F419949

General Info

Members Datasets Scaffolds Average Seq Length
354 237 708 336

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2554235005|2554256984
Length 327
Sequence FSGVKPTGHLTLGNYIGAVRKWVEEDQHRADALFGIVDLHALTVEHDPARVRRLSRQAATLLLAAGLDPERCVLFVQSHVDEHARLSYLLECTATDGEMRRMIQYKEKAARERGGSVRLSLLTYPVLMAADILAYETDEVPVGDDQAQHVELTRDLAVRFNQRYGHTFTVPKATHPVVGARVMNLQDPTSKMGKSDDSGPGIVYLLDEPDVVRRKVMRAVTDSGQDVVFDREGRPGLANLLEVLAACTGAADPAELAGDYASYGALKRDVADAVVELLRPLRERHAELVADPAYVDGVLRAGAERARGMARPVVDRAYRAVGLLPAV

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
14 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
15 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
16 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
17 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
23 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
26 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
27 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
28 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
32 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
41 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
42 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
43 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
44 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
45 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
46 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
47 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
48 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
49 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
156 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
157 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
158 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
159 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
160 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
170 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
171 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
172 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
173 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
174 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
175 2643221647 Streptomyces sp. Root369 Isolate Unclassified
176 2643221670 Streptomyces sp. Root431 Isolate Unclassified
177 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
178 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
179 2643221714 Streptomyces sp. Root264 Isolate Unclassified
180 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
181 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
182 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
183 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
184 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
185 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
186 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
187 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
188 2808606448 Streptomyces sp. 193411 Isolate Unclassified
189 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
190 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
191 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
192 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
193 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
194 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
195 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
196 2862574272 Streptomyces sp. AcE210 Isolate Nodule
197 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
198 2867428634 Streptomyces sp. RP5T Isolate Unclassified
199 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
200 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
201 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
202 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
203 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
204 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
205 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
206 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
207 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
208 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
209 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
210 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
211 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
212 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
213 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
214 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
215 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
216 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
217 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
218 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
219 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
220 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
221 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
222 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
223 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
224 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
225 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
226 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
227 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
228 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
229 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
230 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
231 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
232 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
233 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
234 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
235 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
236 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
237 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.23
Metatranscriptomes 0.28
Isolates 19.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0.56
Rhizoplane 0.28
Rhizosphere 77.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10028399 3300002067 Bacteria 1670
2 rootH1_10046175 3300003316 Bacteria 1579
3 rootL2_10041899 3300003322 Bacteria 2744
4 Ga0006562J51391_1051517 3300003578 Bacteria 2186
5 Ga0070665_100301219 3300005548 Bacteria 1606
6 Ga0068856_100136916 3300005614 Bacteria 2454
7 Ga0075363_100099121 3300006048 Bacteria 1611
8 Ga0075367_10095468 3300006178 Bacteria 1813
9 Ga0075370_10051037 3300006353 Bacteria 2346
10 Ga0105251_10017531 3300009011 Bacteria 3834
11 Ga0105243_10166315 3300009148 Bacteria 1906
12 Ga0105246_10027984 3300011119 Bacteria 3700
13 Ga0182008_10006311 3300014497 Bacteria 6644
14 Ga0182006_1016845 3300015261 Bacteria 3114
15 Ga0182007_10006346 3300015262 Bacteria 5083
16 Ga0183367_1015 3300015688 Bacteria 298435
17 Ga0209758_1003745 3300025297 Bacteria 13467
18 Ga0207426_1012273 3300025302 Bacteria 3225
19 Ga0207426_1018749 3300025302 Bacteria 2433
20 Ga0207426_1020821 3300025302 Bacteria 2275
21 Ga0207426_1029910 3300025302 Bacteria 1791
22 Ga0207647_10024246 3300025904 Bacteria 4002
23 Ga0207709_10084543 3300025935 Bacteria 2055
24 Ga0207702_10216521 3300026078 Bacteria 1783
25 Ga0307517_10033990 3300028786 Bacteria 5826
26 Ga0307515_10007000 3300028794 Bacteria 22397
27 Ga0307515_10223368 3300028794 Bacteria 1695
28 Ga0307511_10019620 3300030521 Bacteria 6421
29 Ga0307512_10036397 3300030522 Bacteria 4174
30 Ga0307513_10123873 3300031456 Bacteria 2545
31 Ga0307509_10033033 3300031507 Bacteria 5697
32 Ga0307509_10200981 3300031507 Bacteria 1830
33 Ga0307508_10012539 3300031616 Bacteria 7751
34 Ga0307508_10091994 3300031616 Bacteria 2621
35 Ga0307508_10135574 3300031616 Bacteria 2065
36 Ga0307516_10025490 3300031730 Bacteria 6021
37 Ga0307516_10077409 3300031730 Bacteria 3175
38 Ga0307516_10101330 3300031730 Bacteria 2695
39 Ga0307518_10188117 3300031838 Bacteria 1387
40 Ga0307507_10025944 3300033179 Bacteria 6333
41 Ga0307507_10084939 3300033179 Bacteria 2756
42 Ga0307507_10113402 3300033179 Bacteria 2203
43 Ga0307510_10063541 3300033180 Bacteria 3759
44 Ga0307510_10084620 3300033180 Bacteria 3053
45 Ga0307510_10135436 3300033180 Bacteria 2122
46 Ga0307510_10157654 3300033180 Bacteria 1873
47 Ga0307510_10167153 3300033180 Bacteria 1785
48 Ga0395898_0003292 3300037466 Bacteria 18144
49 Ga0395898_0185179 3300037466 Bacteria 1989
50 Ga0395898_0212924 3300037466 Bacteria 1843
51 Ga0395901_0261620 3300038443 Bacteria 1801
52 Ga0439436_0000544 3300041404 Bacteria 9915
53 Ga0439436_0013076 3300041404 Bacteria 2513
54 Ga0439439_0008345 3300041406 Bacteria 2445
55 Ga0439439_0009015 3300041406 Bacteria 2366
56 Ga0451853_1262046 3300041512 Bacteria 6496
57 Ga0451853_1799241 3300041512 Bacteria 4970
58 Ga0451853_3591302 3300041512 Bacteria 1138
59 Ga0439433_0009544 3300041999 Bacteria 2116
60 Ga0439449_0010026 3300042007 Bacteria 3583
61 Ga0439455_0012632 3300042012 Bacteria 1900
62 Ga0439457_000818 3300042014 Bacteria 9305
63 Ga0439457_001534 3300042014 Bacteria 6930
64 Ga0439462_0009840 3300042015 Bacteria 2419
65 Ga0450894_001082 3300042131 Bacteria 4118
66 Ga0450896_000796 3300042133 Bacteria 3560
67 Ga0450899_000527 3300042135 Bacteria 4358
68 Ga0450903_000006 3300042138 Bacteria 38832
69 Ga0450906_001712 3300042145 Bacteria 4798
70 Ga0439458_0006113 3300042157 Bacteria 2687
71 Ga0450908_008549 3300042184 Bacteria 1917
72 Ga0466969_0034510 3300044656 Bacteria 2563
73 Ga0466966_0006403 3300044684 Bacteria 7785
74 Ga0466966_0071109 3300044684 Bacteria 2180
75 Ga0466961_0016666 3300044693 Bacteria 4724
76 Ga0466963_0004602 3300044694 Bacteria 8034
77 Ga0466964_0003744 3300044706 Bacteria 5568
78 Ga0466971_0023236 3300044719 Bacteria 2762
79 Ga0466971_0052128 3300044719 Bacteria 1843
80 Ga0466968_0038770 3300044735 Bacteria 2003
81 Ga0466970_0002338 3300044765 Bacteria 9168
82 Ga0466970_0023461 3300044765 Bacteria 3222
83 Ga0466957_0011935 3300044842 Bacteria 5022
84 Ga0466959_0018118 3300045049 Bacteria 5167
85 Ga0466958_0012304 3300045836 Bacteria 4844
86 Ga0466967_0136376 3300045976 Bacteria 2282
87 Ga0495592_0020757 3300046454 Bacteria 4997
88 Ga0495603_0020107 3300046455 Bacteria 4046
89 Ga0495603_0025078 3300046455 Bacteria 3606
90 Ga0495603_0045982 3300046455 Bacteria 2602
91 Ga0495603_0112199 3300046455 Bacteria 1590
92 Ga0495629_0030444 3300046459 Bacteria 3826
93 Ga0495629_0057652 3300046459 Bacteria 2715
94 Ga0495629_0072850 3300046459 Bacteria 2398
95 Ga0495629_0135496 3300046459 Bacteria 1714
96 Ga0495629_0155386 3300046459 Bacteria 1590
97 Ga0495638_0068839 3300046460 Bacteria 2169
98 Ga0495638_0071863 3300046460 Bacteria 2116
99 Ga0495641_0143234 3300046461 Bacteria 1068
100 Ga0495651_0009262 3300046462 Bacteria 7553
101 Ga0495651_0095548 3300046462 Bacteria 2222
102 Ga0495653_0321048 3300046463 Bacteria 1004
103 Ga0495582_0168258 3300046473 Bacteria 1247
104 Ga0495605_0053672 3300046474 Bacteria 1954
105 Ga0495662_0003417 3300046476 Bacteria 8045
106 Ga0495662_0080537 3300046476 Bacteria 1583
107 Ga0495664_0003367 3300046477 Bacteria 8690
108 Ga0495585_0032412 3300046492 Bacteria 2960
109 Ga0495594_0011484 3300046499 Bacteria 4604
110 Ga0495583_0056825 3300046506 Bacteria 1762
111 Ga0495606_0012495 3300046507 Bacteria 6801
112 Ga0495618_0088370 3300046514 Bacteria 1982
113 Ga0495620_0030787 3300046515 Bacteria 2466
114 Ga0495620_0102677 3300046515 Bacteria 1138
115 Ga0495628_0151777 3300046516 Bacteria 1764
116 Ga0495631_0002894 3300046518 Bacteria 9511
117 Ga0495643_0003085 3300046522 Bacteria 12509
118 Ga0495643_0013633 3300046522 Bacteria 4858
119 Ga0495644_0063776 3300046523 Bacteria 1385
120 Ga0495648_0158945 3300046524 Bacteria 1170
121 Ga0495666_0143372 3300046526 Bacteria 1112
122 Ga0495652_0080859 3300046529 Bacteria 2682
123 Ga0495652_0150484 3300046529 Bacteria 1819
124 Ga0495640_0016190 3300046533 Bacteria 5582
125 Ga0495640_0109677 3300046533 Bacteria 1804
126 Ga0495640_0166188 3300046533 Bacteria 1411
127 Ga0495586_0037753 3300046535 Bacteria 2594
128 Ga0495587_0002915 3300046536 Bacteria 11445
129 Ga0495597_0041216 3300046542 Bacteria 2063
130 Ga0495645_0042369 3300046543 Bacteria 3319
131 Ga0495622_0020092 3300046557 Bacteria 3110
132 Ga0495633_0067008 3300046558 Bacteria 1676
133 Ga0495667_0155363 3300046559 Bacteria 1472
134 Ga0495668_0076829 3300046616 Bacteria 1833
135 Ga0495634_0078556 3300046642 Bacteria 2161
136 Ga0495634_0110548 3300046642 Bacteria 1767
137 Ga0495634_0172957 3300046642 Bacteria 1356
138 Ga0495625_0041187 3300046660 Bacteria 3363
139 Ga0495625_0075121 3300046660 Bacteria 2365
140 Ga0495625_0111635 3300046660 Bacteria 1868
141 Ga0495635_0139878 3300046663 Bacteria 1649
142 Ga0495635_0154081 3300046663 Bacteria 1564
143 Ga0495588_0097929 3300046674 Bacteria 1539
144 Ga0495657_0066673 3300046675 Bacteria 2364
145 Ga0495657_0116745 3300046675 Bacteria 1684
146 Ga0495657_0175074 3300046675 Bacteria 1319
147 Ga0495623_0154585 3300046679 Bacteria 1353
148 Ga0495646_0019606 3300046680 Bacteria 4278
149 Ga0495647_0066354 3300046681 Bacteria 1435
150 Ga0495658_0013726 3300046683 Bacteria 4129
151 Ga0495613_0003658 3300046689 Bacteria 11522
152 Ga0495613_0048783 3300046689 Bacteria 3126
153 Ga0495613_0051243 3300046689 Bacteria 3042
154 Ga0495613_0119562 3300046689 Bacteria 1892
155 Ga0495624_0131151 3300046690 Bacteria 1536
156 Ga0495670_0005831 3300046691 Bacteria 6033
157 Ga0495671_0013195 3300046692 Bacteria 4485
158 Ga0495649_0065124 3300046694 Bacteria 1956
159 Ga0495589_0017781 3300046794 Bacteria 3647
160 Ga0495589_0018865 3300046794 Bacteria 3537
161 Ga0495589_0020311 3300046794 Bacteria 3398
162 Ga0495589_0092589 3300046794 Bacteria 1467
163 Ga0495600_0102396 3300046809 Bacteria 1866
164 Ga0495600_0110984 3300046809 Bacteria 1785
165 Ga0495581_0008225 3300047315 Bacteria 6047
166 Ga0495604_0038827 3300047317 Bacteria 3746
167 Ga0495604_0066871 3300047317 Bacteria 2733
168 Ga0495604_0088945 3300047317 Bacteria 2296
169 Ga0495636_0005117 3300047318 Bacteria 5148
170 Ga0495636_0006877 3300047318 Bacteria 4473
171 Ga0495636_0032639 3300047318 Bacteria 2136
172 Ga0495636_0059865 3300047318 Bacteria 1608
173 Ga0495674_0031487 3300047319 Bacteria 4819
174 Ga0495676_0004929 3300047321 Bacteria 12243
175 Ga0495676_0025216 3300047321 Bacteria 5136
176 Ga0495676_0035650 3300047321 Bacteria 4159
177 Ga0495676_0083045 3300047321 Bacteria 2422
178 Ga0495676_0114814 3300047321 Bacteria 1969
179 Ga0495680_0170904 3300047322 Bacteria 1573
180 Ga0495683_0147271 3300047323 Bacteria 1099
181 Ga0495687_008351 3300047443 Bacteria 5938
182 Ga0495687_023534 3300047443 Bacteria 2940
183 Ga0495687_026947 3300047443 Bacteria 2696
184 Ga0495687_028477 3300047443 Bacteria 2598
185 Ga0495687_050546 3300047443 Bacteria 1770
186 Ga0495687_050710 3300047443 Bacteria 1766
187 Ga0495675_0030005 3300047444 Bacteria 3469
188 Ga0495685_007473 3300047447 Bacteria 3609
189 Ga0495685_020388 3300047447 Bacteria 2277
190 Ga0495681_0005684 3300047470 Bacteria 8303
191 Ga0495681_0009279 3300047470 Bacteria 6078
192 Ga0495681_0059553 3300047470 Bacteria 1765
193 Ga0495593_0014592 3300047673 Bacteria 4464
194 Ga0495593_0060569 3300047673 Bacteria 1981
195 Ga0495614_0015109 3300048089 Bacteria 3369
196 Ga0495614_0042893 3300048089 Bacteria 1939
197 Ga0501031_0023237 3300049568 Bacteria 4041
198 Ga0501031_0176253 3300049568 Bacteria 1397
199 Ga0501031_0185798 3300049568 Bacteria 1357
200 Ga0501032_0013638 3300049569 Bacteria 5772
201 Ga0501032_0123689 3300049569 Bacteria 1709
202 Ga0501033_0013276 3300049570 Bacteria 6276
203 Ga0501033_0018487 3300049570 Bacteria 5266
204 Ga0501033_0021782 3300049570 Bacteria 4836
205 Ga0501033_0065255 3300049570 Bacteria 2678
206 Ga0501034_0002096 3300049571 Bacteria 24900
207 Ga0501034_0011995 3300049571 Bacteria 8954
208 Ga0501034_0027746 3300049571 Bacteria 5757
209 Ga0501034_0146038 3300049571 Bacteria 2342
210 Ga0501034_0217430 3300049571 Bacteria 1864
211 Ga0501036_0000716 3300049572 Bacteria 24540
212 Ga0501036_0012244 3300049572 Bacteria 7105
213 Ga0501036_0025965 3300049572 Bacteria 4942
214 Ga0501037_0005867 3300049573 Bacteria 8972
215 Ga0501037_0015862 3300049573 Bacteria 5547
216 Ga0501037_0033458 3300049573 Bacteria 3796
217 Ga0501038_0007874 3300049574 Bacteria 9819
218 Ga0501038_0017371 3300049574 Bacteria 6503
219 Ga0501038_0040959 3300049574 Bacteria 4041
220 Ga0501038_0055151 3300049574 Bacteria 3415
221 Ga0501038_0096341 3300049574 Bacteria 2470
222 Ga0501038_0113836 3300049574 Bacteria 2238
223 Ga0501039_0019146 3300049575 Bacteria 5252
224 Ga0501039_0036413 3300049575 Bacteria 3797
225 Ga0501040_0052707 3300049576 Bacteria 2785
226 Ga0501041_0030349 3300049577 Bacteria 3262
227 Ga0501042_0024301 3300049578 Bacteria 4249
228 Ga0501042_0108686 3300049578 Bacteria 1996
229 Ga0501043_0032885 3300049579 Bacteria 4079
230 Ga0501043_0088087 3300049579 Bacteria 2439
231 Ga0501043_0095799 3300049579 Bacteria 2332
232 Ga0501043_0133271 3300049579 Bacteria 1947
233 Ga0501043_0134460 3300049579 Bacteria 1937
234 Ga0501043_0201849 3300049579 Bacteria 1543
235 Ga0501046_0043902 3300049580 Bacteria 3556
236 Ga0501046_0145888 3300049580 Bacteria 1787
237 Ga0501046_0163275 3300049580 Bacteria 1674
238 Ga0501047_0001043 3300049581 Bacteria 27669
239 Ga0501047_0009981 3300049581 Bacteria 8974
240 Ga0501047_0060664 3300049581 Bacteria 3649
241 Ga0501047_0213059 3300049581 Bacteria 1790
242 Ga0501048_0021075 3300049582 Bacteria 4773
243 Ga0501048_0155332 3300049582 Bacteria 1618
244 Ga0501048_0201688 3300049582 Bacteria 1410
245 Ga0501067_0015511 3300049583 Bacteria 4216
246 Ga0501068_0002784 3300049584 Bacteria 9296
247 Ga0501069_0015915 3300049585 Bacteria 4032
248 Ga0501070_0009705 3300049586 Bacteria 8139
249 Ga0501070_0024581 3300049586 Bacteria 5051
250 Ga0501071_0058167 3300049587 Bacteria 2794
251 Ga0501072_0035551 3300049588 Bacteria 3902
252 Ga0501073_0012236 3300049589 Bacteria 6262
253 Ga0501074_0030589 3300049590 Bacteria 3902
254 Ga0501074_0046742 3300049590 Bacteria 3129
255 Ga0501076_0053099 3300049592 Bacteria 3211
256 Ga0501077_0020154 3300049593 Bacteria 4221
257 Ga0501079_0049046 3300049741 Bacteria 3258
258 Ga0501080_0446717 3300049742 Bacteria 1159
259 Ga0501083_0033969 3300049744 Bacteria 3489
260 Ga0501035_0001231 3300049822 Bacteria 26652
261 Ga0501035_0012655 3300049822 Bacteria 7796
262 Ga0501035_0037420 3300049822 Bacteria 4394
263 Ga0501035_0065974 3300049822 Bacteria 3212
264 Ga0501035_0066644 3300049822 Bacteria 3195
265 Ga0501035_0222619 3300049822 Bacteria 1610
266 Ga0501044_0032944 3300049823 Bacteria 5446
267 Ga0501044_0038476 3300049823 Bacteria 4994
268 Ga0501044_0055774 3300049823 Bacteria 4057
269 Ga0501044_0060747 3300049823 Bacteria 3868
270 Ga0501045_0029047 3300049824 Bacteria 3993
271 Ga0501045_0230858 3300049824 Bacteria 1378
272 Ga0500640_044228 3300053095 Bacteria 1954
273 Ga0500660_047457 3300053100 Bacteria 2145
274 Ga0500553_050040 3300053101 Bacteria 2008
275 Ga0500569_022127 3300053109 Bacteria 1689
276 Ga0500572_008323 3300053111 Bacteria 2422
277 Ga0500561_0004410 3300053137 Bacteria 2537
278 Ga0500573_0074264 3300053140 Bacteria 1937
279 Ga0500600_0075313 3300053149 Bacteria 1840
280 Ga0500616_0070642 3300053153 Bacteria 1781
281 Ga0500624_002396 3300053157 Bacteria 2542
282 Ga0500587_004500 3300053739 Bacteria 1911
283 Ga0501084_0055899 3300054114 Bacteria 3302
284 Ga0466962_0003365 3300061719 Bacteria 7607
285 Ga0530510_0044657 3300061734 Bacteria 3202
286 2554256984 2554235005 Bacteria 6457341
287 2547412969 2547132111 Bacteria 8013147
288 2585305086 2582581313 Bacteria 10042643
289 2585318258 2582581314 Bacteria 11452267
290 2616701426 2616644814 Bacteria 11555299
291 2643947697 2643221587 Bacteria 7586415
292 2644266228 2643221647 Bacteria 10741251
293 2644390122 2643221670 Bacteria 6497041
294 2644435389 2643221677 Bacteria 7584031
295 2644437645 2643221678 Bacteria 9540101
296 2644627896 2643221714 Bacteria 9015452
297 2784589470 2784132148 Bacteria 8627943
298 2785342117 2784746763 Bacteria 9783172
299 2785370542 2784746768 Bacteria 10036182
300 2786671700 2786546132 Bacteria 10419719
301 2793978150 2791355406 Bacteria 11364898
302 2804845789 2802429296 Bacteria 7227771
303 2808843100 2808606359 Bacteria 9866990
304 2808921447 2808606375 Bacteria 9466072
305 2809233134 2808606448 Bacteria 8656184
306 2811845298 2808606982 Bacteria 7791042
307 2812357020 2811994879 Bacteria 9313447
308 2812479682 2811994917 Bacteria 7761064
309 2852640115 2852635781 Bacteria 8251373
310 2862286728 2862281513 Bacteria 9621493
311 2862295212 2862290372 Bacteria 7471434
312 2862510313 2862507626 Bacteria 9425308
313 2862578379 2862574272 Bacteria 10567477
314 2863411800 2863404153 Bacteria 9672205
315 2867436291 2867428634 Bacteria 9590268
316 2873154903 2873151551 Bacteria 8625867
317 2877680080 2877676314 Bacteria 9512378
318 2912718672 2912715099 Bacteria 9460473
319 2912761924 2912757875 Bacteria 7940295
320 2918504556 2918501144 Bacteria 8668083
321 2919471516 2919468124 Bacteria 9133025
322 2946068860 2946064051 Bacteria 8957905
323 2946076900 2946072368 Bacteria 8999607
324 2947228052 2947224130 Bacteria 9938529
325 2954385011 2954380949 Bacteria 10050426
326 2954677985 2954673503 Bacteria 9685905
327 2954686172 2954682443 Bacteria 9862841
328 2954695828 2954691527 Bacteria 10720516
329 2954715237 2954711539 Bacteria 10867210
330 2954736639 2954731030 Bacteria 10243860
331 2954744110 2954740390 Bacteria 10229294
332 2954755487 2954749733 Bacteria 10366972
333 2954763052 2954759201 Bacteria 9358192
334 2990061676 2990059506 Bacteria 9321252
335 2997604999 2997600082 Bacteria 9896405
336 3006326427 3006321560 Bacteria 8247479
337 3006491420 3006486233 Bacteria 8157040
338 3006498285 3006493962 Bacteria 8825450
339 8008566288 8008558824 Bacteria 10610750
340 8008578010 8008574985 Bacteria 7815457
341 8023630125 8023623736 Bacteria 8593882
342 8025418467 8025413630 Bacteria 7014048
343 8025482830 8025478263 Bacteria 8209203
344 8025538086 8025530807 Bacteria 8495698
345 8033689839 8033684223 Bacteria 6906479
346 8047897146 8047893842 Bacteria 11723082
347 8048133486 8048127548 Bacteria 11053136
348 8048361806 8048356638 Bacteria 11044339
349 8048374130 8048369669 Bacteria 11666822
350 8048384096 8048379754 Bacteria 11877923
351 8048409518 8048406513 Bacteria 8936924
352 8056452386 8056447290 Bacteria 7680491
353 8056669901 8056667051 Bacteria 6953971
354 8056833280 8056829672 Bacteria 9045328
355 JGI24735J21928_10028399
356 rootH1_10046175
357 rootL2_10041899
358 Ga0006562J51391_1051517
359 Ga0070665_100301219
360 Ga0068856_100136916
361 Ga0075363_100099121
362 Ga0075367_10095468
363 Ga0075370_10051037
364 Ga0105251_10017531
365 Ga0105243_10166315
366 Ga0105246_10027984
367 Ga0182008_10006311
368 Ga0182006_1016845
369 Ga0182007_10006346
370 Ga0183367_1015
371 Ga0209758_1003745
372 Ga0207426_1012273
373 Ga0207426_1018749
374 Ga0207426_1020821
375 Ga0207426_1029910
376 Ga0207647_10024246
377 Ga0207709_10084543
378 Ga0207702_10216521
379 Ga0307517_10033990
380 Ga0307515_10007000
381 Ga0307515_10223368
382 Ga0307511_10019620
383 Ga0307512_10036397
384 Ga0307513_10123873
385 Ga0307509_10033033
386 Ga0307509_10200981
387 Ga0307508_10012539
388 Ga0307508_10091994
389 Ga0307508_10135574
390 Ga0307516_10025490
391 Ga0307516_10077409
392 Ga0307516_10101330
393 Ga0307518_10188117
394 Ga0307507_10025944
395 Ga0307507_10084939
396 Ga0307507_10113402
397 Ga0307510_10063541
398 Ga0307510_10084620
399 Ga0307510_10135436
400 Ga0307510_10157654
401 Ga0307510_10167153
402 Ga0395898_0003292
403 Ga0395898_0185179
404 Ga0395898_0212924
405 Ga0395901_0261620
406 Ga0439436_0000544
407 Ga0439436_0013076
408 Ga0439439_0008345
409 Ga0439439_0009015
410 Ga0451853_1262046
411 Ga0451853_1799241
412 Ga0451853_3591302
413 Ga0439433_0009544
414 Ga0439449_0010026
415 Ga0439455_0012632
416 Ga0439457_000818
417 Ga0439457_001534
418 Ga0439462_0009840
419 Ga0450894_001082
420 Ga0450896_000796
421 Ga0450899_000527
422 Ga0450903_000006
423 Ga0450906_001712
424 Ga0439458_0006113
425 Ga0450908_008549
426 Ga0466969_0034510
427 Ga0466966_0006403
428 Ga0466966_0071109
429 Ga0466961_0016666
430 Ga0466963_0004602
431 Ga0466964_0003744
432 Ga0466971_0023236
433 Ga0466971_0052128
434 Ga0466968_0038770
435 Ga0466970_0002338
436 Ga0466970_0023461
437 Ga0466957_0011935
438 Ga0466959_0018118
439 Ga0466958_0012304
440 Ga0466967_0136376
441 Ga0495592_0020757
442 Ga0495603_0020107
443 Ga0495603_0025078
444 Ga0495603_0045982
445 Ga0495603_0112199
446 Ga0495629_0030444
447 Ga0495629_0057652
448 Ga0495629_0072850
449 Ga0495629_0135496
450 Ga0495629_0155386
451 Ga0495638_0068839
452 Ga0495638_0071863
453 Ga0495641_0143234
454 Ga0495651_0009262
455 Ga0495651_0095548
456 Ga0495653_0321048
457 Ga0495582_0168258
458 Ga0495605_0053672
459 Ga0495662_0003417
460 Ga0495662_0080537
461 Ga0495664_0003367
462 Ga0495585_0032412
463 Ga0495594_0011484
464 Ga0495583_0056825
465 Ga0495606_0012495
466 Ga0495618_0088370
467 Ga0495620_0030787
468 Ga0495620_0102677
469 Ga0495628_0151777
470 Ga0495631_0002894
471 Ga0495643_0003085
472 Ga0495643_0013633
473 Ga0495644_0063776
474 Ga0495648_0158945
475 Ga0495666_0143372
476 Ga0495652_0080859
477 Ga0495652_0150484
478 Ga0495640_0016190
479 Ga0495640_0109677
480 Ga0495640_0166188
481 Ga0495586_0037753
482 Ga0495587_0002915
483 Ga0495597_0041216
484 Ga0495645_0042369
485 Ga0495622_0020092
486 Ga0495633_0067008
487 Ga0495667_0155363
488 Ga0495668_0076829
489 Ga0495634_0078556
490 Ga0495634_0110548
491 Ga0495634_0172957
492 Ga0495625_0041187
493 Ga0495625_0075121
494 Ga0495625_0111635
495 Ga0495635_0139878
496 Ga0495635_0154081
497 Ga0495588_0097929
498 Ga0495657_0066673
499 Ga0495657_0116745
500 Ga0495657_0175074
501 Ga0495623_0154585
502 Ga0495646_0019606
503 Ga0495647_0066354
504 Ga0495658_0013726
505 Ga0495613_0003658
506 Ga0495613_0048783
507 Ga0495613_0051243
508 Ga0495613_0119562
509 Ga0495624_0131151
510 Ga0495670_0005831
511 Ga0495671_0013195
512 Ga0495649_0065124
513 Ga0495589_0017781
514 Ga0495589_0018865
515 Ga0495589_0020311
516 Ga0495589_0092589
517 Ga0495600_0102396
518 Ga0495600_0110984
519 Ga0495581_0008225
520 Ga0495604_0038827
521 Ga0495604_0066871
522 Ga0495604_0088945
523 Ga0495636_0005117
524 Ga0495636_0006877
525 Ga0495636_0032639
526 Ga0495636_0059865
527 Ga0495674_0031487
528 Ga0495676_0004929
529 Ga0495676_0025216
530 Ga0495676_0035650
531 Ga0495676_0083045
532 Ga0495676_0114814
533 Ga0495680_0170904
534 Ga0495683_0147271
535 Ga0495687_008351
536 Ga0495687_023534
537 Ga0495687_026947
538 Ga0495687_028477
539 Ga0495687_050546
540 Ga0495687_050710
541 Ga0495675_0030005
542 Ga0495685_007473
543 Ga0495685_020388
544 Ga0495681_0005684
545 Ga0495681_0009279
546 Ga0495681_0059553
547 Ga0495593_0014592
548 Ga0495593_0060569
549 Ga0495614_0015109
550 Ga0495614_0042893
551 Ga0501031_0023237
552 Ga0501031_0176253
553 Ga0501031_0185798
554 Ga0501032_0013638
555 Ga0501032_0123689
556 Ga0501033_0013276
557 Ga0501033_0018487
558 Ga0501033_0021782
559 Ga0501033_0065255
560 Ga0501034_0002096
561 Ga0501034_0011995
562 Ga0501034_0027746
563 Ga0501034_0146038
564 Ga0501034_0217430
565 Ga0501036_0000716
566 Ga0501036_0012244
567 Ga0501036_0025965
568 Ga0501037_0005867
569 Ga0501037_0015862
570 Ga0501037_0033458
571 Ga0501038_0007874
572 Ga0501038_0017371
573 Ga0501038_0040959
574 Ga0501038_0055151
575 Ga0501038_0096341
576 Ga0501038_0113836
577 Ga0501039_0019146
578 Ga0501039_0036413
579 Ga0501040_0052707
580 Ga0501041_0030349
581 Ga0501042_0024301
582 Ga0501042_0108686
583 Ga0501043_0032885
584 Ga0501043_0088087
585 Ga0501043_0095799
586 Ga0501043_0133271
587 Ga0501043_0134460
588 Ga0501043_0201849
589 Ga0501046_0043902
590 Ga0501046_0145888
591 Ga0501046_0163275
592 Ga0501047_0001043
593 Ga0501047_0009981
594 Ga0501047_0060664
595 Ga0501047_0213059
596 Ga0501048_0021075
597 Ga0501048_0155332
598 Ga0501048_0201688
599 Ga0501067_0015511
600 Ga0501068_0002784
601 Ga0501069_0015915
602 Ga0501070_0009705
603 Ga0501070_0024581
604 Ga0501071_0058167
605 Ga0501072_0035551
606 Ga0501073_0012236
607 Ga0501074_0030589
608 Ga0501074_0046742
609 Ga0501076_0053099
610 Ga0501077_0020154
611 Ga0501079_0049046
612 Ga0501080_0446717
613 Ga0501083_0033969
614 Ga0501035_0001231
615 Ga0501035_0012655
616 Ga0501035_0037420
617 Ga0501035_0065974
618 Ga0501035_0066644
619 Ga0501035_0222619
620 Ga0501044_0032944
621 Ga0501044_0038476
622 Ga0501044_0055774
623 Ga0501044_0060747
624 Ga0501045_0029047
625 Ga0501045_0230858
626 Ga0500640_044228
627 Ga0500660_047457
628 Ga0500553_050040
629 Ga0500569_022127
630 Ga0500572_008323
631 Ga0500561_0004410
632 Ga0500573_0074264
633 Ga0500600_0075313
634 Ga0500616_0070642
635 Ga0500624_002396
636 Ga0500587_004500
637 Ga0501084_0055899
638 Ga0466962_0003365
639 Ga0530510_0044657
640 2554256984
641 2547412969
642 2585305086
643 2585318258
644 2616701426
645 2643947697
646 2644266228
647 2644390122
648 2644435389
649 2644437645
650 2644627896
651 2784589470
652 2785342117
653 2785370542
654 2786671700
655 2793978150
656 2804845789
657 2808843100
658 2808921447
659 2809233134
660 2811845298
661 2812357020
662 2812479682
663 2852640115
664 2862286728
665 2862295212
666 2862510313
667 2862578379
668 2863411800
669 2867436291
670 2873154903
671 2877680080
672 2912718672
673 2912761924
674 2918504556
675 2919471516
676 2946068860
677 2946076900
678 2947228052
679 2954385011
680 2954677985
681 2954686172
682 2954695828
683 2954715237
684 2954736639
685 2954744110
686 2954755487
687 2954763052
688 2990061676
689 2997604999
690 3006326427
691 3006491420
692 3006498285
693 8008566288
694 8008578010
695 8023630125
696 8025418467
697 8025482830
698 8025538086
699 8033689839
700 8047897146
701 8048133486
702 8048361806
703 8048374130
704 8048384096
705 8048409518
706 8056452386
707 8056669901
708 8056833280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

1

279

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ev2-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with y-11 and atp 0.9338 3 330
7ent-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with y-13 and atp 0.9301 3 330
7ev3-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with y-10 and atp 0.9282 3 330
7el8-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase 0.9244 1 330
7ev2-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with y-11 and atp 0.9226 3 330
ID Description Score Start End Superfamily
3n9iB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9411 188 296 1.10.240.10
3u1vA02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9404 189 293 1.10.240.10
2ov4A02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9373 188 296 1.10.240.10
1i6lA02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9366 189 293 1.10.240.10
3fhjF02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9192 188 296 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A358M7I5-F1-model_v4 Tryptophan--tRNA ligase 0.9331 189 281 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A6B0D5T8-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9233 127 330 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A7Y1TWK6-F1-model_v4 Tryptophan--tRNA ligase 0.9198 161 330 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A2Z5TNW7-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9194 2 330 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A7W9PF89-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.916 1 331 GO:0004830
GO:0005524
GO:0005829
GO:0006436

Map