F419908

General Info

Members Datasets Scaffolds Average Seq Length
354 180 708 339

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0018574|Ga0501034_0018574_4153_5319
Length 388
Sequence MVSPLLYTLRVIEEVKIETKKLHKGVLPVQGTEICALTLFSHKQKHLSLPEVAIVILNYNGRKHMETFLPSVLASTYSNLRVIVADNASTDDSVAFLQQQYPGVELLTHPVNEGFAGGYNWALQRVKADYYVLLNSDVSVTPGWIEPVITLMESTPRLAACQPKLLSWKEPGCFEYAGASGGWIDSLGYPFSRGRVFDVCEEDRHQYDDIAPVFWASGAAMFVRAAVYHELGGLDTAFFAHQEEIDLCWRMQLAGYRIMCCPQSVVYHVGGGTLPRGGRKVFLNFRNNLIMLCKNLPWYEKIWKLPVRLALDAVSAWKGLLGGDTAFFTAIIRAHWAAVTWLVTKHYSRQHKRKPLSSLEGAYRGTVVWKYFVRKQTHFSEIVGNKRS

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
169 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
179 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
180 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 0.28
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0018574 3300049571 Bacteria 7127
2 JGI24740J21852_10021382 3300001979 Bacteria 2244
3 JGI24744J21845_10007822 3300002077 Bacteria 2208
4 JGI25406J46586_10013804 3300003203 Bacteria 3453
5 rootH2_10270715 3300003320 Bacteria 2978
6 JGI25160J50197_1001690 3300003354 Bacteria 10740
7 JGI25160J50197_1001795 3300003354 Bacteria 10369
8 Ga0065712_10115062 3300005290 Bacteria 1757
9 Ga0065712_10119619 3300005290 Bacteria 1689
10 Ga0065707_10176137 3300005295 Bacteria 1450
11 Ga0070676_10004950 3300005328 Bacteria 7053
12 Ga0070683_100034969 3300005329 Bacteria 4592
13 Ga0070683_100118653 3300005329 Bacteria 2498
14 Ga0070690_100213222 3300005330 Bacteria 1349
15 Ga0070670_100068796 3300005331 Bacteria 3039
16 Ga0070670_100125888 3300005331 Bacteria 2211
17 Ga0070670_100187008 3300005331 Bacteria 1798
18 Ga0070670_100252142 3300005331 Bacteria 1538
19 Ga0068869_100026904 3300005334 Bacteria 4006
20 Ga0068869_100178080 3300005334 Bacteria 1665
21 Ga0070666_10035175 3300005335 Bacteria 3321
22 Ga0070666_10036433 3300005335 Bacteria 3266
23 Ga0070666_10051689 3300005335 Bacteria 2768
24 Ga0070666_10218329 3300005335 Bacteria 1344
25 Ga0070680_100126133 3300005336 Bacteria 2139
26 Ga0070680_100253938 3300005336 Bacteria 1487
27 Ga0070682_100000054 3300005337 Bacteria 112635
28 Ga0068868_100004678 3300005338 Bacteria 9613
29 Ga0068868_100009727 3300005338 Bacteria 6935
30 Ga0068868_100030848 3300005338 Bacteria 4112
31 Ga0068868_100137315 3300005338 Bacteria 2005
32 Ga0070660_100007374 3300005339 Bacteria 7660
33 Ga0070689_100013179 3300005340 Bacteria 5976
34 Ga0070689_100018054 3300005340 Bacteria 5189
35 Ga0070689_100060310 3300005340 Bacteria 2949
36 Ga0070689_100070606 3300005340 Bacteria 2727
37 Ga0070687_100029232 3300005343 Bacteria 2681
38 Ga0070687_100091056 3300005343 Bacteria 1687
39 Ga0070661_100044780 3300005344 Bacteria 3233
40 Ga0070668_100035463 3300005347 Bacteria 3803
41 Ga0070668_100107505 3300005347 Bacteria 2218
42 Ga0070675_100024077 3300005354 Bacteria 4874
43 Ga0070675_100047105 3300005354 Bacteria 3532
44 Ga0070675_100110142 3300005354 Bacteria 2328
45 Ga0070675_100126298 3300005354 Bacteria 2176
46 Ga0070671_100099945 3300005355 Bacteria 2434
47 Ga0070671_100157584 3300005355 Bacteria 1918
48 Ga0070674_100077884 3300005356 Bacteria 2361
49 Ga0070674_100168726 3300005356 Bacteria 1667
50 Ga0070673_100025515 3300005364 Bacteria 4352
51 Ga0070673_100070380 3300005364 Bacteria 2807
52 Ga0070688_100038390 3300005365 Bacteria 2924
53 Ga0070688_100040916 3300005365 Bacteria 2842
54 Ga0070659_100001036 3300005366 Bacteria 20329
55 Ga0070667_100078942 3300005367 Bacteria 2813
56 Ga0070667_100107228 3300005367 Bacteria 2419
57 Ga0070667_100168620 3300005367 Bacteria 1932
58 Ga0070678_100027359 3300005456 Bacteria 3871
59 Ga0070662_100047161 3300005457 Bacteria 3098
60 Ga0070662_100157328 3300005457 Bacteria 1775
61 Ga0070662_100195757 3300005457 Bacteria 1601
62 Ga0070681_10059834 3300005458 Bacteria 3789
63 Ga0068867_100013229 3300005459 Bacteria 5846
64 Ga0068867_100052751 3300005459 Bacteria 3001
65 Ga0070685_10012514 3300005466 Bacteria 4460
66 Ga0070685_10030599 3300005466 Bacteria 3001
67 Ga0070685_10034471 3300005466 Bacteria 2851
68 Ga0070698_100000911 3300005471 Bacteria 32333
69 Ga0070698_100164782 3300005471 Bacteria 2159
70 Ga0070684_100001596 3300005535 Bacteria 16370
71 Ga0070697_100296995 3300005536 Bacteria 1388
72 Ga0068853_100052547 3300005539 Bacteria 3510
73 Ga0068853_100063804 3300005539 Bacteria 3191
74 Ga0068853_100130465 3300005539 Bacteria 2249
75 Ga0068853_100467492 3300005539 Bacteria 1188
76 Ga0070672_100009655 3300005543 Bacteria 6661
77 Ga0070672_100178478 3300005543 Unclassified 1769
78 Ga0070686_100014377 3300005544 Bacteria 4563
79 Ga0070686_100101391 3300005544 Bacteria 1946
80 Ga0070665_100020529 3300005548 Bacteria 6636
81 Ga0070664_100000795 3300005564 Bacteria 24308
82 Ga0070664_100084041 3300005564 Bacteria 2747
83 Ga0070664_100090473 3300005564 Bacteria 2648
84 Ga0068857_100000427 3300005577 Bacteria 29758
85 Ga0068857_100080676 3300005577 Bacteria 2905
86 Ga0068857_100115843 3300005577 Bacteria 2411
87 Ga0068857_100195331 3300005577 Bacteria 1844
88 Ga0068857_100367422 3300005577 Bacteria 1334
89 Ga0068854_100011756 3300005578 Bacteria 5714
90 Ga0068859_100009838 3300005617 Bacteria 9653
91 Ga0068859_100083355 3300005617 Bacteria 3240
92 Ga0068859_100132017 3300005617 Bacteria 2569
93 Ga0068859_100132609 3300005617 Bacteria 2563
94 Ga0068859_100196116 3300005617 Bacteria 2104
95 Ga0068864_100019919 3300005618 Bacteria 5608
96 Ga0068864_100103171 3300005618 Bacteria 2532
97 Ga0068864_100322793 3300005618 Bacteria 1450
98 Ga0068866_10011127 3300005718 Bacteria 3881
99 Ga0068866_10016807 3300005718 Bacteria 3278
100 Ga0068861_100010569 3300005719 Bacteria 6408
101 Ga0068851_10103441 3300005834 Bacteria 1513
102 Ga0068870_10010068 3300005840 Bacteria 4325
103 Ga0068870_10028567 3300005840 Bacteria 2801
104 Ga0068863_100067206 3300005841 Bacteria 3391
105 Ga0068863_100087123 3300005841 Bacteria 2959
106 Ga0068863_100118315 3300005841 Bacteria 2525
107 Ga0068863_100257845 3300005841 Bacteria 1685
108 Ga0068863_100302284 3300005841 Bacteria 1552
109 Ga0068858_100045952 3300005842 Bacteria 4048
110 Ga0068858_100068745 3300005842 Bacteria 3282
111 Ga0068862_100204156 3300005844 Unclassified 1783
112 Ga0081539_10000714 3300005985 Bacteria 66625
113 Ga0081539_10054781 3300005985 Bacteria 2223
114 Ga0097621_100035232 3300006237 Bacteria 3998
115 Ga0097621_100035622 3300006237 Bacteria 3978
116 Ga0097621_100284829 3300006237 Bacteria 1455
117 Ga0068871_100031930 3300006358 Bacteria 4155
118 Ga0068871_100045690 3300006358 Bacteria 3525
119 Ga0068871_100078996 3300006358 Bacteria 2721
120 Ga0068871_100128068 3300006358 Bacteria 2150
121 Ga0075428_100014010 3300006844 Bacteria 8926
122 Ga0075428_100107559 3300006844 Bacteria 3039
123 Ga0075430_100049356 3300006846 Bacteria 3552
124 Ga0075431_100009348 3300006847 Bacteria 9841
125 Ga0068865_100003822 3300006881 Bacteria 9036
126 Ga0068865_100177389 3300006881 Bacteria 1638
127 Ga0097620_100009838 3300006931 Bacteria 9653
128 Ga0097620_100083348 3300006931 Bacteria 3240
129 Ga0097620_100132018 3300006931 Bacteria 2569
130 Ga0097620_100132601 3300006931 Bacteria 2563
131 Ga0097620_100196121 3300006931 Bacteria 2104
132 Ga0105240_10000165 3300009093 Bacteria 134738
133 Ga0105240_10000289 3300009093 Bacteria 98095
134 Ga0105247_10094776 3300009101 Bacteria 1900
135 Ga0114129_10076932 3300009147 Bacteria 4644
136 Ga0105242_10014316 3300009176 Bacteria 6143
137 Ga0105242_10127640 3300009176 Bacteria 2191
138 Ga0105242_10247686 3300009176 Bacteria 1604
139 Ga0105237_10004022 3300009545 Bacteria 17178
140 Ga0105249_10004236 3300009553 Bacteria 12404
141 Ga0105249_10045221 3300009553 Bacteria 4004
142 Ga0105249_10156566 3300009553 Bacteria 2198
143 Ga0105249_10269625 3300009553 Bacteria 1695
144 Ga0105239_10009608 3300010375 Bacteria 10881
145 Ga0105246_10027278 3300011119 Bacteria 3741
146 Ga0105246_10226758 3300011119 Bacteria 1468
147 Ga0105246_10322803 3300011119 Bacteria 1255
148 Ga0157373_10050272 3300013100 Unclassified 2969
149 Ga0157373_10098814 3300013100 Bacteria 2054
150 Ga0157373_10109068 3300013100 Bacteria 1946
151 Ga0157371_10024954 3300013102 Bacteria 4362
152 Ga0157371_10120053 3300013102 Bacteria 1868
153 Ga0157371_10149943 3300013102 Bacteria 1663
154 Ga0157371_10177370 3300013102 Bacteria 1523
155 Ga0157371_10314585 3300013102 Bacteria 1135
156 Ga0157370_10337671 3300013104 Bacteria 1389
157 Ga0157369_10185258 3300013105 Bacteria 2189
158 Ga0157369_10320918 3300013105 Unclassified 1610
159 Ga0157374_10003940 3300013296 Bacteria 12472
160 Ga0157374_10054295 3300013296 Bacteria 3737
161 Ga0157374_10241584 3300013296 Bacteria 1776
162 Ga0157374_10470942 3300013296 Unclassified 1259
163 Ga0157378_10068733 3300013297 Bacteria 3177
164 Ga0157378_10330073 3300013297 Unclassified 1484
165 Ga0163162_10007851 3300013306 Bacteria 10397
166 Ga0163162_10009056 3300013306 Bacteria 9676
167 Ga0163162_10021314 3300013306 Bacteria 6380
168 Ga0163162_10370696 3300013306 Bacteria 1565
169 Ga0157372_10017263 3300013307 Bacteria 7748
170 Ga0157372_10090509 3300013307 Bacteria 3479
171 Ga0157372_10188862 3300013307 Bacteria 2386
172 Ga0157372_10196988 3300013307 Bacteria 2333
173 Ga0157372_10680868 3300013307 Bacteria 1197
174 Ga0157375_10042579 3300013308 Bacteria 4396
175 Ga0157375_10061205 3300013308 Bacteria 3737
176 Ga0157375_10152193 3300013308 Bacteria 2450
177 Ga0157375_10211684 3300013308 Bacteria 2096
178 Ga0157375_10261648 3300013308 Bacteria 1892
179 Ga0157375_10265411 3300013308 Bacteria 1878
180 Ga0163163_10005040 3300014325 Bacteria 11385
181 Ga0163163_10036240 3300014325 Bacteria 4791
182 Ga0163163_10067506 3300014325 Bacteria 3556
183 Ga0163163_10122054 3300014325 Unclassified 2640
184 Ga0157380_10059716 3300014326 Bacteria 3044
185 Ga0157380_10097319 3300014326 Bacteria 2442
186 Ga0157380_10340103 3300014326 Bacteria 1399
187 Ga0157377_10009262 3300014745 Bacteria 4824
188 Ga0157377_10047479 3300014745 Bacteria 2405
189 Ga0157377_10135246 3300014745 Bacteria 1510
190 Ga0157379_10015795 3300014968 Bacteria 6634
191 Ga0157379_10126538 3300014968 Bacteria 2299
192 Ga0157376_10009747 3300014969 Bacteria 6994
193 Ga0157376_10023076 3300014969 Bacteria 4863
194 Ga0157376_10181815 3300014969 Bacteria 1923
195 Ga0163161_10023683 3300017792 Bacteria 4333
196 Ga0163161_10025413 3300017792 Bacteria 4191
197 Ga0163161_10070421 3300017792 Bacteria 2557
198 Ga0163161_10118169 3300017792 Bacteria 1989
199 Ga0207426_1000132 3300025302 Bacteria 209623
200 Ga0207697_10016485 3300025315 Bacteria 3043
201 Ga0207682_10015305 3300025893 Bacteria 2985
202 Ga0207642_10065244 3300025899 Bacteria 1710
203 Ga0207680_10039875 3300025903 Bacteria 2728
204 Ga0207647_10022639 3300025904 Bacteria 4170
205 Ga0207647_10062158 3300025904 Bacteria 2276
206 Ga0207685_10047476 3300025905 Bacteria 1639
207 Ga0207645_10000394 3300025907 Bacteria 35984
208 Ga0207645_10070415 3300025907 Bacteria 2237
209 Ga0207643_10035516 3300025908 Bacteria 2795
210 Ga0207707_10051257 3300025912 Bacteria 3594
211 Ga0207695_10000027 3300025913 Bacteria 612456
212 Ga0207695_10000247 3300025913 Bacteria 140966
213 Ga0207657_10047179 3300025919 Bacteria 3769
214 Ga0207657_10063696 3300025919 Bacteria 3150
215 Ga0207649_10041505 3300025920 Bacteria 2800
216 Ga0207681_10032520 3300025923 Bacteria 3416
217 Ga0207681_10374349 3300025923 Bacteria 1145
218 Ga0207650_10043507 3300025925 Bacteria 3297
219 Ga0207650_10054894 3300025925 Bacteria 2956
220 Ga0207659_10048453 3300025926 Bacteria 3010
221 Ga0207659_10266493 3300025926 Bacteria 1396
222 Ga0207690_10004407 3300025932 Bacteria 8309
223 Ga0207690_10043693 3300025932 Bacteria 2950
224 Ga0207690_10049456 3300025932 Bacteria 2803
225 Ga0207706_10012755 3300025933 Bacteria 7649
226 Ga0207706_10061443 3300025933 Bacteria 3309
227 Ga0207706_10069848 3300025933 Bacteria 3089
228 Ga0207706_10092872 3300025933 Bacteria 2654
229 Ga0207706_10183342 3300025933 Bacteria 1838
230 Ga0207686_10000451 3300025934 Bacteria 27274
231 Ga0207686_10017880 3300025934 Bacteria 4003
232 Ga0207686_10064989 3300025934 Bacteria 2324
233 Ga0207686_10336815 3300025934 Bacteria 1132
234 Ga0207670_10011107 3300025936 Bacteria 5214
235 Ga0207670_10024781 3300025936 Bacteria 3755
236 Ga0207670_10028941 3300025936 Bacteria 3523
237 Ga0207670_10070614 3300025936 Bacteria 2413
238 Ga0207669_10234517 3300025937 Bacteria 1356
239 Ga0207691_10119004 3300025940 Bacteria 2343
240 Ga0207691_10145939 3300025940 Bacteria 2083
241 Ga0207691_10162629 3300025940 Bacteria 1958
242 Ga0207689_10011164 3300025942 Bacteria 7707
243 Ga0207689_10023331 3300025942 Bacteria 5194
244 Ga0207689_10029249 3300025942 Bacteria 4603
245 Ga0207689_10302711 3300025942 Bacteria 1325
246 Ga0207661_10057039 3300025944 Bacteria 3138
247 Ga0207661_10057368 3300025944 Bacteria 3131
248 Ga0207661_10435110 3300025944 Bacteria 1193
249 Ga0207679_10000247 3300025945 Bacteria 41238
250 Ga0207679_10017496 3300025945 Bacteria 4783
251 Ga0207651_10068475 3300025960 Bacteria 2502
252 Ga0207651_10072732 3300025960 Bacteria 2442
253 Ga0207651_10102246 3300025960 Bacteria 2130
254 Ga0207651_10243517 3300025960 Bacteria 1467
255 Ga0207712_10002286 3300025961 Bacteria 12445
256 Ga0207712_10152941 3300025961 Bacteria 1784
257 Ga0207712_10245637 3300025961 Unclassified 1444
258 Ga0207658_10066641 3300025986 Bacteria 2709
259 Ga0207658_10073979 3300025986 Bacteria 2588
260 Ga0207677_10006173 3300026023 Bacteria 6547
261 Ga0207677_10025644 3300026023 Bacteria 3681
262 Ga0207677_10088572 3300026023 Bacteria 2245
263 Ga0207677_10093050 3300026023 Bacteria 2196
264 Ga0207677_10130386 3300026023 Bacteria 1908
265 Ga0207703_10022105 3300026035 Bacteria 4985
266 Ga0207703_10123099 3300026035 Bacteria 2229
267 Ga0207639_10026670 3300026041 Bacteria 4199
268 Ga0207639_10083448 3300026041 Bacteria 2536
269 Ga0207678_10034218 3300026067 Bacteria 4425
270 Ga0207708_10098756 3300026075 Bacteria 2257
271 Ga0207641_10011263 3300026088 Bacteria 7335
272 Ga0207641_10031055 3300026088 Bacteria 4429
273 Ga0207648_10001319 3300026089 Bacteria 27586
274 Ga0207648_10032961 3300026089 Bacteria 4571
275 Ga0207648_10054145 3300026089 Bacteria 3505
276 Ga0207648_10065877 3300026089 Bacteria 3159
277 Ga0207648_10070037 3300026089 Bacteria 3057
278 Ga0207676_10053737 3300026095 Bacteria 3153
279 Ga0207676_10118727 3300026095 Bacteria 2226
280 Ga0207676_10138776 3300026095 Bacteria 2078
281 Ga0207674_10001291 3300026116 Bacteria 32707
282 Ga0207674_10008605 3300026116 Bacteria 11766
283 Ga0207674_10164331 3300026116 Bacteria 2174
284 Ga0207674_10167538 3300026116 Bacteria 2150
285 Ga0207675_100029404 3300026118 Bacteria 5120
286 Ga0207675_100030577 3300026118 Bacteria 5017
287 Ga0207675_100157546 3300026118 Bacteria 2164
288 Ga0207683_10000783 3300026121 Bacteria 28988
289 Ga0207683_10092128 3300026121 Bacteria 2701
290 Ga0207698_10221755 3300026142 Bacteria 1709
291 Ga0307515_10000001 3300028794 Bacteria 4259510
292 Ga0265327_10003794 3300031251 Bacteria 13994
293 Ga0265327_10031413 3300031251 Bacteria 2984
294 Ga0307405_10071465 3300031731 Bacteria 2233
295 Ga0307413_10007405 3300031824 Bacteria 5097
296 Ga0307412_10216215 3300031911 Bacteria 1466
297 Ga0307416_100020830 3300032002 Bacteria 4690
298 Ga0307415_100092583 3300032126 Bacteria 2192
299 Ga0373934_0038635 3300035086 Bacteria 1881
300 Ga0373955_0013189 3300035172 Bacteria 3988
301 Ga0373924_0041477 3300035410 Bacteria 1886
302 Ga0373937_0255306 3300036401 Bacteria 1652
303 Ga0395900_0023610 3300037418 Bacteria 6292
304 Ga0395905_0009439 3300037471 Bacteria 9532
305 Ga0439449_0003737 3300042007 Bacteria 5898
306 Ga0439457_016402 3300042014 Bacteria 1651
307 Ga0453684_0171941 3300044712 Bacteria 2552
308 Ga0466967_0137667 3300045976 Bacteria 2272
309 Ga0466967_0178087 3300045976 Bacteria 2004
310 Ga0495592_0070119 3300046454 Bacteria 2555
311 Ga0495629_0151647 3300046459 Bacteria 1611
312 Ga0495594_0021231 3300046499 Bacteria 3465
313 Ga0495667_0076113 3300046559 Unclassified 2183
314 Ga0495668_0000310 3300046616 Bacteria 67405
315 Ga0495634_0081707 3300046642 Bacteria 2113
316 Ga0495600_0066858 3300046809 Bacteria 2350
317 Ga0495674_0033248 3300047319 Bacteria 4673
318 Ga0495675_0154359 3300047444 Bacteria 1417
319 Ga0495684_0020250 3300047471 Bacteria 5125
320 Ga0495686_0015003 3300047472 Bacteria 5310
321 Ga0496110_0218408 3300048913 Bacteria 1733
322 Ga0501300_007642 3300049523 Bacteria 1585
323 Ga0501032_0002473 3300049569 Bacteria 14427
324 Ga0501033_0104009 3300049570 Bacteria 2070
325 Ga0501034_0000277 3300049571 Bacteria 92445
326 Ga0501034_0010052 3300049571 Bacteria 9881
327 Ga0501034_0020335 3300049571 Bacteria 6776
328 Ga0501034_0077202 3300049571 Bacteria 3336
329 Ga0501036_0021899 3300049572 Bacteria 5374
330 Ga0501037_0061717 3300049573 Bacteria 2734
331 Ga0501038_0021564 3300049574 Bacteria 5781
332 Ga0501046_0005489 3300049580 Bacteria 11327
333 Ga0501047_0024633 3300049581 Bacteria 5776
334 Ga0501048_0022708 3300049582 Bacteria 4586
335 Ga0501068_0146690 3300049584 Unclassified 1481
336 Ga0501070_0068163 3300049586 Bacteria 2946
337 Ga0501072_0092273 3300049588 Bacteria 2405
338 Ga0501074_0013934 3300049590 Bacteria 5843
339 Ga0501223_000940 3300049663 Bacteria 6876
340 Ga0501224_012494 3300049664 Bacteria 1251
341 Ga0501235_011432 3300049669 Bacteria 1948
342 Ga0501080_0176156 3300049742 Bacteria 1970
343 Ga0501083_0027836 3300049744 Bacteria 3898
344 Ga0501266_003405 3300049763 Bacteria 1979
345 Ga0501266_009089 3300049763 Bacteria 1255
346 Ga0501268_003124 3300049765 Unclassified 2243
347 Ga0501044_0028957 3300049823 Bacteria 5842
348 Ga0501044_0034741 3300049823 Bacteria 5285
349 nmdc:mga05p37_21088_c1 3300050507 Bacteria 7886
350 nmdc:mga09592_44523_c1 3300050508 Bacteria 3737
351 nmdc:mga06r32_59366_c1 3300050510 Bacteria 3678
352 Ga0500646_0002430 3300053090 Bacteria 4844
353 2740033208 2739367866 Bacteria 4215900
354 2839991147 2839989709 Bacteria 3773432
355 Ga0501034_0018574
356 JGI24740J21852_10021382
357 JGI24744J21845_10007822
358 JGI25406J46586_10013804
359 rootH2_10270715
360 JGI25160J50197_1001690
361 JGI25160J50197_1001795
362 Ga0065712_10115062
363 Ga0065712_10119619
364 Ga0065707_10176137
365 Ga0070676_10004950
366 Ga0070683_100034969
367 Ga0070683_100118653
368 Ga0070690_100213222
369 Ga0070670_100068796
370 Ga0070670_100125888
371 Ga0070670_100187008
372 Ga0070670_100252142
373 Ga0068869_100026904
374 Ga0068869_100178080
375 Ga0070666_10035175
376 Ga0070666_10036433
377 Ga0070666_10051689
378 Ga0070666_10218329
379 Ga0070680_100126133
380 Ga0070680_100253938
381 Ga0070682_100000054
382 Ga0068868_100004678
383 Ga0068868_100009727
384 Ga0068868_100030848
385 Ga0068868_100137315
386 Ga0070660_100007374
387 Ga0070689_100013179
388 Ga0070689_100018054
389 Ga0070689_100060310
390 Ga0070689_100070606
391 Ga0070687_100029232
392 Ga0070687_100091056
393 Ga0070661_100044780
394 Ga0070668_100035463
395 Ga0070668_100107505
396 Ga0070675_100024077
397 Ga0070675_100047105
398 Ga0070675_100110142
399 Ga0070675_100126298
400 Ga0070671_100099945
401 Ga0070671_100157584
402 Ga0070674_100077884
403 Ga0070674_100168726
404 Ga0070673_100025515
405 Ga0070673_100070380
406 Ga0070688_100038390
407 Ga0070688_100040916
408 Ga0070659_100001036
409 Ga0070667_100078942
410 Ga0070667_100107228
411 Ga0070667_100168620
412 Ga0070678_100027359
413 Ga0070662_100047161
414 Ga0070662_100157328
415 Ga0070662_100195757
416 Ga0070681_10059834
417 Ga0068867_100013229
418 Ga0068867_100052751
419 Ga0070685_10012514
420 Ga0070685_10030599
421 Ga0070685_10034471
422 Ga0070698_100000911
423 Ga0070698_100164782
424 Ga0070684_100001596
425 Ga0070697_100296995
426 Ga0068853_100052547
427 Ga0068853_100063804
428 Ga0068853_100130465
429 Ga0068853_100467492
430 Ga0070672_100009655
431 Ga0070672_100178478
432 Ga0070686_100014377
433 Ga0070686_100101391
434 Ga0070665_100020529
435 Ga0070664_100000795
436 Ga0070664_100084041
437 Ga0070664_100090473
438 Ga0068857_100000427
439 Ga0068857_100080676
440 Ga0068857_100115843
441 Ga0068857_100195331
442 Ga0068857_100367422
443 Ga0068854_100011756
444 Ga0068859_100009838
445 Ga0068859_100083355
446 Ga0068859_100132017
447 Ga0068859_100132609
448 Ga0068859_100196116
449 Ga0068864_100019919
450 Ga0068864_100103171
451 Ga0068864_100322793
452 Ga0068866_10011127
453 Ga0068866_10016807
454 Ga0068861_100010569
455 Ga0068851_10103441
456 Ga0068870_10010068
457 Ga0068870_10028567
458 Ga0068863_100067206
459 Ga0068863_100087123
460 Ga0068863_100118315
461 Ga0068863_100257845
462 Ga0068863_100302284
463 Ga0068858_100045952
464 Ga0068858_100068745
465 Ga0068862_100204156
466 Ga0081539_10000714
467 Ga0081539_10054781
468 Ga0097621_100035232
469 Ga0097621_100035622
470 Ga0097621_100284829
471 Ga0068871_100031930
472 Ga0068871_100045690
473 Ga0068871_100078996
474 Ga0068871_100128068
475 Ga0075428_100014010
476 Ga0075428_100107559
477 Ga0075430_100049356
478 Ga0075431_100009348
479 Ga0068865_100003822
480 Ga0068865_100177389
481 Ga0097620_100009838
482 Ga0097620_100083348
483 Ga0097620_100132018
484 Ga0097620_100132601
485 Ga0097620_100196121
486 Ga0105240_10000165
487 Ga0105240_10000289
488 Ga0105247_10094776
489 Ga0114129_10076932
490 Ga0105242_10014316
491 Ga0105242_10127640
492 Ga0105242_10247686
493 Ga0105237_10004022
494 Ga0105249_10004236
495 Ga0105249_10045221
496 Ga0105249_10156566
497 Ga0105249_10269625
498 Ga0105239_10009608
499 Ga0105246_10027278
500 Ga0105246_10226758
501 Ga0105246_10322803
502 Ga0157373_10050272
503 Ga0157373_10098814
504 Ga0157373_10109068
505 Ga0157371_10024954
506 Ga0157371_10120053
507 Ga0157371_10149943
508 Ga0157371_10177370
509 Ga0157371_10314585
510 Ga0157370_10337671
511 Ga0157369_10185258
512 Ga0157369_10320918
513 Ga0157374_10003940
514 Ga0157374_10054295
515 Ga0157374_10241584
516 Ga0157374_10470942
517 Ga0157378_10068733
518 Ga0157378_10330073
519 Ga0163162_10007851
520 Ga0163162_10009056
521 Ga0163162_10021314
522 Ga0163162_10370696
523 Ga0157372_10017263
524 Ga0157372_10090509
525 Ga0157372_10188862
526 Ga0157372_10196988
527 Ga0157372_10680868
528 Ga0157375_10042579
529 Ga0157375_10061205
530 Ga0157375_10152193
531 Ga0157375_10211684
532 Ga0157375_10261648
533 Ga0157375_10265411
534 Ga0163163_10005040
535 Ga0163163_10036240
536 Ga0163163_10067506
537 Ga0163163_10122054
538 Ga0157380_10059716
539 Ga0157380_10097319
540 Ga0157380_10340103
541 Ga0157377_10009262
542 Ga0157377_10047479
543 Ga0157377_10135246
544 Ga0157379_10015795
545 Ga0157379_10126538
546 Ga0157376_10009747
547 Ga0157376_10023076
548 Ga0157376_10181815
549 Ga0163161_10023683
550 Ga0163161_10025413
551 Ga0163161_10070421
552 Ga0163161_10118169
553 Ga0207426_1000132
554 Ga0207697_10016485
555 Ga0207682_10015305
556 Ga0207642_10065244
557 Ga0207680_10039875
558 Ga0207647_10022639
559 Ga0207647_10062158
560 Ga0207685_10047476
561 Ga0207645_10000394
562 Ga0207645_10070415
563 Ga0207643_10035516
564 Ga0207707_10051257
565 Ga0207695_10000027
566 Ga0207695_10000247
567 Ga0207657_10047179
568 Ga0207657_10063696
569 Ga0207649_10041505
570 Ga0207681_10032520
571 Ga0207681_10374349
572 Ga0207650_10043507
573 Ga0207650_10054894
574 Ga0207659_10048453
575 Ga0207659_10266493
576 Ga0207690_10004407
577 Ga0207690_10043693
578 Ga0207690_10049456
579 Ga0207706_10012755
580 Ga0207706_10061443
581 Ga0207706_10069848
582 Ga0207706_10092872
583 Ga0207706_10183342
584 Ga0207686_10000451
585 Ga0207686_10017880
586 Ga0207686_10064989
587 Ga0207686_10336815
588 Ga0207670_10011107
589 Ga0207670_10024781
590 Ga0207670_10028941
591 Ga0207670_10070614
592 Ga0207669_10234517
593 Ga0207691_10119004
594 Ga0207691_10145939
595 Ga0207691_10162629
596 Ga0207689_10011164
597 Ga0207689_10023331
598 Ga0207689_10029249
599 Ga0207689_10302711
600 Ga0207661_10057039
601 Ga0207661_10057368
602 Ga0207661_10435110
603 Ga0207679_10000247
604 Ga0207679_10017496
605 Ga0207651_10068475
606 Ga0207651_10072732
607 Ga0207651_10102246
608 Ga0207651_10243517
609 Ga0207712_10002286
610 Ga0207712_10152941
611 Ga0207712_10245637
612 Ga0207658_10066641
613 Ga0207658_10073979
614 Ga0207677_10006173
615 Ga0207677_10025644
616 Ga0207677_10088572
617 Ga0207677_10093050
618 Ga0207677_10130386
619 Ga0207703_10022105
620 Ga0207703_10123099
621 Ga0207639_10026670
622 Ga0207639_10083448
623 Ga0207678_10034218
624 Ga0207708_10098756
625 Ga0207641_10011263
626 Ga0207641_10031055
627 Ga0207648_10001319
628 Ga0207648_10032961
629 Ga0207648_10054145
630 Ga0207648_10065877
631 Ga0207648_10070037
632 Ga0207676_10053737
633 Ga0207676_10118727
634 Ga0207676_10138776
635 Ga0207674_10001291
636 Ga0207674_10008605
637 Ga0207674_10164331
638 Ga0207674_10167538
639 Ga0207675_100029404
640 Ga0207675_100030577
641 Ga0207675_100157546
642 Ga0207683_10000783
643 Ga0207683_10092128
644 Ga0207698_10221755
645 Ga0307515_10000001
646 Ga0265327_10003794
647 Ga0265327_10031413
648 Ga0307405_10071465
649 Ga0307413_10007405
650 Ga0307412_10216215
651 Ga0307416_100020830
652 Ga0307415_100092583
653 Ga0373934_0038635
654 Ga0373955_0013189
655 Ga0373924_0041477
656 Ga0373937_0255306
657 Ga0395900_0023610
658 Ga0395905_0009439
659 Ga0439449_0003737
660 Ga0439457_016402
661 Ga0453684_0171941
662 Ga0466967_0137667
663 Ga0466967_0178087
664 Ga0495592_0070119
665 Ga0495629_0151647
666 Ga0495594_0021231
667 Ga0495667_0076113
668 Ga0495668_0000310
669 Ga0495634_0081707
670 Ga0495600_0066858
671 Ga0495674_0033248
672 Ga0495675_0154359
673 Ga0495684_0020250
674 Ga0495686_0015003
675 Ga0496110_0218408
676 Ga0501300_007642
677 Ga0501032_0002473
678 Ga0501033_0104009
679 Ga0501034_0000277
680 Ga0501034_0010052
681 Ga0501034_0020335
682 Ga0501034_0077202
683 Ga0501036_0021899
684 Ga0501037_0061717
685 Ga0501038_0021564
686 Ga0501046_0005489
687 Ga0501047_0024633
688 Ga0501048_0022708
689 Ga0501068_0146690
690 Ga0501070_0068163
691 Ga0501072_0092273
692 Ga0501074_0013934
693 Ga0501223_000940
694 Ga0501224_012494
695 Ga0501235_011432
696 Ga0501080_0176156
697 Ga0501083_0027836
698 Ga0501266_003405
699 Ga0501266_009089
700 Ga0501268_003124
701 Ga0501044_0028957
702 Ga0501044_0034741
703 nmdc:mga05p37_21088_c1
704 nmdc:mga09592_44523_c1
705 nmdc:mga06r32_59366_c1
706 Ga0500646_0002430
707 2740033208
708 2839991147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

53

171

0.96

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

50

284

0.85

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

130

345

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8148 2 221
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8135 2 221
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8017 2 221
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7991 2 221
4d11-assembly4.cif.gz_F galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) 0.7683 1 222
ID Description Score Start End Superfamily
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8619 3 110 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8006 1 228 3.90.550.10
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7938 2 227 3.90.550.10
af_A0A096MIV6_83_419_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7894 2 247 3.90.550.10
af_P9WMX3_2_220_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7856 5 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2E4L2L8-F1-model_v4 Glycosyl hydrolase 0.9693 3 109 GO:0016787
AF-A0A7C2YIV5-F1-model_v4 Glycosyltransferase family 2 protein 0.9493 1 334 GO:0016740
AF-A0A660LNY2-F1-model_v4 deleted 0.9405 6 295
AF-X1L7R2-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9381 5 162
AF-A0A6S6RSF9-F1-model_v4 Glycosyltransferase 0.938 2 338 GO:0016740

Map