F420007

General Info

Members Datasets Scaffolds Average Seq Length
355 174 710 107

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100059654|Ga0070670_1000596546
Length 117
Sequence VLKPPNEPASETAENVRPVGELVHELIEDGKAYARAEIAVVKATAVSKVQAFKLPAILFGLAYVLTLAAITALAVGVAMGLATLIGPLGGGVVAFLLFGGIAGALVWVGINKLREGL

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
129 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.32
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 12.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100059654 3300005331 Bacteria 3275
2 JGI24735J21928_10209499 3300002067 Bacteria 566
3 Ga0065712_10258573 3300005290 Unclassified 942
4 Ga0065715_10821741 3300005293 Bacteria 602
5 Ga0070658_10027662 3300005327 Bacteria 4549
6 Ga0070658_10030823 3300005327 Bacteria 4308
7 Ga0070658_10783109 3300005327 Bacteria 828
8 Ga0070676_10249874 3300005328 Bacteria 1183
9 Ga0070683_100225387 3300005329 Bacteria 1781
10 Ga0070683_100889014 3300005329 Bacteria 854
11 Ga0070670_100012394 3300005331 Bacteria 7295
12 Ga0070670_100185465 3300005331 Bacteria 1806
13 Ga0070670_101978459 3300005331 Bacteria 537
14 Ga0070677_10228065 3300005333 Bacteria 913
15 Ga0070666_10016602 3300005335 Bacteria 4711
16 Ga0070666_10155528 3300005335 Bacteria 1597
17 Ga0068868_100831586 3300005338 Unclassified 835
18 Ga0070660_100121604 3300005339 Bacteria 2084
19 Ga0070660_100363959 3300005339 Unclassified 1192
20 Ga0070660_101342953 3300005339 Bacteria 607
21 Ga0070689_100599419 3300005340 Bacteria 954
22 Ga0070661_100034551 3300005344 Bacteria 3666
23 Ga0070661_100048713 3300005344 Bacteria 3102
24 Ga0070661_100276549 3300005344 Bacteria 1301
25 Ga0070692_10439629 3300005345 Bacteria 832
26 Ga0070675_100012092 3300005354 Bacteria 6767
27 Ga0070675_100785835 3300005354 Bacteria 870
28 Ga0070671_100009973 3300005355 Bacteria 7626
29 Ga0070671_100155869 3300005355 Bacteria 1929
30 Ga0070671_100305120 3300005355 Bacteria 1355
31 Ga0070674_100318361 3300005356 Bacteria 1246
32 Ga0070673_100033445 3300005364 Bacteria 3883
33 Ga0070673_100095950 3300005364 Bacteria 2433
34 Ga0070673_100154784 3300005364 Bacteria 1944
35 Ga0070673_100758537 3300005364 Unclassified 894
36 Ga0070659_100029341 3300005366 Bacteria 4251
37 Ga0070659_100058699 3300005366 Bacteria 3037
38 Ga0070659_100443163 3300005366 Unclassified 1101
39 Ga0070667_100004347 3300005367 Bacteria 11953
40 Ga0070667_100016231 3300005367 Bacteria 6161
41 Ga0070667_100495765 3300005367 Unclassified 1119
42 Ga0070667_101536324 3300005367 Unclassified 625
43 Ga0070709_10044918 3300005434 Bacteria 2738
44 Ga0070714_100027398 3300005435 Bacteria 4719
45 Ga0070714_100039876 3300005435 Bacteria 3956
46 Ga0070714_100106786 3300005435 Bacteria 2474
47 Ga0070713_100041674 3300005436 Bacteria 3742
48 Ga0070663_100013440 3300005455 Bacteria 5221
49 Ga0070663_100188101 3300005455 Bacteria 1606
50 Ga0070662_100039372 3300005457 Bacteria 3361
51 Ga0070662_100197565 3300005457 Bacteria 1594
52 Ga0070662_100391503 3300005457 Bacteria 1145
53 Ga0070679_100204618 3300005530 Bacteria 1938
54 Ga0070684_100004884 3300005535 Bacteria 10233
55 Ga0070672_100018813 3300005543 Bacteria 5002
56 Ga0070672_100075821 3300005543 Bacteria 2685
57 Ga0070693_100255419 3300005547 Unclassified 1163
58 Ga0070665_100092511 3300005548 Bacteria 3029
59 Ga0070665_101513999 3300005548 Bacteria 679
60 Ga0068855_100304628 3300005563 Bacteria 1764
61 Ga0068855_101392164 3300005563 Bacteria 723
62 Ga0070664_100011516 3300005564 Bacteria 7179
63 Ga0070664_100013829 3300005564 Bacteria 6578
64 Ga0070664_100058497 3300005564 Bacteria 3278
65 Ga0070664_100179436 3300005564 Bacteria 1881
66 Ga0070664_100222126 3300005564 Bacteria 1690
67 Ga0068857_100017137 3300005577 Bacteria 6346
68 Ga0068857_100148051 3300005577 Bacteria 2125
69 Ga0068854_101451765 3300005578 Unclassified 621
70 Ga0068856_100042249 3300005614 Bacteria 4484
71 Ga0068856_100462593 3300005614 Bacteria 1289
72 Ga0068852_101824115 3300005616 Bacteria 630
73 Ga0068859_100178033 3300005617 Bacteria 2209
74 Ga0068864_100018619 3300005618 Bacteria 5803
75 Ga0068864_100759633 3300005618 Bacteria 951
76 Ga0068851_10062822 3300005834 Bacteria 1906
77 Ga0068851_10255309 3300005834 Unclassified 995
78 Ga0068863_100142572 3300005841 Bacteria 2290
79 Ga0068863_101930902 3300005841 Bacteria 600
80 Ga0068858_100027743 3300005842 Bacteria 5261
81 Ga0068860_100229835 3300005843 Bacteria 1802
82 Ga0070717_10066455 3300006028 Bacteria 2999
83 Ga0070716_100045587 3300006173 Bacteria 2462
84 Ga0070712_100031743 3300006175 Bacteria 3561
85 Ga0097621_100028916 3300006237 Bacteria 4374
86 Ga0068871_100049132 3300006358 Bacteria 3408
87 Ga0068865_101423364 3300006881 Bacteria 619
88 Ga0097620_100178029 3300006931 Bacteria 2209
89 Ga0105250_10253797 3300009092 Unclassified 752
90 Ga0105240_10135394 3300009093 Bacteria 2951
91 Ga0105241_10539274 3300009174 Bacteria 1046
92 Ga0105248_10097797 3300009177 Bacteria 3307
93 Ga0105248_10722703 3300009177 Bacteria 1124
94 Ga0105248_12413275 3300009177 Bacteria 599
95 Ga0105248_12416538 3300009177 Unclassified 599
96 Ga0105237_10054672 3300009545 Bacteria 4000
97 Ga0105237_12220234 3300009545 Bacteria 558
98 Ga0105246_10083133 3300011119 Bacteria 2287
99 Ga0157373_10076402 3300013100 Bacteria 2363
100 Ga0157373_10088793 3300013100 Bacteria 2178
101 Ga0157371_10067181 3300013102 Bacteria 2538
102 Ga0157369_10697348 3300013105 Unclassified 1046
103 Ga0157374_10081885 3300013296 Bacteria 3064
104 Ga0157372_10191453 3300013307 Bacteria 2369
105 Ga0157372_10408213 3300013307 Bacteria 1583
106 Ga0157375_13118930 3300013308 Unclassified 553
107 Ga0163163_10075666 3300014325 Bacteria 3360
108 Ga0163163_10807057 3300014325 Bacteria 1002
109 Ga0182008_10069044 3300014497 Bacteria 1739
110 Ga0157379_10014771 3300014968 Bacteria 6849
111 Ga0163161_10179493 3300017792 Bacteria 1623
112 Ga0206353_10114185 3300020082 Bacteria 1044
113 Ga0207656_10065778 3300025321 Bacteria 1601
114 Ga0207656_10183469 3300025321 Bacteria 1005
115 Ga0207682_10046638 3300025893 Bacteria 1782
116 Ga0207680_10009738 3300025903 Bacteria 4781
117 Ga0207680_10131383 3300025903 Bacteria 1651
118 Ga0207647_10044526 3300025904 Bacteria 2772
119 Ga0207647_10079746 3300025904 Bacteria 1965
120 Ga0207645_10240228 3300025907 Bacteria 1197
121 Ga0207705_10026344 3300025909 Bacteria 4146
122 Ga0207705_10250578 3300025909 Bacteria 1350
123 Ga0207705_10934606 3300025909 Bacteria 671
124 Ga0207705_10953951 3300025909 Bacteria 663
125 Ga0207654_10117879 3300025911 Bacteria 1662
126 Ga0207707_11270983 3300025912 Bacteria 593
127 Ga0207695_10835557 3300025913 Bacteria 801
128 Ga0207671_10329692 3300025914 Unclassified 1209
129 Ga0207693_10016650 3300025915 Bacteria 5874
130 Ga0207657_10004423 3300025919 Bacteria 14873
131 Ga0207657_10028897 3300025919 Bacteria 5051
132 Ga0207657_10322115 3300025919 Unclassified 1222
133 Ga0207657_10699582 3300025919 Bacteria 787
134 Ga0207649_10094276 3300025920 Bacteria 1967
135 Ga0207649_10099526 3300025920 Bacteria 1921
136 Ga0207649_10322030 3300025920 Bacteria 1136
137 Ga0207652_10307991 3300025921 Bacteria 1429
138 Ga0207681_10990809 3300025923 Bacteria 705
139 Ga0207650_10035099 3300025925 Bacteria 3639
140 Ga0207650_10162950 3300025925 Bacteria 1768
141 Ga0207650_10211942 3300025925 Bacteria 1556
142 Ga0207659_10026992 3300025926 Bacteria 3882
143 Ga0207664_10229751 3300025929 Bacteria 1612
144 Ga0207664_10400794 3300025929 Bacteria 1220
145 Ga0207664_11047723 3300025929 Bacteria 730
146 Ga0207644_10013847 3300025931 Bacteria 5387
147 Ga0207644_10014947 3300025931 Bacteria 5204
148 Ga0207690_10132110 3300025932 Bacteria 1828
149 Ga0207690_10276276 3300025932 Bacteria 1307
150 Ga0207690_10846211 3300025932 Bacteria 757
151 Ga0207706_10006309 3300025933 Bacteria 11018
152 Ga0207706_10012988 3300025933 Bacteria 7580
153 Ga0207706_10380892 3300025933 Unclassified 1224
154 Ga0207691_10009591 3300025940 Bacteria 9289
155 Ga0207691_10062323 3300025940 Bacteria 3384
156 Ga0207711_10071404 3300025941 Bacteria 3012
157 Ga0207711_10710888 3300025941 Bacteria 937
158 Ga0207661_10109691 3300025944 Bacteria 2331
159 Ga0207661_10268703 3300025944 Bacteria 1521
160 Ga0207679_10003483 3300025945 Bacteria 9730
161 Ga0207679_10026267 3300025945 Bacteria 4014
162 Ga0207679_10209590 3300025945 Bacteria 1633
163 Ga0207679_11495150 3300025945 Bacteria 619
164 Ga0207667_10093440 3300025949 Bacteria 3106
165 Ga0207651_10020440 3300025960 Bacteria 3996
166 Ga0207651_10527740 3300025960 Unclassified 1024
167 Ga0207640_10133094 3300025981 Bacteria 1800
168 Ga0207658_10069012 3300025986 Bacteria 2669
169 Ga0207658_10152707 3300025986 Bacteria 1883
170 Ga0207677_10040311 3300026023 Bacteria 3078
171 Ga0207703_10327085 3300026035 Unclassified 1405
172 Ga0207678_10018629 3300026067 Bacteria 6095
173 Ga0207678_10051843 3300026067 Bacteria 3541
174 Ga0207678_10508200 3300026067 Bacteria 1051
175 Ga0207702_10025563 3300026078 Bacteria 4902
176 Ga0207702_10028238 3300026078 Bacteria 4662
177 Ga0207702_10953271 3300026078 Unclassified 851
178 Ga0207641_10518272 3300026088 Unclassified 1159
179 Ga0207676_10283021 3300026095 Bacteria 1506
180 Ga0207676_10709138 3300026095 Unclassified 975
181 Ga0207674_10004617 3300026116 Bacteria 16526
182 Ga0207674_10021228 3300026116 Bacteria 6999
183 Ga0207698_10188438 3300026142 Bacteria 1835
184 Ga0207698_10239291 3300026142 Bacteria 1653
185 Ga0207698_10920433 3300026142 Unclassified 882
186 Ga0207698_11534582 3300026142 Unclassified 681
187 Ga0268266_10538008 3300028379 Bacteria 1118
188 Ga0307408_100078613 3300031548 Bacteria 2459
189 Ga0307405_10101907 3300031731 Bacteria 1927
190 Ga0307405_10477542 3300031731 Bacteria 994
191 Ga0307405_12159913 3300031731 Unclassified 500
192 Ga0307413_10025745 3300031824 Bacteria 3230
193 Ga0307413_10073942 3300031824 Bacteria 2156
194 Ga0307413_10129114 3300031824 Bacteria 1726
195 Ga0307413_10171389 3300031824 Bacteria 1536
196 Ga0307413_10461749 3300031824 Bacteria 1010
197 Ga0307413_10536177 3300031824 Bacteria 946
198 Ga0307410_10008672 3300031852 Bacteria 5651
199 Ga0307410_10008798 3300031852 Bacteria 5623
200 Ga0307410_10059630 3300031852 Bacteria 2606
201 Ga0307410_10084417 3300031852 Bacteria 2239
202 Ga0307410_10114030 3300031852 Bacteria 1960
203 Ga0307410_10191557 3300031852 Bacteria 1555
204 Ga0307410_10231276 3300031852 Unclassified 1427
205 Ga0307410_11098734 3300031852 Bacteria 689
206 Ga0307406_10023978 3300031901 Bacteria 3638
207 Ga0307406_10070908 3300031901 Bacteria 2282
208 Ga0307406_10169331 3300031901 Bacteria 1579
209 Ga0307406_10443084 3300031901 Bacteria 1040
210 Ga0307407_10010195 3300031903 Bacteria 4419
211 Ga0307407_10079368 3300031903 Bacteria 1980
212 Ga0307407_10083874 3300031903 Bacteria 1934
213 Ga0307407_10107141 3300031903 Bacteria 1747
214 Ga0307407_10257571 3300031903 Bacteria 1198
215 Ga0307407_10546563 3300031903 Bacteria 855
216 Ga0307412_10024047 3300031911 Bacteria 3757
217 Ga0307412_10096981 3300031911 Bacteria 2076
218 Ga0307412_10304723 3300031911 Bacteria 1261
219 Ga0307412_10360041 3300031911 Bacteria 1171
220 Ga0307409_100026478 3300031995 Bacteria 4090
221 Ga0307409_100103048 3300031995 Bacteria 2372
222 Ga0307409_100139320 3300031995 Bacteria 2087
223 Ga0307409_100156547 3300031995 Bacteria 1986
224 Ga0307409_100296297 3300031995 Bacteria 1502
225 Ga0307409_100405672 3300031995 Bacteria 1303
226 Ga0307409_101240645 3300031995 Bacteria 769
227 Ga0307409_101338512 3300031995 Bacteria 742
228 Ga0307409_101811624 3300031995 Bacteria 639
229 Ga0307416_100022526 3300032002 Bacteria 4550
230 Ga0307416_100038002 3300032002 Bacteria 3710
231 Ga0307416_100082034 3300032002 Bacteria 2730
232 Ga0307416_100205904 3300032002 Bacteria 1871
233 Ga0307414_10007766 3300032004 Bacteria 6045
234 Ga0307414_10035108 3300032004 Bacteria 3333
235 Ga0307414_10189107 3300032004 Bacteria 1664
236 Ga0307414_10491245 3300032004 Bacteria 1084
237 Ga0307414_11414301 3300032004 Bacteria 646
238 Ga0307411_10005125 3300032005 Bacteria 6396
239 Ga0307411_10072467 3300032005 Bacteria 2339
240 Ga0307411_10073852 3300032005 Bacteria 2321
241 Ga0307411_10088443 3300032005 Bacteria 2154
242 Ga0307411_10150969 3300032005 Bacteria 1726
243 Ga0307411_10318608 3300032005 Bacteria 1254
244 Ga0307415_100016222 3300032126 Bacteria 4434
245 Ga0307415_100074412 3300032126 Bacteria 2400
246 Ga0307415_100077346 3300032126 Bacteria 2362
247 Ga0307415_100100063 3300032126 Bacteria 2123
248 Ga0307415_102577179 3300032126 Unclassified 501
249 Ga0373946_0509904 3300035171 Bacteria 617
250 Ga0395899_0033949 3300037312 Bacteria 3830
251 Ga0395899_0161976 3300037312 Bacteria 1580
252 Ga0395899_0172723 3300037312 Unclassified 1521
253 Ga0395900_0007827 3300037418 Bacteria 11015
254 Ga0395900_0054777 3300037418 Bacteria 4107
255 Ga0395900_0067742 3300037418 Bacteria 3667
256 Ga0395898_0077658 3300037466 Bacteria 3205
257 Ga0395898_0241158 3300037466 Bacteria 1724
258 Ga0395905_0004883 3300037471 Bacteria 13817
259 Ga0395905_0039427 3300037471 Bacteria 4432
260 Ga0395905_0441044 3300037471 Unclassified 1199
261 Ga0395905_0445544 3300037471 Bacteria 1192
262 Ga0395905_0497853 3300037471 Unclassified 1119
263 Ga0395901_0015393 3300038443 Bacteria 7787
264 Ga0395901_0040219 3300038443 Bacteria 4842
265 Ga0395901_0101993 3300038443 Bacteria 3011
266 Ga0436363_0138506 3300039450 Unclassified 864
267 Ga0439466_0201615 3300041411 Bacteria 605
268 Ga0439465_0031886 3300041413 Bacteria 1681
269 Ga0439465_0077373 3300041413 Bacteria 1123
270 Ga0439432_003506 3300042006 Bacteria 5811
271 Ga0439432_088159 3300042006 Bacteria 935
272 Ga0439449_0023013 3300042007 Bacteria 2332
273 Ga0439449_0109124 3300042007 Bacteria 1025
274 Ga0439452_047104 3300042010 Bacteria 998
275 Ga0450912_000032 3300042116 Bacteria 4381
276 Ga0450898_079323 3300042134 Bacteria 666
277 Ga0450898_085099 3300042134 Bacteria 647
278 Ga0466969_0103304 3300044656 Bacteria 1340
279 Ga0466972_0188515 3300044658 Bacteria 967
280 Ga0466966_0230168 3300044684 Unclassified 1118
281 Ga0466966_0501996 3300044684 Bacteria 730
282 Ga0466966_0526309 3300044684 Bacteria 711
283 Ga0466961_0064181 3300044693 Bacteria 2334
284 Ga0466961_0075856 3300044693 Bacteria 2131
285 Ga0466961_0263977 3300044693 Bacteria 1055
286 Ga0466961_0422975 3300044693 Bacteria 807
287 Ga0466963_0083718 3300044694 Bacteria 2164
288 Ga0466963_0112163 3300044694 Bacteria 1872
289 Ga0466963_0495005 3300044694 Unclassified 863
290 Ga0466964_0151140 3300044706 Bacteria 1077
291 Ga0466964_0180686 3300044706 Bacteria 1000
292 Ga0466964_0839555 3300044706 Bacteria 522
293 Ga0466971_0012803 3300044719 Bacteria 3677
294 Ga0466971_0028062 3300044719 Bacteria 2519
295 Ga0466971_0455508 3300044719 Bacteria 628
296 Ga0466970_0044243 3300044765 Bacteria 2370
297 Ga0466970_0128646 3300044765 Bacteria 1390
298 Ga0466957_0036661 3300044842 Bacteria 2949
299 Ga0466957_0086852 3300044842 Bacteria 1955
300 Ga0466957_0391985 3300044842 Unclassified 949
301 Ga0466957_1016572 3300044842 Bacteria 596
302 Ga0466959_0055966 3300045049 Bacteria 2878
303 Ga0466958_0008744 3300045836 Bacteria 5621
304 Ga0466958_0019791 3300045836 Bacteria 3919
305 Ga0466958_0217532 3300045836 Unclassified 1218
306 Ga0466967_0149372 3300045976 Bacteria 2183
307 Ga0495627_190566 3300046453 Unclassified 566
308 Ga0495629_0639835 3300046459 Bacteria 709
309 Ga0495585_0121717 3300046492 Unclassified 1380
310 Ga0495620_0219646 3300046515 Bacteria 728
311 Ga0495644_0026006 3300046523 Bacteria 2222
312 Ga0495663_0006403 3300046525 Bacteria 3250
313 Ga0495663_0197901 3300046525 Unclassified 700
314 Ga0495598_0000231 3300046537 Bacteria 9952
315 Ga0495621_0000597 3300046539 Bacteria 9014
316 Ga0495633_0010977 3300046558 Bacteria 4918
317 Ga0495661_0057455 3300046665 Bacteria 2323
318 Ga0495669_0002190 3300046684 Bacteria 8018
319 Ga0495669_0062148 3300046684 Bacteria 1692
320 Ga0495669_0083144 3300046684 Bacteria 1471
321 Ga0495669_0247231 3300046684 Bacteria 856
322 Ga0495670_0003874 3300046691 Bacteria 7349
323 Ga0495677_0007384 3300047445 Bacteria 4112
324 Ga0496101_0041724 3300048904 Bacteria 3273
325 Ga0496101_0276526 3300048904 Unclassified 1312
326 Ga0496102_0015381 3300048905 Bacteria 6665
327 Ga0496102_0373576 3300048905 Bacteria 1342
328 Ga0496103_0337336 3300048906 Unclassified 969
329 Ga0496104_0128509 3300048907 Bacteria 2434
330 Ga0496106_0068353 3300048909 Bacteria 2710
331 Ga0496106_0113835 3300048909 Bacteria 2109
332 Ga0496107_0014908 3300048910 Bacteria 5442
333 Ga0496107_0323231 3300048910 Bacteria 1148
334 Ga0496108_0020381 3300048911 Bacteria 5450
335 Ga0496108_0066826 3300048911 Bacteria 3032
336 Ga0496109_0017915 3300048912 Bacteria 6216
337 Ga0496109_0090176 3300048912 Bacteria 2835
338 Ga0496109_0506028 3300048912 Bacteria 1140
339 Ga0496110_0054896 3300048913 Bacteria 3504
340 Ga0496110_0127394 3300048913 Bacteria 2297
341 Ga0496111_0002214 3300048914 Bacteria 11663
342 Ga0496111_0395049 3300048914 Bacteria 1022
343 Ga0496111_0530059 3300048914 Unclassified 865
344 Ga0496112_0024933 3300048915 Bacteria 5738
345 Ga0496112_0095008 3300048915 Bacteria 2952
346 Ga0496113_0002615 3300048916 Bacteria 10534
347 Ga0496113_0089112 3300048916 Bacteria 2374
348 Ga0496114_0090303 3300048917 Bacteria 2600
349 Ga0496115_0023981 3300048918 Bacteria 4738
350 Ga0501069_0057030 3300049585 Unclassified 2177
351 Ga0501233_098851 3300049668 Unclassified 770
352 nmdc:mga0n895_1096778_c1 3300050512 Bacteria 773
353 Ga0587075_059182 3300059644 Unclassified 687
354 Ga0466962_0025200 3300061719 Bacteria 2855
355 Ga0466962_0027839 3300061719 Bacteria 2709
356 Ga0070670_100059654
357 JGI24735J21928_10209499
358 Ga0065712_10258573
359 Ga0065715_10821741
360 Ga0070658_10027662
361 Ga0070658_10030823
362 Ga0070658_10783109
363 Ga0070676_10249874
364 Ga0070683_100225387
365 Ga0070683_100889014
366 Ga0070670_100012394
367 Ga0070670_100185465
368 Ga0070670_101978459
369 Ga0070677_10228065
370 Ga0070666_10016602
371 Ga0070666_10155528
372 Ga0068868_100831586
373 Ga0070660_100121604
374 Ga0070660_100363959
375 Ga0070660_101342953
376 Ga0070689_100599419
377 Ga0070661_100034551
378 Ga0070661_100048713
379 Ga0070661_100276549
380 Ga0070692_10439629
381 Ga0070675_100012092
382 Ga0070675_100785835
383 Ga0070671_100009973
384 Ga0070671_100155869
385 Ga0070671_100305120
386 Ga0070674_100318361
387 Ga0070673_100033445
388 Ga0070673_100095950
389 Ga0070673_100154784
390 Ga0070673_100758537
391 Ga0070659_100029341
392 Ga0070659_100058699
393 Ga0070659_100443163
394 Ga0070667_100004347
395 Ga0070667_100016231
396 Ga0070667_100495765
397 Ga0070667_101536324
398 Ga0070709_10044918
399 Ga0070714_100027398
400 Ga0070714_100039876
401 Ga0070714_100106786
402 Ga0070713_100041674
403 Ga0070663_100013440
404 Ga0070663_100188101
405 Ga0070662_100039372
406 Ga0070662_100197565
407 Ga0070662_100391503
408 Ga0070679_100204618
409 Ga0070684_100004884
410 Ga0070672_100018813
411 Ga0070672_100075821
412 Ga0070693_100255419
413 Ga0070665_100092511
414 Ga0070665_101513999
415 Ga0068855_100304628
416 Ga0068855_101392164
417 Ga0070664_100011516
418 Ga0070664_100013829
419 Ga0070664_100058497
420 Ga0070664_100179436
421 Ga0070664_100222126
422 Ga0068857_100017137
423 Ga0068857_100148051
424 Ga0068854_101451765
425 Ga0068856_100042249
426 Ga0068856_100462593
427 Ga0068852_101824115
428 Ga0068859_100178033
429 Ga0068864_100018619
430 Ga0068864_100759633
431 Ga0068851_10062822
432 Ga0068851_10255309
433 Ga0068863_100142572
434 Ga0068863_101930902
435 Ga0068858_100027743
436 Ga0068860_100229835
437 Ga0070717_10066455
438 Ga0070716_100045587
439 Ga0070712_100031743
440 Ga0097621_100028916
441 Ga0068871_100049132
442 Ga0068865_101423364
443 Ga0097620_100178029
444 Ga0105250_10253797
445 Ga0105240_10135394
446 Ga0105241_10539274
447 Ga0105248_10097797
448 Ga0105248_10722703
449 Ga0105248_12413275
450 Ga0105248_12416538
451 Ga0105237_10054672
452 Ga0105237_12220234
453 Ga0105246_10083133
454 Ga0157373_10076402
455 Ga0157373_10088793
456 Ga0157371_10067181
457 Ga0157369_10697348
458 Ga0157374_10081885
459 Ga0157372_10191453
460 Ga0157372_10408213
461 Ga0157375_13118930
462 Ga0163163_10075666
463 Ga0163163_10807057
464 Ga0182008_10069044
465 Ga0157379_10014771
466 Ga0163161_10179493
467 Ga0206353_10114185
468 Ga0207656_10065778
469 Ga0207656_10183469
470 Ga0207682_10046638
471 Ga0207680_10009738
472 Ga0207680_10131383
473 Ga0207647_10044526
474 Ga0207647_10079746
475 Ga0207645_10240228
476 Ga0207705_10026344
477 Ga0207705_10250578
478 Ga0207705_10934606
479 Ga0207705_10953951
480 Ga0207654_10117879
481 Ga0207707_11270983
482 Ga0207695_10835557
483 Ga0207671_10329692
484 Ga0207693_10016650
485 Ga0207657_10004423
486 Ga0207657_10028897
487 Ga0207657_10322115
488 Ga0207657_10699582
489 Ga0207649_10094276
490 Ga0207649_10099526
491 Ga0207649_10322030
492 Ga0207652_10307991
493 Ga0207681_10990809
494 Ga0207650_10035099
495 Ga0207650_10162950
496 Ga0207650_10211942
497 Ga0207659_10026992
498 Ga0207664_10229751
499 Ga0207664_10400794
500 Ga0207664_11047723
501 Ga0207644_10013847
502 Ga0207644_10014947
503 Ga0207690_10132110
504 Ga0207690_10276276
505 Ga0207690_10846211
506 Ga0207706_10006309
507 Ga0207706_10012988
508 Ga0207706_10380892
509 Ga0207691_10009591
510 Ga0207691_10062323
511 Ga0207711_10071404
512 Ga0207711_10710888
513 Ga0207661_10109691
514 Ga0207661_10268703
515 Ga0207679_10003483
516 Ga0207679_10026267
517 Ga0207679_10209590
518 Ga0207679_11495150
519 Ga0207667_10093440
520 Ga0207651_10020440
521 Ga0207651_10527740
522 Ga0207640_10133094
523 Ga0207658_10069012
524 Ga0207658_10152707
525 Ga0207677_10040311
526 Ga0207703_10327085
527 Ga0207678_10018629
528 Ga0207678_10051843
529 Ga0207678_10508200
530 Ga0207702_10025563
531 Ga0207702_10028238
532 Ga0207702_10953271
533 Ga0207641_10518272
534 Ga0207676_10283021
535 Ga0207676_10709138
536 Ga0207674_10004617
537 Ga0207674_10021228
538 Ga0207698_10188438
539 Ga0207698_10239291
540 Ga0207698_10920433
541 Ga0207698_11534582
542 Ga0268266_10538008
543 Ga0307408_100078613
544 Ga0307405_10101907
545 Ga0307405_10477542
546 Ga0307405_12159913
547 Ga0307413_10025745
548 Ga0307413_10073942
549 Ga0307413_10129114
550 Ga0307413_10171389
551 Ga0307413_10461749
552 Ga0307413_10536177
553 Ga0307410_10008672
554 Ga0307410_10008798
555 Ga0307410_10059630
556 Ga0307410_10084417
557 Ga0307410_10114030
558 Ga0307410_10191557
559 Ga0307410_10231276
560 Ga0307410_11098734
561 Ga0307406_10023978
562 Ga0307406_10070908
563 Ga0307406_10169331
564 Ga0307406_10443084
565 Ga0307407_10010195
566 Ga0307407_10079368
567 Ga0307407_10083874
568 Ga0307407_10107141
569 Ga0307407_10257571
570 Ga0307407_10546563
571 Ga0307412_10024047
572 Ga0307412_10096981
573 Ga0307412_10304723
574 Ga0307412_10360041
575 Ga0307409_100026478
576 Ga0307409_100103048
577 Ga0307409_100139320
578 Ga0307409_100156547
579 Ga0307409_100296297
580 Ga0307409_100405672
581 Ga0307409_101240645
582 Ga0307409_101338512
583 Ga0307409_101811624
584 Ga0307416_100022526
585 Ga0307416_100038002
586 Ga0307416_100082034
587 Ga0307416_100205904
588 Ga0307414_10007766
589 Ga0307414_10035108
590 Ga0307414_10189107
591 Ga0307414_10491245
592 Ga0307414_11414301
593 Ga0307411_10005125
594 Ga0307411_10072467
595 Ga0307411_10073852
596 Ga0307411_10088443
597 Ga0307411_10150969
598 Ga0307411_10318608
599 Ga0307415_100016222
600 Ga0307415_100074412
601 Ga0307415_100077346
602 Ga0307415_100100063
603 Ga0307415_102577179
604 Ga0373946_0509904
605 Ga0395899_0033949
606 Ga0395899_0161976
607 Ga0395899_0172723
608 Ga0395900_0007827
609 Ga0395900_0054777
610 Ga0395900_0067742
611 Ga0395898_0077658
612 Ga0395898_0241158
613 Ga0395905_0004883
614 Ga0395905_0039427
615 Ga0395905_0441044
616 Ga0395905_0445544
617 Ga0395905_0497853
618 Ga0395901_0015393
619 Ga0395901_0040219
620 Ga0395901_0101993
621 Ga0436363_0138506
622 Ga0439466_0201615
623 Ga0439465_0031886
624 Ga0439465_0077373
625 Ga0439432_003506
626 Ga0439432_088159
627 Ga0439449_0023013
628 Ga0439449_0109124
629 Ga0439452_047104
630 Ga0450912_000032
631 Ga0450898_079323
632 Ga0450898_085099
633 Ga0466969_0103304
634 Ga0466972_0188515
635 Ga0466966_0230168
636 Ga0466966_0501996
637 Ga0466966_0526309
638 Ga0466961_0064181
639 Ga0466961_0075856
640 Ga0466961_0263977
641 Ga0466961_0422975
642 Ga0466963_0083718
643 Ga0466963_0112163
644 Ga0466963_0495005
645 Ga0466964_0151140
646 Ga0466964_0180686
647 Ga0466964_0839555
648 Ga0466971_0012803
649 Ga0466971_0028062
650 Ga0466971_0455508
651 Ga0466970_0044243
652 Ga0466970_0128646
653 Ga0466957_0036661
654 Ga0466957_0086852
655 Ga0466957_0391985
656 Ga0466957_1016572
657 Ga0466959_0055966
658 Ga0466958_0008744
659 Ga0466958_0019791
660 Ga0466958_0217532
661 Ga0466967_0149372
662 Ga0495627_190566
663 Ga0495629_0639835
664 Ga0495585_0121717
665 Ga0495620_0219646
666 Ga0495644_0026006
667 Ga0495663_0006403
668 Ga0495663_0197901
669 Ga0495598_0000231
670 Ga0495621_0000597
671 Ga0495633_0010977
672 Ga0495661_0057455
673 Ga0495669_0002190
674 Ga0495669_0062148
675 Ga0495669_0083144
676 Ga0495669_0247231
677 Ga0495670_0003874
678 Ga0495677_0007384
679 Ga0496101_0041724
680 Ga0496101_0276526
681 Ga0496102_0015381
682 Ga0496102_0373576
683 Ga0496103_0337336
684 Ga0496104_0128509
685 Ga0496106_0068353
686 Ga0496106_0113835
687 Ga0496107_0014908
688 Ga0496107_0323231
689 Ga0496108_0020381
690 Ga0496108_0066826
691 Ga0496109_0017915
692 Ga0496109_0090176
693 Ga0496109_0506028
694 Ga0496110_0054896
695 Ga0496110_0127394
696 Ga0496111_0002214
697 Ga0496111_0395049
698 Ga0496111_0530059
699 Ga0496112_0024933
700 Ga0496112_0095008
701 Ga0496113_0002615
702 Ga0496113_0089112
703 Ga0496114_0090303
704 Ga0496115_0023981
705 Ga0501069_0057030
706 Ga0501233_098851
707 nmdc:mga0n895_1096778_c1
708 Ga0587075_059182
709 Ga0466962_0025200
710 Ga0466962_0027839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07332

Phage_holin_3_6

Putative Actinobacterial Holin-X, holin superfamily III

20

117

0.96

Map