteria 1998
281 Ga0265332_10072085 3300031238 Bacteria 1471
282 Ga0265325_10120563 3300031241 Bacteria 1265
283 Ga0265339_10008502 3300031249 Bacteria 6530
284 Ga0265339_10085368 3300031249 Bacteria 1662
285 Ga0265339_10168731 3300031249 Unclassified 1097
286 Ga0265316_10308609 3300031344 Bacteria 1151
287 Ga0265314_10072094 3300031711 Bacteria 2309
288 Ga0307412_10299796 3300031911 Unclassified 1270
289 Ga0307416_100367304 3300032002 Bacteria 1464
290 Ga0373946_0048893 3300035171 Bacteria 1762
291 Ga0373931_0101206 3300035691 Bacteria 1621
292 Ga0373935_0296537 3300035692 Unclassified 1142
293 Ga0373927_0446720 3300035695 Bacteria 854
294 Ga0373925_0130618 3300037068 Bacteria 1958
295 Ga0436365_0976914 3300039437 Bacteria 772
296 Ga0436362_0315644 3300039453 Bacteria 834
297 Ga0436362_0405638 3300039453 Bacteria 964
298 Ga0466963_0000891 3300044694 Bacteria 15209
299 Ga0453684_0999351 3300044712 Bacteria 890
300 Ga0466967_0150962 3300045976 Unclassified 2171
301 Ga0466967_0414433 3300045976 Bacteria 1312
302 Ga0495629_0366621 3300046459 Bacteria 981
303 Ga0495584_0102668 3300046491 Unclassified 1446
304 Ga0495630_0183506 3300046517 Bacteria 1596
305 Ga0495649_0297182 3300046694 Unclassified 823
306 Ga0495674_0427706 3300047319 Bacteria 1066
307 Ga0496102_0108620 3300048905 Bacteria 2584
308 Ga0496102_0234390 3300048905 Bacteria 1730
309 Ga0496102_0388093 3300048905 Bacteria 1314
310 Ga0496103_0019437 3300048906 Bacteria 4080
311 Ga0496104_0077844 3300048907 Bacteria 3160
312 Ga0496105_0047730 3300048908 Unclassified 3534
313 Ga0496106_0105483 3300048909 Bacteria 2190
314 Ga0496106_0142820 3300048909 Bacteria 1884
315 Ga0496107_0079030 3300048910 Bacteria 2398
316 Ga0496107_0319273 3300048910 Unclassified 1156
317 Ga0496108_0242377 3300048911 Bacteria 1568
318 Ga0496108_0607452 3300048911 Bacteria 953
319 Ga0496109_0163470 3300048912 Bacteria 2086
320 Ga0496109_0438691 3300048912 Bacteria 1234
321 Ga0496110_0504701 3300048913 Unclassified 1101
322 Ga0496112_0040594 3300048915 Unclassified 4550
323 Ga0496112_0091067 3300048915 Bacteria 3018
324 Ga0496112_0138079 3300048915 Bacteria 2407
325 Ga0496112_0403832 3300048915 Bacteria 1306
326 Ga0496112_1005732 3300048915 Bacteria 753
327 Ga0496113_0406861 3300048916 Bacteria 1093
328 Ga0496113_0477225 3300048916 Unclassified 1002
329 Ga0501039_0232068 3300049575 Bacteria 1451
330 Ga0501067_0160963 3300049583 Unclassified 1250
331 Ga0501069_0051063 3300049585 Unclassified 2301
332 Ga0501069_0317384 3300049585 Unclassified 915
333 Ga0501045_0683376 3300049824 Unclassified 758
334 nmdc:mga05p37_154802_c1 3300050507 Bacteria 2802
335 nmdc:mga05p37_438980_c1 3300050507 Unclassified 1514
336 nmdc:mga05p37_853578_c1 3300050507 Unclassified 988
337 nmdc:mga05p37_878177_c1 3300050507 Unclassified 970
338 nmdc:mga08y16_595329_c1 3300050511 Unclassified 1115
339 nmdc:mga0rr50_456093_c1 3300050513 Bacteria 1084
340 nmdc:mga08x19_195419_c1 3300050514 Bacteria 1385
341 nmdc:mga08x19_301077_c1 3300050514 Bacteria 1114
342 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
343 nmdc:mga0a205_265669_c1 3300050515 Bacteria 1593
344 nmdc:mga0a205_275039_c1 3300050515 Bacteria 1560
345 nmdc:mga0a205_39708_c1 3300050515 Bacteria 4529
346 Ga0587073_0051613 3300059492 Bacteria 934
347 Ga0587077_040034 3300059493 Unclassified 937
348 Ga0587083_0071373 3300059505 Bacteria 807
349 Ga0587088_052403 3300059508 Bacteria 803
350 Ga0587099_016126 3300059622 Bacteria 804
351 Ga0587067_058356 3300059640 Bacteria 802
352 Ga0587069_028774 3300059642 Unclassified 885
353 Ga0587076_055292 3300059645 Unclassified 785
354 Ga0587079_026182 3300059647 Unclassified 1089
355 Ga0587114_033108 3300059655 Bacteria 801
356 Ga0070697_100219171
357 rootL2_10244308
358 Ga0058861_10022824
359 Ga0058862_10046026
360 Ga0070683_100108310
361 Ga0070683_100826049
362 Ga0070690_100233047
363 Ga0068869_100043505
364 Ga0070666_10061259
365 Ga0070680_100054371
366 Ga0070680_100107381
367 Ga0070680_100393788
368 Ga0068868_100032763
369 Ga0068868_100523130
370 Ga0070689_100233697
371 Ga0070674_100564582
372 Ga0070709_10000170
373 Ga0070714_100041001
374 Ga0070714_100108438
375 Ga0070714_100210392
376 Ga0070714_100671391
377 Ga0070713_100042259
378 Ga0070713_100160718
379 Ga0070713_100461081
380 Ga0070710_10134642
381 Ga0070710_10173484
382 Ga0070710_10232352
383 Ga0070711_100000379
384 Ga0070711_100252035
385 Ga0070711_100304847
386 Ga0070711_100630799
387 Ga0070705_100074366
388 Ga0070694_100615658
389 Ga0070708_100000392
390 Ga0070708_100002645
391 Ga0070708_100007829
392 Ga0070708_100015609
393 Ga0070708_100022929
394 Ga0070708_100144345
395 Ga0070708_100150315
396 Ga0070708_100208299
397 Ga0070708_100364695
398 Ga0070663_100053607
399 Ga0070681_10013466
400 Ga0070681_10016184
401 Ga0070681_10161294
402 Ga0070706_100001692
403 Ga0070706_100043765
404 Ga0070706_100062827
405 Ga0070706_100177667
406 Ga0070707_100004546
407 Ga0070707_100019655
408 Ga0070707_100110736
409 Ga0070707_100114364
410 Ga0070707_100168286
411 Ga0070707_100310958
412 Ga0070707_100829246
413 Ga0070698_100000870
414 Ga0070698_100000922
415 Ga0070698_100065010
416 Ga0070698_100188007
417 Ga0070698_100326441
418 Ga0070698_100764441
419 Ga0070699_100000502
420 Ga0070699_100022922
421 Ga0070699_100030280
422 Ga0070699_100236708
423 Ga0070699_100540061
424 Ga0070679_100001509
425 Ga0070679_100067350
426 Ga0070679_100268798
427 Ga0070679_100270884
428 Ga0070684_100026304
429 Ga0070697_100002721
430 Ga0070697_100026347
431 Ga0070697_100035699
432 Ga0070697_100039377
433 Ga0070697_100057834
434 Ga0070697_100102969
435 Ga0070697_100115864
436 Ga0070697_100460330
437 Ga0068853_100403919
438 Ga0070686_100183114
439 Ga0070695_100008728
440 Ga0070695_100073187
441 Ga0070695_100412860
442 Ga0070696_100005745
443 Ga0070696_100377160
444 Ga0070693_100168596
445 Ga0070665_100444232
446 Ga0070704_100350873
447 Ga0068855_100226683
448 Ga0068855_100301389
449 Ga0068855_100849498
450 Ga0068855_100999887
451 Ga0068855_101334375
452 Ga0070664_100094932
453 Ga0068857_100378720
454 Ga0068854_100072023
455 Ga0068854_100384035
456 Ga0068856_100088361
457 Ga0068852_100045600
458 Ga0068859_100246006
459 Ga0068864_100224356
460 Ga0068864_100422671
461 Ga0068863_100561236
462 Ga0068863_100939439
463 Ga0068858_100024222
464 Ga0068858_101289298
465 Ga0081455_10130836
466 Ga0070717_10079724
467 Ga0070717_10166892
468 Ga0070717_10222699
469 Ga0070717_10344449
470 Ga0070717_10643214
471 Ga0070717_10669047
472 Ga0070717_10937027
473 Ga0070715_10126519
474 Ga0070715_10177488
475 Ga0070716_100042067
476 Ga0070716_100221251
477 Ga0070712_100000355
478 Ga0070712_100102864
479 Ga0070712_100294763
480 Ga0070712_100505905
481 Ga0070712_100614806
482 Ga0070712_100748417
483 Ga0097621_100158451
484 Ga0097621_101217813
485 Ga0068871_100020368
486 Ga0075428_100399268
487 Ga0075433_10206102
488 Ga0075433_10517777
489 Ga0075434_100040060
490 Ga0075434_100158196
491 Ga0075434_100354367
492 Ga0075436_100000370
493 Ga0075436_100043251
494 Ga0075436_100355866
495 Ga0075436_100387067
496 Ga0097620_100246015
497 Ga0075435_100471151
498 Ga0099794_10054275
499 Ga0099794_10092216
500 Ga0099795_10234803
501 Ga0105240_10131865
502 Ga0105240_10278489
503 Ga0111539_10060445
504 Ga0105245_10000076
505 Ga0105245_10352832
506 Ga0105245_11034608
507 Ga0114129_10125965
508 Ga0114129_10209326
509 Ga0114129_10488645
510 Ga0114129_10489475
511 Ga0114129_11019242
512 Ga0105243_10034108
513 Ga0105241_10000492
514 Ga0105241_10206940
515 Ga0105241_10660996
516 Ga0105241_10672495
517 Ga0105248_10025691
518 Ga0105248_10514077
519 Ga0105248_10653067
520 Ga0105237_10119179
521 Ga0105237_10608737
522 Ga0105238_10100474
523 Ga0105249_10050500
524 Ga0105239_10344593
525 Ga0157373_10028437
526 Ga0157373_10059875
527 Ga0157370_10042182
528 Ga0157369_10001530
529 Ga0157369_10058324
530 Ga0157369_10832271
531 Ga0157369_10994654
532 Ga0157374_10017700
533 Ga0157374_10104048
534 Ga0157378_10019433
535 Ga0163162_10026012
536 Ga0157372_10034335
537 Ga0157372_10600440
538 Ga0157372_11285164
539 Ga0157379_10231897
540 Ga0197907_10020291
541 Ga0197907_10316134
542 Ga0206356_10149905
543 Ga0206349_1523792
544 Ga0206351_10888997
545 Ga0206350_11252976
546 Ga0206353_10300102
547 Ga0206353_10926881
548 Ga0224712_10038630
549 Ga0224712_10214377
550 Ga0224712_10311221
551 Ga0224712_10349910
552 Ga0228598_1000036
553 Ga0207653_10046777
554 Ga0207692_10312512
555 Ga0207685_10170153
556 Ga0207699_10000023
557 Ga0207699_10055757
558 Ga0207699_10140957
559 Ga0207699_10164262
560 Ga0207699_10319138
561 Ga0207705_10439955
562 Ga0207684_10000375
563 Ga0207684_10017589
564 Ga0207684_10026878
565 Ga0207684_10029631
566 Ga0207684_10086392
567 Ga0207654_10131313
568 Ga0207707_10002698
569 Ga0207707_10002759
570 Ga0207707_10075025
571 Ga0207707_10111558
572 Ga0207695_10319992
573 Ga0207671_10046376
574 Ga0207671_10705950
575 Ga0207693_10000478
576 Ga0207693_10091221
577 Ga0207693_10178774
578 Ga0207663_10073492
579 Ga0207663_10239708
580 Ga0207663_10302469
581 Ga0207660_10000557
582 Ga0207660_10057207
583 Ga0207660_10172558
584 Ga0207652_10002297
585 Ga0207652_10035693
586 Ga0207652_10074351
587 Ga0207652_10228043
588 Ga0207652_10485010
589 Ga0207646_10000657
590 Ga0207646_10001061
591 Ga0207646_10048899
592 Ga0207646_10071842
593 Ga0207646_10081255
594 Ga0207646_10157135
595 Ga0207646_10499360
596 Ga0207694_10213722
597 Ga0207687_10000104
598 Ga0207700_10096338
599 Ga0207700_10207591
600 Ga0207664_10293878
601 Ga0207664_10588278
602 Ga0207664_10738456
603 Ga0207664_10778916
604 Ga0207709_10280362
605 Ga0207709_10613823
606 Ga0207665_10073929
607 Ga0207665_10126631
608 Ga0207665_10204103
609 Ga0207665_10418447
610 Ga0207665_10703721
611 Ga0207711_10106880
612 Ga0207711_11190660
613 Ga0207661_10021403
614 Ga0207661_10055030
615 Ga0207679_10557908
616 Ga0207667_10102798
617 Ga0207667_10156312
618 Ga0207667_10584057
619 Ga0207667_11002709
620 Ga0207712_10102994
621 Ga0207640_10578772
622 Ga0207677_10188997
623 Ga0207703_10022188
624 Ga0207639_10477203
625 Ga0207678_10111215
626 Ga0207702_10089093
627 Ga0207702_11067535
628 Ga0207674_10061193
629 Ga0268264_10018173
630 Ga0268264_10613436
631 Ga0265326_10020142
632 Ga0265319_1011685
633 Ga0265338_10006903
634 Ga0265324_10072089
635 Ga0265770_1004033
636 Ga0265332_10072085
637 Ga0265325_10120563
638 Ga0265339_10008502
639 Ga0265339_10085368
640 Ga0265339_10168731
641 Ga0265316_10308609
642 Ga0265314_10072094
643 Ga0307412_10299796
644 Ga0307416_100367304
645 Ga0373946_0048893
646 Ga0373931_0101206
647 Ga0373935_0296537
648 Ga0373927_0446720
649 Ga0373925_0130618
650 Ga0436365_0976914
651 Ga0436362_0315644
652 Ga0436362_0405638
653 Ga0466963_0000891
654 Ga0453684_0999351
655 Ga0466967_0150962
656 Ga0466967_0414433
657 Ga0495629_0366621
658 Ga0495584_0102668
659 Ga0495630_0183506
660 Ga0495649_0297182
661 Ga0495674_0427706
662 Ga0496102_0108620
663 Ga0496102_0234390
664 Ga0496102_0388093
665 Ga0496103_0019437
666 Ga0496104_0077844
667 Ga0496105_0047730
668 Ga0496106_0105483
669 Ga0496106_0142820
670 Ga0496107_0079030
671 Ga0496107_0319273
672 Ga0496108_0242377
673 Ga0496108_0607452
674 Ga0496109_0163470
675 Ga0496109_0438691
676 Ga0496110_0504701
677 Ga0496112_0040594
678 Ga0496112_0091067
679 Ga0496112_0138079
680 Ga0496112_0403832
681 Ga0496112_1005732
682 Ga0496113_0406861
683 Ga0496113_0477225
684 Ga0501039_0232068
685 Ga0501067_0160963
686 Ga0501069_0051063
687 Ga0501069_0317384
688 Ga0501045_0683376
689 nmdc:mga05p37_154802_c1
690 nmdc:mga05p37_438980_c1
691 nmdc:mga05p37_853578_c1
692 nmdc:mga05p37_878177_c1
693 nmdc:mga08y16_595329_c1
694 nmdc:mga0rr50_456093_c1
695 nmdc:mga08x19_195419_c1
696 nmdc:mga08x19_301077_c1
697 nmdc:mga08x19_7_c1
698 nmdc:mga0a205_265669_c1
699 nmdc:mga0a205_275039_c1
700 nmdc:mga0a205_39708_c1
701 Ga0587073_0051613
702 Ga0587077_040034
703 Ga0587083_0071373
704 Ga0587088_052403
705 Ga0587099_016126
706 Ga0587067_058356
707 Ga0587069_028774
708 Ga0587076_055292
709 Ga0587079_026182
710 Ga0587114_033108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

80

226

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cyb-assembly1.cif.gz_J dpsc from streptomyces coelicolor 0.9878 21 194
4cyb-assembly1.cif.gz_J dpsc from streptomyces coelicolor 0.9821 21 194
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.9786 34 189
2vxx-assembly1.cif.gz_B x-ray structure of dpsa from thermosynechococcus elongatus 0.9646 19 193
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9599 32 187
ID Description Score Start End Superfamily
4cybA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9922 21 193 1.20.1260.10
4cybA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9865 21 193 1.20.1260.10
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9563 40 185 1.20.1260.10
1mojA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9519 19 193 1.20.1260.10
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9491 44 187 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2Z5G6T2-F1-model_v4 Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase 0.9921 12 195 GO:0003677
GO:0008199
GO:0016722
AF-A0A317HLT3-F1-model_v4 Ferritin/DPS protein domain-containing protein 0.992 12 137 GO:0008199
GO:0016722
AF-A0A537Z9P4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9904 35 194 GO:0008199
GO:0016722
AF-A0A522MVR6-F1-model_v4 DNA starvation/stationary phase protection protein 0.9892 23 194 GO:0008199
GO:0016722
AF-A0A0N0TM34-F1-model_v4 DNA polymerase 0.9869 16 194 GO:0008199
GO:0016722

Map