F419906
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 354 | 209 | 310 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0010186|Ga0501033_0010186_1692_2717 |
| Length | 306 |
| Sequence | MSDATRAVAAGTEPAGVQEPPSAASLETVLSLRDATLGFADRTLWSGLDLNVHGGEFIAVLGANGSGKTSLLRVILGQQKLVSGSIDFLGEPVTRGNRRIGYVPQQRLADEGTPLRARDLVGLGLDGHRWGVPWPSRRRRERIDGLLDAVGAVPYGSVPIATLSGGEQQRLRVGQALAGDPRLLLCDEPLLSLDLAHQRAVSELIDRQRRERQLGVLFVTHDVNPVLDLVDRVLYLAGGKFRIGTPDQVLRSEVLSELYDAPVDVIRTRGRIVVVGTADAPGAHPDGLHAHHDTMPGAATGGSSER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 5 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 6 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 7 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 8 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 9 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 10 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 11 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 12 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 13 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 14 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 15 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 16 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 17 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 18 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 19 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 20 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 21 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 22 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 23 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 24 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 25 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 26 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 27 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 28 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 29 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 30 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 31 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 32 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 33 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 34 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 35 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 36 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 37 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 38 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 39 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 40 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 41 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 42 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 44 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 127 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 130 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 135 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 136 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 157 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 158 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 159 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 160 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 161 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 162 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 163 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 166 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 167 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 195 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 196 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 197 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 198 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 199 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 200 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 201 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 202 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 203 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 204 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 205 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 206 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 207 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 208 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 209 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.16 |
| Metatranscriptomes | 1.41 |
| Isolates | 12.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.56 |
| Bulb | 0 |
| Endosphere | 14.41 |
| Nodule | 0 |
| Rhizoplane | 3.95 |
| Rhizosphere | 58.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10004858 | 3300002067 | Bacteria | 4481 |
| 2 | JGI25164J39214_1000397 | 3300002772 | Bacteria | 25332 |
| 3 | JGI25165J46597_1000005 | 3300003214 | Bacteria | 623702 |
| 4 | rootL2_10062257 | 3300003322 | Bacteria | 1750 |
| 5 | Ga0006562J51391_1006080 | 3300003578 | Bacteria | 11098 |
| 6 | Ga0006562J51391_1006082 | 3300003578 | Bacteria | 4290 |
| 7 | Ga0055539_1000014 | 3300003752 | Bacteria | 381086 |
| 8 | Ga0055533_1000002 | 3300003756 | Bacteria | 1196393 |
| 9 | Ga0055525_1000421 | 3300003759 | Bacteria | 25425 |
| 10 | Ga0055525_1001814 | 3300003759 | Bacteria | 2942 |
| 11 | Ga0055527_1000004 | 3300003760 | Bacteria | 570634 |
| 12 | Ga0055542_1000019 | 3300003762 | Bacteria | 341174 |
| 13 | Ga0055529_1000008 | 3300003763 | Bacteria | 394786 |
| 14 | Ga0070658_10000298 | 3300005327 | Bacteria | 43158 |
| 15 | Ga0070658_10035237 | 3300005327 | Bacteria | 4031 |
| 16 | Ga0070658_10039424 | 3300005327 | Bacteria | 3811 |
| 17 | Ga0070658_10055107 | 3300005327 | Bacteria | 3230 |
| 18 | Ga0070690_100045890 | 3300005330 | Bacteria | 2777 |
| 19 | Ga0070682_100044876 | 3300005337 | Bacteria | 2738 |
| 20 | Ga0070682_100083837 | 3300005337 | Bacteria | 2070 |
| 21 | Ga0068868_100377852 | 3300005338 | Bacteria | 1218 |
| 22 | Ga0070660_100042247 | 3300005339 | Bacteria | 3479 |
| 23 | Ga0070660_100413854 | 3300005339 | Bacteria | 1116 |
| 24 | Ga0070661_100103383 | 3300005344 | Bacteria | 2121 |
| 25 | Ga0070659_100000783 | 3300005366 | Bacteria | 23117 |
| 26 | Ga0070659_100062048 | 3300005366 | Bacteria | 2954 |
| 27 | Ga0070667_100032534 | 3300005367 | Bacteria | 4350 |
| 28 | Ga0070714_100005110 | 3300005435 | Bacteria | 9981 |
| 29 | Ga0070713_100624238 | 3300005436 | Bacteria | 1025 |
| 30 | Ga0070685_10012833 | 3300005466 | Bacteria | 4409 |
| 31 | Ga0068853_100011464 | 3300005539 | Bacteria | 7205 |
| 32 | Ga0068853_100108666 | 3300005539 | Bacteria | 2461 |
| 33 | Ga0070672_100129148 | 3300005543 | Bacteria | 2076 |
| 34 | Ga0068855_100010920 | 3300005563 | Bacteria | 10962 |
| 35 | Ga0068855_100182336 | 3300005563 | Bacteria | 2373 |
| 36 | Ga0068857_100010949 | 3300005577 | Bacteria | 7893 |
| 37 | Ga0068854_100299106 | 3300005578 | Bacteria | 1301 |
| 38 | Ga0068852_100106792 | 3300005616 | Bacteria | 2539 |
| 39 | Ga0068852_100107538 | 3300005616 | Bacteria | 2530 |
| 40 | Ga0068859_100071413 | 3300005617 | Bacteria | 3508 |
| 41 | Ga0068858_100000867 | 3300005842 | Bacteria | 31292 |
| 42 | Ga0075365_10002458 | 3300006038 | Bacteria | 9098 |
| 43 | Ga0075365_10005786 | 3300006038 | Bacteria | 6715 |
| 44 | Ga0075369_10022083 | 3300006186 | Bacteria | 2623 |
| 45 | Ga0097620_100071411 | 3300006931 | Bacteria | 3508 |
| 46 | Ga0105244_10035749 | 3300009036 | Bacteria | 2608 |
| 47 | Ga0105240_10011822 | 3300009093 | Bacteria | 12121 |
| 48 | Ga0105240_10292597 | 3300009093 | Bacteria | 1866 |
| 49 | Ga0105245_10004196 | 3300009098 | Bacteria | 12794 |
| 50 | Ga0105247_10013352 | 3300009101 | Bacteria | 4930 |
| 51 | Ga0105243_10080277 | 3300009148 | Bacteria | 2660 |
| 52 | Ga0105241_10002520 | 3300009174 | Bacteria | 13742 |
| 53 | Ga0105248_10007269 | 3300009177 | Bacteria | 12148 |
| 54 | Ga0105237_10100332 | 3300009545 | Bacteria | 2886 |
| 55 | Ga0105237_10100854 | 3300009545 | Bacteria | 2879 |
| 56 | Ga0105238_10136855 | 3300009551 | Bacteria | 2427 |
| 57 | Ga0157371_10086687 | 3300013102 | Bacteria | 2217 |
| 58 | Ga0157370_10097567 | 3300013104 | Bacteria | 2757 |
| 59 | Ga0157369_10026412 | 3300013105 | Bacteria | 6440 |
| 60 | Ga0157369_10084741 | 3300013105 | Bacteria | 3387 |
| 61 | Ga0157369_10240299 | 3300013105 | Bacteria | 1892 |
| 62 | Ga0157369_10399219 | 3300013105 | Bacteria | 1426 |
| 63 | Ga0157374_10582799 | 3300013296 | Bacteria | 1128 |
| 64 | Ga0157372_10577232 | 3300013307 | Bacteria | 1310 |
| 65 | Ga0157379_10019290 | 3300014968 | Bacteria | 6022 |
| 66 | Ga0206354_10047148 | 3300020081 | Bacteria | 5041 |
| 67 | Ga0206353_10036517 | 3300020082 | Bacteria | 7349 |
| 68 | Ga0206353_11454628 | 3300020082 | Bacteria | 1761 |
| 69 | Ga0209566_100056 | 3300025225 | Bacteria | 209595 |
| 70 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 71 | Ga0209672_100011 | 3300025228 | Bacteria | 856297 |
| 72 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 73 | Ga0209563_100335 | 3300025230 | Bacteria | 18136 |
| 74 | Ga0207427_100024 | 3300025231 | Bacteria | 438403 |
| 75 | Ga0209437_100243 | 3300025233 | Bacteria | 88712 |
| 76 | Ga0209258_102049 | 3300025242 | Bacteria | 5744 |
| 77 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 78 | Ga0209677_101216 | 3300025253 | Bacteria | 11724 |
| 79 | Ga0209148_1000023 | 3300025254 | Bacteria | 680511 |
| 80 | Ga0209148_1000931 | 3300025254 | Bacteria | 19265 |
| 81 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 82 | Ga0209455_1000023 | 3300025272 | Bacteria | 680449 |
| 83 | Ga0209455_1000565 | 3300025272 | Bacteria | 24721 |
| 84 | Ga0207655_1004351 | 3300025728 | Bacteria | 10076 |
| 85 | Ga0207655_1024450 | 3300025728 | Bacteria | 2960 |
| 86 | Ga0207647_10004822 | 3300025904 | Bacteria | 9977 |
| 87 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 88 | Ga0207705_10166882 | 3300025909 | Bacteria | 1656 |
| 89 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 90 | Ga0207695_10001965 | 3300025913 | Bacteria | 31843 |
| 91 | Ga0207695_10114224 | 3300025913 | Bacteria | 2676 |
| 92 | Ga0207695_10383851 | 3300025913 | Bacteria | 1290 |
| 93 | Ga0207671_10082894 | 3300025914 | Bacteria | 2407 |
| 94 | Ga0207671_10128664 | 3300025914 | Bacteria | 1942 |
| 95 | Ga0207657_10096560 | 3300025919 | Bacteria | 2458 |
| 96 | Ga0207694_10080900 | 3300025924 | Bacteria | 2550 |
| 97 | Ga0207687_10018338 | 3300025927 | Bacteria | 4617 |
| 98 | Ga0207700_10020137 | 3300025928 | Bacteria | 4523 |
| 99 | Ga0207664_10002066 | 3300025929 | Bacteria | 13221 |
| 100 | Ga0207690_10000713 | 3300025932 | Bacteria | 21429 |
| 101 | Ga0207709_10004264 | 3300025935 | Bacteria | 8279 |
| 102 | Ga0207691_10320742 | 3300025940 | Bacteria | 1328 |
| 103 | Ga0207711_10012169 | 3300025941 | Bacteria | 7152 |
| 104 | Ga0207711_10183693 | 3300025941 | Bacteria | 1903 |
| 105 | Ga0207667_10003872 | 3300025949 | Bacteria | 18418 |
| 106 | Ga0207667_10020205 | 3300025949 | Bacteria | 7412 |
| 107 | Ga0207667_10029884 | 3300025949 | Bacteria | 5903 |
| 108 | Ga0207658_10032533 | 3300025986 | Bacteria | 3712 |
| 109 | Ga0207703_10000121 | 3300026035 | Bacteria | 94523 |
| 110 | Ga0207639_10025875 | 3300026041 | Bacteria | 4259 |
| 111 | Ga0207639_10106852 | 3300026041 | Bacteria | 2273 |
| 112 | Ga0207678_10019846 | 3300026067 | Bacteria | 5908 |
| 113 | Ga0207702_10094742 | 3300026078 | Bacteria | 2621 |
| 114 | Ga0207702_10259014 | 3300026078 | Bacteria | 1637 |
| 115 | Ga0207702_10321066 | 3300026078 | Bacteria | 1475 |
| 116 | Ga0207674_10004042 | 3300026116 | Bacteria | 17798 |
| 117 | Ga0207698_10005350 | 3300026142 | Bacteria | 7916 |
| 118 | Ga0207698_10058374 | 3300026142 | Bacteria | 2990 |
| 119 | Ga0307513_10025493 | 3300031456 | Bacteria | 6848 |
| 120 | Ga0307514_10126020 | 3300031649 | Bacteria | 1774 |
| 121 | Ga0307518_10177682 | 3300031838 | Bacteria | 1443 |
| 122 | Ga0307416_100126040 | 3300032002 | Bacteria | 2294 |
| 123 | Ga0307507_10005233 | 3300033179 | Bacteria | 21590 |
| 124 | Ga0395899_0013247 | 3300037312 | Bacteria | 6310 |
| 125 | Ga0395899_0025711 | 3300037312 | Bacteria | 4444 |
| 126 | Ga0395900_0001470 | 3300037418 | Bacteria | 28112 |
| 127 | Ga0395900_0053053 | 3300037418 | Bacteria | 4173 |
| 128 | Ga0395898_0000355 | 3300037466 | Bacteria | 101003 |
| 129 | Ga0395898_0610244 | 3300037466 | Bacteria | 1034 |
| 130 | Ga0395901_0299355 | 3300038443 | Bacteria | 1668 |
| 131 | Ga0439465_0032346 | 3300041413 | Bacteria | 1670 |
| 132 | Ga0451791_1705021 | 3300041451 | Bacteria | 1537 |
| 133 | Ga0439462_0005836 | 3300042015 | Bacteria | 3047 |
| 134 | Ga0466965_0000004 | 3300044683 | Bacteria | 229348 |
| 135 | Ga0466965_0154196 | 3300044683 | Bacteria | 1202 |
| 136 | Ga0466961_0010348 | 3300044693 | Bacteria | 5948 |
| 137 | Ga0466961_0148193 | 3300044693 | Bacteria | 1466 |
| 138 | Ga0466961_0181630 | 3300044693 | Bacteria | 1306 |
| 139 | Ga0466961_0182917 | 3300044693 | Bacteria | 1301 |
| 140 | Ga0466963_0304781 | 3300044694 | Bacteria | 1121 |
| 141 | Ga0466970_0038464 | 3300044765 | Bacteria | 2537 |
| 142 | Ga0466970_0073000 | 3300044765 | Bacteria | 1846 |
| 143 | Ga0466970_0099695 | 3300044765 | Bacteria | 1581 |
| 144 | Ga0466957_0037964 | 3300044842 | Bacteria | 2901 |
| 145 | Ga0466957_0050230 | 3300044842 | Bacteria | 2538 |
| 146 | Ga0466960_0247307 | 3300044901 | Bacteria | 989 |
| 147 | Ga0466959_0052709 | 3300045049 | Bacteria | 2978 |
| 148 | Ga0466959_0223406 | 3300045049 | Bacteria | 1305 |
| 149 | Ga0466967_0506050 | 3300045976 | Bacteria | 1186 |
| 150 | Ga0495590_0000091 | 3300046457 | Bacteria | 55288 |
| 151 | Ga0495650_0000211 | 3300046471 | Bacteria | 125248 |
| 152 | Ga0495672_0022559 | 3300047320 | Bacteria | 4090 |
| 153 | Ga0495672_0063499 | 3300047320 | Bacteria | 2119 |
| 154 | Ga0496100_0143344 | 3300048903 | Bacteria | 1696 |
| 155 | Ga0496102_0029611 | 3300048905 | Bacteria | 4900 |
| 156 | Ga0496102_0613063 | 3300048905 | Bacteria | 1011 |
| 157 | Ga0496103_0007844 | 3300048906 | Bacteria | 6345 |
| 158 | Ga0496104_0047744 | 3300048907 | Bacteria | 4036 |
| 159 | Ga0496104_0204064 | 3300048907 | Bacteria | 1888 |
| 160 | Ga0496105_0066260 | 3300048908 | Bacteria | 2981 |
| 161 | Ga0496107_0086229 | 3300048910 | Bacteria | 2292 |
| 162 | Ga0496114_0036324 | 3300048917 | Bacteria | 4072 |
| 163 | Ga0496114_0080296 | 3300048917 | Bacteria | 2754 |
| 164 | Ga0496115_0028473 | 3300048918 | Bacteria | 4379 |
| 165 | Ga0496115_0124841 | 3300048918 | Bacteria | 2120 |
| 166 | Ga0496115_0174848 | 3300048918 | Bacteria | 1775 |
| 167 | Ga0496116_0098782 | 3300048919 | Bacteria | 1750 |
| 168 | Ga0496117_0000174 | 3300048920 | Bacteria | 132648 |
| 169 | Ga0496117_0000964 | 3300048920 | Bacteria | 44066 |
| 170 | Ga0496117_0000988 | 3300048920 | Bacteria | 43571 |
| 171 | Ga0496117_0010998 | 3300048920 | Bacteria | 8147 |
| 172 | Ga0496117_0011054 | 3300048920 | Bacteria | 8128 |
| 173 | Ga0496117_0032545 | 3300048920 | Bacteria | 3960 |
| 174 | Ga0496117_0052738 | 3300048920 | Bacteria | 2862 |
| 175 | Ga0496117_0110585 | 3300048920 | Bacteria | 1712 |
| 176 | Ga0496117_0166409 | 3300048920 | Bacteria | 1285 |
| 177 | Ga0496118_0001023 | 3300048921 | Bacteria | 43511 |
| 178 | Ga0496118_0012972 | 3300048921 | Bacteria | 7934 |
| 179 | Ga0496118_0028229 | 3300048921 | Bacteria | 4732 |
| 180 | Ga0496118_0036785 | 3300048921 | Bacteria | 3951 |
| 181 | Ga0496118_0037274 | 3300048921 | Bacteria | 3917 |
| 182 | Ga0496118_0046371 | 3300048921 | Bacteria | 3382 |
| 183 | Ga0496119_0001425 | 3300048922 | Bacteria | 28914 |
| 184 | Ga0496119_0004747 | 3300048922 | Bacteria | 13353 |
| 185 | Ga0496119_0005538 | 3300048922 | Bacteria | 12031 |
| 186 | Ga0496119_0005866 | 3300048922 | Bacteria | 11594 |
| 187 | Ga0496119_0016295 | 3300048922 | Bacteria | 5665 |
| 188 | Ga0496119_0026116 | 3300048922 | Bacteria | 4058 |
| 189 | Ga0496119_0053427 | 3300048922 | Bacteria | 2468 |
| 190 | Ga0496119_0064734 | 3300048922 | Bacteria | 2169 |
| 191 | Ga0496120_0001113 | 3300048923 | Bacteria | 34863 |
| 192 | Ga0496120_0004584 | 3300048923 | Bacteria | 11506 |
| 193 | Ga0496120_0008857 | 3300048923 | Bacteria | 7217 |
| 194 | Ga0496120_0014330 | 3300048923 | Bacteria | 5291 |
| 195 | Ga0496120_0021735 | 3300048923 | Bacteria | 4048 |
| 196 | Ga0496120_0027182 | 3300048923 | Bacteria | 3524 |
| 197 | Ga0496120_0044676 | 3300048923 | Bacteria | 2572 |
| 198 | Ga0496121_0000046 | 3300048924 | Bacteria | 335942 |
| 199 | Ga0496121_0041971 | 3300048924 | Bacteria | 3988 |
| 200 | Ga0496121_0094095 | 3300048924 | Bacteria | 2332 |
| 201 | Ga0496121_0095367 | 3300048924 | Bacteria | 2312 |
| 202 | Ga0496122_0000071 | 3300048925 | Bacteria | 222537 |
| 203 | Ga0496122_0000235 | 3300048925 | Bacteria | 124769 |
| 204 | Ga0496122_0001637 | 3300048925 | Bacteria | 34821 |
| 205 | Ga0496122_0123911 | 3300048925 | Bacteria | 1659 |
| 206 | Ga0496122_0165277 | 3300048925 | Bacteria | 1343 |
| 207 | Ga0496123_0000006 | 3300048926 | Bacteria | 647258 |
| 208 | Ga0496123_0000036 | 3300048926 | Bacteria | 265722 |
| 209 | Ga0496123_0042348 | 3300048926 | Bacteria | 3143 |
| 210 | Ga0496124_0000323 | 3300048927 | Bacteria | 88352 |
| 211 | Ga0496124_0006954 | 3300048927 | Bacteria | 12152 |
| 212 | Ga0496125_0015829 | 3300048928 | Bacteria | 7266 |
| 213 | Ga0496126_0002769 | 3300048929 | Bacteria | 23107 |
| 214 | Ga0496126_0038102 | 3300048929 | Bacteria | 4475 |
| 215 | Ga0496126_0185990 | 3300048929 | Bacteria | 1762 |
| 216 | Ga0501031_0004291 | 3300049568 | Bacteria | 9220 |
| 217 | Ga0501031_0036199 | 3300049568 | Bacteria | 3220 |
| 218 | Ga0501032_0050649 | 3300049569 | Bacteria | 2800 |
| 219 | Ga0501032_0059247 | 3300049569 | Bacteria | 2570 |
| 220 | Ga0501032_0153001 | 3300049569 | Bacteria | 1516 |
| 221 | Ga0501033_0008500 | 3300049570 | Bacteria | 7944 |
| 222 | Ga0501033_0010186 | 3300049570 | Bacteria | 7219 |
| 223 | Ga0501033_0029502 | 3300049570 | Bacteria | 4122 |
| 224 | Ga0501033_0062414 | 3300049570 | Bacteria | 2744 |
| 225 | Ga0501033_0107671 | 3300049570 | Bacteria | 2030 |
| 226 | Ga0501033_0189576 | 3300049570 | Bacteria | 1472 |
| 227 | Ga0501034_0002837 | 3300049571 | Bacteria | 20198 |
| 228 | Ga0501034_0035337 | 3300049571 | Bacteria | 5066 |
| 229 | Ga0501034_0049941 | 3300049571 | Bacteria | 4220 |
| 230 | Ga0501034_0066419 | 3300049571 | Bacteria | 3620 |
| 231 | Ga0501034_0067572 | 3300049571 | Bacteria | 3586 |
| 232 | Ga0501034_0104109 | 3300049571 | Bacteria | 2831 |
| 233 | Ga0501034_0144109 | 3300049571 | Bacteria | 2360 |
| 234 | Ga0501034_0148422 | 3300049571 | Bacteria | 2321 |
| 235 | Ga0501034_0319702 | 3300049571 | Bacteria | 1485 |
| 236 | Ga0501036_0035942 | 3300049572 | Bacteria | 4192 |
| 237 | Ga0501037_0001056 | 3300049573 | Bacteria | 20390 |
| 238 | Ga0501037_0084604 | 3300049573 | Bacteria | 2297 |
| 239 | Ga0501037_0114478 | 3300049573 | Bacteria | 1941 |
| 240 | Ga0501037_0130757 | 3300049573 | Bacteria | 1800 |
| 241 | Ga0501037_0131877 | 3300049573 | Bacteria | 1792 |
| 242 | Ga0501037_0157727 | 3300049573 | Bacteria | 1619 |
| 243 | Ga0501037_0340940 | 3300049573 | Bacteria | 1035 |
| 244 | Ga0501038_0021966 | 3300049574 | Bacteria | 5723 |
| 245 | Ga0501038_0072159 | 3300049574 | Bacteria | 2926 |
| 246 | Ga0501038_0148504 | 3300049574 | Bacteria | 1912 |
| 247 | Ga0501038_0462772 | 3300049574 | Bacteria | 974 |
| 248 | Ga0501039_0361517 | 3300049575 | Bacteria | 1140 |
| 249 | Ga0501042_0007500 | 3300049578 | Bacteria | 7149 |
| 250 | Ga0501043_0001586 | 3300049579 | Bacteria | 19754 |
| 251 | Ga0501043_0034912 | 3300049579 | Bacteria | 3955 |
| 252 | Ga0501043_0180566 | 3300049579 | Bacteria | 1644 |
| 253 | Ga0501046_0031040 | 3300049580 | Bacteria | 4334 |
| 254 | Ga0501046_0049498 | 3300049580 | Bacteria | 3323 |
| 255 | Ga0501047_0006847 | 3300049581 | Bacteria | 10709 |
| 256 | Ga0501047_0021788 | 3300049581 | Bacteria | 6153 |
| 257 | Ga0501047_0065962 | 3300049581 | Bacteria | 3489 |
| 258 | Ga0501047_0070058 | 3300049581 | Bacteria | 3376 |
| 259 | Ga0501047_0155844 | 3300049581 | Bacteria | 2158 |
| 260 | Ga0501048_0007540 | 3300049582 | Bacteria | 8245 |
| 261 | Ga0501067_0070493 | 3300049583 | Bacteria | 1936 |
| 262 | Ga0501068_0128710 | 3300049584 | Bacteria | 1582 |
| 263 | Ga0501069_0024065 | 3300049585 | Bacteria | 3322 |
| 264 | Ga0501069_0156016 | 3300049585 | Bacteria | 1313 |
| 265 | Ga0501070_0000407 | 3300049586 | Bacteria | 39131 |
| 266 | Ga0501070_0061984 | 3300049586 | Bacteria | 3098 |
| 267 | Ga0501070_0419550 | 3300049586 | Bacteria | 1081 |
| 268 | Ga0501072_0029509 | 3300049588 | Bacteria | 4285 |
| 269 | Ga0501073_0011248 | 3300049589 | Bacteria | 6547 |
| 270 | Ga0501073_0038283 | 3300049589 | Bacteria | 3403 |
| 271 | Ga0501077_0267048 | 3300049593 | Bacteria | 1088 |
| 272 | Ga0501080_0010478 | 3300049742 | Bacteria | 8488 |
| 273 | Ga0501080_0048839 | 3300049742 | Bacteria | 3937 |
| 274 | Ga0501083_0000178 | 3300049744 | Bacteria | 41100 |
| 275 | Ga0501083_0010591 | 3300049744 | Bacteria | 6492 |
| 276 | Ga0501083_0016310 | 3300049744 | Bacteria | 5202 |
| 277 | Ga0501035_0002897 | 3300049822 | Bacteria | 16522 |
| 278 | Ga0501035_0044463 | 3300049822 | Bacteria | 3999 |
| 279 | Ga0501035_0049454 | 3300049822 | Bacteria | 3767 |
| 280 | Ga0501035_0060481 | 3300049822 | Bacteria | 3372 |
| 281 | Ga0501035_0196966 | 3300049822 | Bacteria | 1730 |
| 282 | Ga0501044_0002388 | 3300049823 | Bacteria | 21404 |
| 283 | Ga0501044_0033799 | 3300049823 | Bacteria | 5369 |
| 284 | Ga0501044_0193892 | 3300049823 | Bacteria | 1992 |
| 285 | Ga0501044_0292519 | 3300049823 | Bacteria | 1560 |
| 286 | Ga0501044_0420702 | 3300049823 | Bacteria | 1246 |
| 287 | nmdc:mga00v17_28267_c1 | 3300050491 | Bacteria | 3283 |
| 288 | nmdc:mga00v17_43141_c1 | 3300050491 | Bacteria | 2715 |
| 289 | nmdc:mga0yw44_13884_c1 | 3300050492 | Bacteria | 4257 |
| 290 | nmdc:mga0sz30_8410_c1 | 3300050516 | Bacteria | 3897 |
| 291 | Ga0500635_0000241 | 3300053080 | Bacteria | 23974 |
| 292 | Ga0500651_0000692 | 3300053093 | Bacteria | 16729 |
| 293 | Ga0500556_0000133 | 3300053104 | Bacteria | 63387 |
| 294 | Ga0500559_0000534 | 3300053136 | Bacteria | 26496 |
| 295 | Ga0500559_0004644 | 3300053136 | Bacteria | 6477 |
| 296 | Ga0500568_0000007 | 3300053139 | Bacteria | 292579 |
| 297 | Ga0500568_0000099 | 3300053139 | Bacteria | 80197 |
| 298 | Ga0500568_0003779 | 3300053139 | Bacteria | 8288 |
| 299 | Ga0500568_0006347 | 3300053139 | Bacteria | 5945 |
| 300 | Ga0500573_0000005 | 3300053140 | Bacteria | 315762 |
| 301 | Ga0500573_0001951 | 3300053140 | Bacteria | 10078 |
| 302 | Ga0500573_0162087 | 3300053140 | Bacteria | 1216 |
| 303 | Ga0500573_0202246 | 3300053140 | Bacteria | 1053 |
| 304 | Ga0500588_0009258 | 3300053146 | Bacteria | 2336 |
| 305 | Ga0500590_002660 | 3300053148 | Bacteria | 8024 |
| 306 | Ga0500604_0002879 | 3300053151 | Unclassified | 4663 |
| 307 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 308 | Ga0500616_0000807 | 3300053153 | Bacteria | 35698 |
| 309 | Ga0500620_000019 | 3300053155 | Bacteria | 32857 |
| 310 | Ga0500645_004661 | 3300053730 | Bacteria | 5219 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0036199 | Ga0501031_0036199_2280_3086 | 238 |
| 2 | 3300049574 | Ga0501038_0148504 | Ga0501038_0148504_1049_1855 | 238 |
| 3 | 3300047320 | Ga0495672_0063499 | Ga0495672_0063499_592_1419 | 243 |
| 4 | 3300053151 | Ga0500604_0002879 | Ga0500604_0002879_2600_3427 | 243 |
| 5 | 3300044683 | Ga0466965_0000004 | Ga0466965_0000004_166447_167262 | 244 |
| 6 | 3300048922 | Ga0496119_0016295 | Ga0496119_0016295_3576_4388 | 244 |
| 7 | 3300048923 | Ga0496120_0014330 | Ga0496120_0014330_1178_1990 | 244 |
| 8 | 3300050491 | nmdc:mga00v17_43141_c1 | nmdc:mga00v17_43141_c1_147_962 | 245 |
| 9 | 3300006038 | Ga0075365_10002458 | Ga0075365_100024583 | 246 |
| 10 | 3300044693 | Ga0466961_0182917 | Ga0466961_0182917_459_1268 | 246 |
| 11 | 3300048923 | Ga0496120_0008857 | Ga0496120_0008857_4578_5372 | 246 |
| 12 | 3300050492 | nmdc:mga0yw44_13884_c1 | nmdc:mga0yw44_13884_c1_1072_1887 | 246 |
| 13 | 3300053140 | Ga0500573_0162087 | Ga0500573_0162087_242_997 | 246 |
| 14 | 3300053140 | Ga0500573_0202246 | Ga0500573_0202246_244_999 | 246 |
| 15 | 3300006038 | Ga0075365_10005786 | Ga0075365_100057863 | 247 |
| 16 | 3300009148 | Ga0105243_10080277 | Ga0105243_100802772 | 247 |
| 17 | 3300013102 | Ga0157371_10086687 | Ga0157371_100866872 | 247 |
| 18 | 3300025919 | Ga0207657_10096560 | Ga0207657_100965602 | 247 |
| 19 | 3300005327 | Ga0070658_10000298 | Ga0070658_1000029841 | 248 |
| 20 | 3300005337 | Ga0070682_100083837 | Ga0070682_1000838371 | 248 |
| 21 | 3300005366 | Ga0070659_100062048 | Ga0070659_1000620482 | 248 |
| 22 | 3300013104 | Ga0157370_10097567 | Ga0157370_100975673 | 248 |
| 23 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001993 | 248 |
| 24 | 3300026067 | Ga0207678_10019846 | Ga0207678_100198463 | 248 |
| 25 | 3300031649 | Ga0307514_10126020 | Ga0307514_101260202 | 248 |
| 26 | 3300050491 | nmdc:mga00v17_28267_c1 | nmdc:mga00v17_28267_c1_2172_2987 | 248 |
| 27 | 3300049578 | Ga0501042_0007500 | Ga0501042_0007500_5788_6687 | 249 |
| 28 | 3300053140 | Ga0500573_0001951 | Ga0500573_0001951_1349_2113 | 249 |
| 29 | 3300041451 | Ga0451791_1705021 | Ga0451791_1705021_718_1485 | 250 |
| 30 | 3300048929 | Ga0496126_0002769 | Ga0496126_0002769_5134_5973 | 250 |
| 31 | 3300053093 | Ga0500651_0000692 | Ga0500651_0000692_15452_16255 | 250 |
| 32 | 3300053136 | Ga0500559_0000534 | Ga0500559_0000534_16708_17517 | 250 |
| 33 | 3300053148 | Ga0500590_002660 | Ga0500590_002660_3564_4367 | 250 |
| 34 | 3300005339 | Ga0070660_100413854 | Ga0070660_1004138542 | 251 |
| 35 | 3300049569 | Ga0501032_0153001 | Ga0501032_0153001_485_1291 | 251 |
| 36 | 3300049571 | Ga0501034_0319702 | Ga0501034_0319702_316_1122 | 251 |
| 37 | 3300049573 | Ga0501037_0084604 | Ga0501037_0084604_911_1717 | 251 |
| 38 | 3300049574 | Ga0501038_0072159 | Ga0501038_0072159_1797_2603 | 251 |
| 39 | 3300049575 | Ga0501039_0361517 | Ga0501039_0361517_249_1055 | 251 |
| 40 | 3300044765 | Ga0466970_0099695 | Ga0466970_0099695_301_1104 | 252 |
| 41 | 3300046471 | Ga0495650_0000211 | Ga0495650_0000211_122782_123621 | 252 |
| 42 | 3300053104 | Ga0500556_0000133 | Ga0500556_0000133_16705_17520 | 252 |
| 43 | iso_pu_bacteria | 2966921586 | 2966922881 | 252 |
| 44 | 3300003760 | Ga0055527_1000004 | Ga0055527_1000004356 | 253 |
| 45 | 3300003762 | Ga0055542_1000019 | Ga0055542_1000019144 | 253 |
| 46 | 3300003763 | Ga0055529_1000008 | Ga0055529_1000008221 | 253 |
| 47 | 3300006186 | Ga0075369_10022083 | Ga0075369_100220833 | 253 |
| 48 | 3300013105 | Ga0157369_10026412 | Ga0157369_100264123 | 253 |
| 49 | 3300025228 | Ga0209672_100011 | Ga0209672_100011356 | 253 |
| 50 | 3300025242 | Ga0209258_102049 | Ga0209258_1020495 | 253 |
| 51 | 3300025254 | Ga0209148_1000023 | Ga0209148_1000023194 | 253 |
| 52 | 3300025272 | Ga0209455_1000023 | Ga0209455_1000023194 | 253 |
| 53 | 3300042015 | Ga0439462_0005836 | Ga0439462_0005836_1543_2346 | 253 |
| 54 | 3300048919 | Ga0496116_0098782 | Ga0496116_0098782_560_1381 | 253 |
| 55 | 3300048920 | Ga0496117_0052738 | Ga0496117_0052738_532_1353 | 253 |
| 56 | 3300048921 | Ga0496118_0012972 | Ga0496118_0012972_4539_5360 | 253 |
| 57 | 3300048922 | Ga0496119_0026116 | Ga0496119_0026116_1316_2137 | 253 |
| 58 | 3300048923 | Ga0496120_0004584 | Ga0496120_0004584_2315_3136 | 253 |
| 59 | 3300048925 | Ga0496122_0000071 | Ga0496122_0000071_49838_50659 | 253 |
| 60 | 3300048926 | Ga0496123_0000006 | Ga0496123_0000006_474562_475383 | 253 |
| 61 | 3300048927 | Ga0496124_0006954 | Ga0496124_0006954_998_1819 | 253 |
| 62 | 3300048928 | Ga0496125_0015829 | Ga0496125_0015829_3248_4069 | 253 |
| 63 | 3300048929 | Ga0496126_0038102 | Ga0496126_0038102_560_1381 | 253 |
| 64 | 3300049571 | Ga0501034_0035337 | Ga0501034_0035337_1591_2421 | 253 |
| 65 | 3300049573 | Ga0501037_0114478 | Ga0501037_0114478_25_855 | 253 |
| 66 | 3300049579 | Ga0501043_0001586 | Ga0501043_0001586_4641_5471 | 253 |
| 67 | 3300049581 | Ga0501047_0065962 | Ga0501047_0065962_170_1000 | 253 |
| 68 | 3300049583 | Ga0501067_0070493 | Ga0501067_0070493_172_1002 | 253 |
| 69 | 3300049585 | Ga0501069_0024065 | Ga0501069_0024065_352_1182 | 253 |
| 70 | 3300049589 | Ga0501073_0011248 | Ga0501073_0011248_1675_2505 | 253 |
| 71 | 3300049593 | Ga0501077_0267048 | Ga0501077_0267048_182_1012 | 253 |
| 72 | 3300049742 | Ga0501080_0010478 | Ga0501080_0010478_5187_6017 | 253 |
| 73 | 3300049744 | Ga0501083_0010591 | Ga0501083_0010591_2266_3096 | 253 |
| 74 | 3300005327 | Ga0070658_10035237 | Ga0070658_100352373 | 254 |
| 75 | 3300005338 | Ga0068868_100377852 | Ga0068868_1003778522 | 254 |
| 76 | 3300005339 | Ga0070660_100042247 | Ga0070660_1000422472 | 254 |
| 77 | 3300005344 | Ga0070661_100103383 | Ga0070661_1001033832 | 254 |
| 78 | 3300005366 | Ga0070659_100000783 | Ga0070659_10000078313 | 254 |
| 79 | 3300005367 | Ga0070667_100032534 | Ga0070667_1000325343 | 254 |
| 80 | 3300005466 | Ga0070685_10012833 | Ga0070685_100128333 | 254 |
| 81 | 3300005539 | Ga0068853_100011464 | Ga0068853_1000114642 | 254 |
| 82 | 3300005563 | Ga0068855_100010920 | Ga0068855_1000109207 | 254 |
| 83 | 3300005563 | Ga0068855_100182336 | Ga0068855_1001823363 | 254 |
| 84 | 3300005578 | Ga0068854_100299106 | Ga0068854_1002991062 | 254 |
| 85 | 3300005616 | Ga0068852_100106792 | Ga0068852_1001067923 | 254 |
| 86 | 3300005617 | Ga0068859_100071413 | Ga0068859_1000714132 | 254 |
| 87 | 3300005842 | Ga0068858_100000867 | Ga0068858_1000008672 | 254 |
| 88 | 3300006931 | Ga0097620_100071411 | Ga0097620_1000714112 | 254 |
| 89 | 3300009093 | Ga0105240_10292597 | Ga0105240_102925972 | 254 |
| 90 | 3300009098 | Ga0105245_10004196 | Ga0105245_1000419611 | 254 |
| 91 | 3300009551 | Ga0105238_10136855 | Ga0105238_101368553 | 254 |
| 92 | 3300014968 | Ga0157379_10019290 | Ga0157379_100192902 | 254 |
| 93 | 3300025913 | Ga0207695_10114224 | Ga0207695_101142243 | 254 |
| 94 | 3300025913 | Ga0207695_10383851 | Ga0207695_103838512 | 254 |
| 95 | 3300025924 | Ga0207694_10080900 | Ga0207694_100809002 | 254 |
| 96 | 3300025927 | Ga0207687_10018338 | Ga0207687_100183383 | 254 |
| 97 | 3300025932 | Ga0207690_10000713 | Ga0207690_100007132 | 254 |
| 98 | 3300025941 | Ga0207711_10183693 | Ga0207711_101836932 | 254 |
| 99 | 3300025949 | Ga0207667_10003872 | Ga0207667_100038726 | 254 |
| 100 | 3300025949 | Ga0207667_10020205 | Ga0207667_100202053 | 254 |
| 101 | 3300025949 | Ga0207667_10029884 | Ga0207667_100298842 | 254 |
| 102 | 3300025986 | Ga0207658_10032533 | Ga0207658_100325332 | 254 |
| 103 | 3300026035 | Ga0207703_10000121 | Ga0207703_1000012168 | 254 |
| 104 | 3300026041 | Ga0207639_10025875 | Ga0207639_100258752 | 254 |
| 105 | 3300026078 | Ga0207702_10259014 | Ga0207702_102590142 | 254 |
| 106 | 3300026078 | Ga0207702_10321066 | Ga0207702_103210662 | 254 |
| 107 | 3300026142 | Ga0207698_10058374 | Ga0207698_100583742 | 254 |
| 108 | 3300048920 | Ga0496117_0110585 | Ga0496117_0110585_358_1176 | 254 |
| 109 | 3300048924 | Ga0496121_0041971 | Ga0496121_0041971_875_1693 | 254 |
| 110 | 3300048929 | Ga0496126_0185990 | Ga0496126_0185990_333_1148 | 254 |
| 111 | 3300053139 | Ga0500568_0000099 | Ga0500568_0000099_68661_69467 | 254 |
| 112 | 3300053139 | Ga0500568_0003779 | Ga0500568_0003779_1601_2410 | 254 |
| 113 | iso_pu_bacteria | 2857733635 | 2857735031 | 254 |
| 114 | 3300005330 | Ga0070690_100045890 | Ga0070690_1000458903 | 255 |
| 115 | 3300005539 | Ga0068853_100108666 | Ga0068853_1001086662 | 255 |
| 116 | 3300005543 | Ga0070672_100129148 | Ga0070672_1001291482 | 255 |
| 117 | 3300009101 | Ga0105247_10013352 | Ga0105247_100133523 | 255 |
| 118 | 3300009177 | Ga0105248_10007269 | Ga0105248_100072693 | 255 |
| 119 | 3300009545 | Ga0105237_10100332 | Ga0105237_101003323 | 255 |
| 120 | 3300025728 | Ga0207655_1024450 | Ga0207655_10244502 | 255 |
| 121 | 3300025914 | Ga0207671_10082894 | Ga0207671_100828942 | 255 |
| 122 | 3300025940 | Ga0207691_10320742 | Ga0207691_103207422 | 255 |
| 123 | 3300026041 | Ga0207639_10106852 | Ga0207639_101068522 | 255 |
| 124 | 3300044693 | Ga0466961_0181630 | Ga0466961_0181630_272_1063 | 255 |
| 125 | 3300044694 | Ga0466963_0304781 | Ga0466963_0304781_203_994 | 255 |
| 126 | 3300044842 | Ga0466957_0050230 | Ga0466957_0050230_250_1041 | 255 |
| 127 | 3300044901 | Ga0466960_0247307 | Ga0466960_0247307_110_901 | 255 |
| 128 | 3300046457 | Ga0495590_0000091 | Ga0495590_0000091_32224_33060 | 255 |
| 129 | 3300048920 | Ga0496117_0000174 | Ga0496117_0000174_129577_130410 | 255 |
| 130 | 3300048920 | Ga0496117_0000988 | Ga0496117_0000988_41669_42484 | 255 |
| 131 | 3300048921 | Ga0496118_0001023 | Ga0496118_0001023_41653_42468 | 255 |
| 132 | 3300048922 | Ga0496119_0004747 | Ga0496119_0004747_10364_11206 | 255 |
| 133 | 3300048922 | Ga0496119_0053427 | Ga0496119_0053427_11_826 | 255 |
| 134 | 3300048923 | Ga0496120_0021735 | Ga0496120_0021735_1380_2222 | 255 |
| 135 | 3300048923 | Ga0496120_0044676 | Ga0496120_0044676_723_1538 | 255 |
| 136 | 3300048925 | Ga0496122_0123911 | Ga0496122_0123911_55_870 | 255 |
| 137 | 3300048926 | Ga0496123_0042348 | Ga0496123_0042348_1188_2003 | 255 |
| 138 | 3300048927 | Ga0496124_0000323 | Ga0496124_0000323_1058_1873 | 255 |
| 139 | 3300049569 | Ga0501032_0059247 | Ga0501032_0059247_317_1132 | 255 |
| 140 | 3300049573 | Ga0501037_0001056 | Ga0501037_0001056_7040_7855 | 255 |
| 141 | 3300049579 | Ga0501043_0180566 | Ga0501043_0180566_689_1504 | 255 |
| 142 | 3300049581 | Ga0501047_0006847 | Ga0501047_0006847_9835_10650 | 255 |
| 143 | 3300049744 | Ga0501083_0000178 | Ga0501083_0000178_10492_11391 | 255 |
| 144 | 3300049822 | Ga0501035_0002897 | Ga0501035_0002897_6238_7053 | 255 |
| 145 | 3300049823 | Ga0501044_0002388 | Ga0501044_0002388_8791_9606 | 255 |
| 146 | 3300053146 | Ga0500588_0009258 | Ga0500588_0009258_1183_2022 | 255 |
| 147 | 3300053153 | Ga0500616_0000807 | Ga0500616_0000807_25447_26262 | 255 |
| 148 | 3300005577 | Ga0068857_100010949 | Ga0068857_1000109496 | 256 |
| 149 | 3300005616 | Ga0068852_100107538 | Ga0068852_1001075383 | 256 |
| 150 | 3300009093 | Ga0105240_10011822 | Ga0105240_100118227 | 256 |
| 151 | 3300009174 | Ga0105241_10002520 | Ga0105241_100025205 | 256 |
| 152 | 3300009545 | Ga0105237_10100854 | Ga0105237_101008542 | 256 |
| 153 | 3300025254 | Ga0209148_1000931 | Ga0209148_100093110 | 256 |
| 154 | 3300025728 | Ga0207655_1004351 | Ga0207655_10043516 | 256 |
| 155 | 3300025911 | Ga0207654_10000001 | Ga0207654_10000001439 | 256 |
| 156 | 3300025913 | Ga0207695_10001965 | Ga0207695_1000196511 | 256 |
| 157 | 3300025914 | Ga0207671_10128664 | Ga0207671_101286642 | 256 |
| 158 | 3300025935 | Ga0207709_10004264 | Ga0207709_100042644 | 256 |
| 159 | 3300026116 | Ga0207674_10004042 | Ga0207674_1000404210 | 256 |
| 160 | 3300026142 | Ga0207698_10005350 | Ga0207698_100053505 | 256 |
| 161 | 3300041413 | Ga0439465_0032346 | Ga0439465_0032346_562_1383 | 256 |
| 162 | 3300047320 | Ga0495672_0022559 | Ga0495672_0022559_3080_3919 | 256 |
| 163 | 3300048905 | Ga0496102_0029611 | Ga0496102_0029611_669_1529 | 256 |
| 164 | 3300048920 | Ga0496117_0010998 | Ga0496117_0010998_2083_2943 | 256 |
| 165 | 3300048921 | Ga0496118_0028229 | Ga0496118_0028229_3345_4205 | 256 |
| 166 | 3300048924 | Ga0496121_0094095 | Ga0496121_0094095_1418_2236 | 256 |
| 167 | 3300049571 | Ga0501034_0144109 | Ga0501034_0144109_1291_2094 | 256 |
| 168 | 3300049581 | Ga0501047_0070058 | Ga0501047_0070058_653_1555 | 256 |
| 169 | iso_pu_bacteria | 2904501621 | 2904502425 | 256 |
| 170 | iso_pu_bacteria | 2908674828 | 2908677436 | 256 |
| 171 | iso_pu_bacteria | 2928500415 | 2928503607 | 256 |
| 172 | 3300048925 | Ga0496122_0165277 | Ga0496122_0165277_14_829 | 257 |
| 173 | 3300049570 | Ga0501033_0029502 | Ga0501033_0029502_2100_2906 | 257 |
| 174 | 3300049572 | Ga0501036_0035942 | Ga0501036_0035942_3256_4062 | 257 |
| 175 | 3300049573 | Ga0501037_0340940 | Ga0501037_0340940_110_916 | 257 |
| 176 | 3300049584 | Ga0501068_0128710 | Ga0501068_0128710_475_1281 | 257 |
| 177 | 3300049586 | Ga0501070_0061984 | Ga0501070_0061984_460_1266 | 257 |
| 178 | 3300050516 | nmdc:mga0sz30_8410_c1 | nmdc:mga0sz30_8410_c1_1911_2726 | 257 |
| 179 | 3300053139 | Ga0500568_0006347 | Ga0500568_0006347_3520_4308 | 257 |
| 180 | iso_pu_bacteria | 2585428157 | 2588107466 | 257 |
| 181 | 3300013296 | Ga0157374_10582799 | Ga0157374_105827991 | 258 |
| 182 | 3300025941 | Ga0207711_10012169 | Ga0207711_100121698 | 258 |
| 183 | 3300048925 | Ga0496122_0001637 | Ga0496122_0001637_12441_13274 | 258 |
| 184 | 3300049571 | Ga0501034_0002837 | Ga0501034_0002837_13937_14728 | 258 |
| 185 | 3300049571 | Ga0501034_0049941 | Ga0501034_0049941_2797_3591 | 258 |
| 186 | 3300049573 | Ga0501037_0157727 | Ga0501037_0157727_579_1370 | 258 |
| 187 | 3300049588 | Ga0501072_0029509 | Ga0501072_0029509_1263_2054 | 258 |
| 188 | 3300049589 | Ga0501073_0038283 | Ga0501073_0038283_237_1028 | 258 |
| 189 | 3300053136 | Ga0500559_0004644 | Ga0500559_0004644_4010_4870 | 258 |
| 190 | 3300048920 | Ga0496117_0000964 | Ga0496117_0000964_40106_40945 | 259 |
| 191 | 3300048920 | Ga0496117_0032545 | Ga0496117_0032545_900_1733 | 259 |
| 192 | 3300048921 | Ga0496118_0036785 | Ga0496118_0036785_2549_3388 | 259 |
| 193 | 3300048921 | Ga0496118_0046371 | Ga0496118_0046371_457_1290 | 259 |
| 194 | 3300048922 | Ga0496119_0001425 | Ga0496119_0001425_23545_24384 | 259 |
| 195 | 3300048922 | Ga0496119_0005538 | Ga0496119_0005538_9565_10398 | 259 |
| 196 | 3300048923 | Ga0496120_0001113 | Ga0496120_0001113_4601_5434 | 259 |
| 197 | 3300053140 | Ga0500573_0000005 | Ga0500573_0000005_153993_154790 | 259 |
| 198 | 3300049823 | Ga0501044_0420702 | Ga0501044_0420702_226_1029 | 260 |
| 199 | iso_pu_bacteria | 2757320536 | 2758225432 | 260 |
| 200 | iso_pu_bacteria | 8004212874 | 8004212943 | 260 |
| 201 | iso_pu_bacteria | 8016254467 | 8016255847 | 260 |
| 202 | 3300048908 | Ga0496105_0066260 | Ga0496105_0066260_1605_2435 | 261 |
| 203 | 3300049573 | Ga0501037_0131877 | Ga0501037_0131877_721_1572 | 261 |
| 204 | 3300049574 | Ga0501038_0462772 | Ga0501038_0462772_73_924 | 261 |
| 205 | 3300049580 | Ga0501046_0049498 | Ga0501046_0049498_1039_1890 | 261 |
| 206 | 3300049581 | Ga0501047_0155844 | Ga0501047_0155844_1056_1907 | 261 |
| 207 | 3300049586 | Ga0501070_0419550 | Ga0501070_0419550_139_990 | 261 |
| 208 | 3300053153 | Ga0500616_0000010 | Ga0500616_0000010_331288_332163 | 261 |
| 209 | 3300053155 | Ga0500620_000019 | Ga0500620_000019_1265_2122 | 261 |
| 210 | iso_pu_bacteria | 2643221546 | 2643751847 | 261 |
| 211 | iso_pu_bacteria | 2643221597 | 2643997272 | 261 |
| 212 | iso_pu_bacteria | 2773857758 | 2774379567 | 261 |
| 213 | iso_pu_bacteria | 2904509784 | 2904512948 | 261 |
| 214 | iso_pu_bacteria | 2908678064 | 2908679410 | 261 |
| 215 | iso_pu_bacteria | 2919069694 | 2919070049 | 261 |
| 216 | iso_pu_bacteria | 2974294766 | 2974295623 | 261 |
| 217 | iso_pu_bacteria | 2974324384 | 2974324574 | 261 |
| 218 | iso_pu_bacteria | 2977228692 | 2977229607 | 261 |
| 219 | iso_pu_bacteria | 2977236895 | 2977238345 | 261 |
| 220 | iso_pu_bacteria | 2977264416 | 2977264871 | 261 |
| 221 | iso_pu_bacteria | 2984542743 | 2984543873 | 261 |
| 222 | 3300045976 | Ga0466967_0506050 | Ga0466967_0506050_287_1168 | 262 |
| 223 | iso_pu_bacteria | 2643221566 | 2643847306 | 262 |
| 224 | 3300002772 | JGI25164J39214_1000397 | JGI25164J39214_10003973 | 263 |
| 225 | 3300003214 | JGI25165J46597_1000005 | JGI25165J46597_1000005387 | 263 |
| 226 | 3300025231 | Ga0207427_100024 | Ga0207427_100024219 | 263 |
| 227 | 3300025233 | Ga0209437_100243 | Ga0209437_10024327 | 263 |
| 228 | 3300025261 | Ga0209233_1000001 | Ga0209233_1000001262 | 263 |
| 229 | 3300049570 | Ga0501033_0189576 | Ga0501033_0189576_173_1033 | 263 |
| 230 | iso_pu_bacteria | 2643221649 | 2644280203 | 263 |
| 231 | iso_pu_bacteria | 2844852863 | 2844853594 | 263 |
| 232 | 3300048920 | Ga0496117_0166409 | Ga0496117_0166409_205_1014 | 264 |
| 233 | iso_pu_bacteria | 2906799679 | 2906802839 | 264 |
| 234 | iso_pu_bacteria | 8056037122 | 8056040393 | 264 |
| 235 | iso_pu_bacteria | 8057345674 | 8057346576 | 264 |
| 236 | 3300048917 | Ga0496114_0080296 | Ga0496114_0080296_198_1013 | 265 |
| 237 | 3300049571 | Ga0501034_0066419 | Ga0501034_0066419_98_1123 | 265 |
| 238 | 3300049742 | Ga0501080_0048839 | Ga0501080_0048839_2735_3676 | 265 |
| 239 | 3300053139 | Ga0500568_0000007 | Ga0500568_0000007_215749_216561 | 265 |
| 240 | iso_pu_bacteria | 2582580736 | 2583152010 | 265 |
| 241 | iso_pu_bacteria | 2585428094 | 2587861917 | 265 |
| 242 | iso_pu_bacteria | 2917736166 | 2917739061 | 265 |
| 243 | 3300005327 | Ga0070658_10055107 | Ga0070658_100551074 | 266 |
| 244 | 3300032002 | Ga0307416_100126040 | Ga0307416_1001260402 | 266 |
| 245 | 3300033179 | Ga0307507_10005233 | Ga0307507_1000523318 | 266 |
| 246 | 3300037466 | Ga0395898_0610244 | Ga0395898_0610244_171_1010 | 266 |
| 247 | 3300048918 | Ga0496115_0174848 | Ga0496115_0174848_100_984 | 266 |
| 248 | 3300049570 | Ga0501033_0010186 | Ga0501033_0010186_1692_2717 | 266 |
| 249 | 3300049822 | Ga0501035_0049454 | Ga0501035_0049454_886_1911 | 266 |
| 250 | 3300049823 | Ga0501044_0033799 | Ga0501044_0033799_2556_3581 | 266 |
| 251 | iso_pu_bacteria | 2857729791 | 2857730683 | 266 |
| 252 | 3300005337 | Ga0070682_100044876 | Ga0070682_1000448762 | 267 |
| 253 | 3300005435 | Ga0070714_100005110 | Ga0070714_1000051102 | 267 |
| 254 | 3300005436 | Ga0070713_100624238 | Ga0070713_1006242382 | 267 |
| 255 | 3300013105 | Ga0157369_10084741 | Ga0157369_100847412 | 267 |
| 256 | 3300013105 | Ga0157369_10240299 | Ga0157369_102402992 | 267 |
| 257 | 3300013307 | Ga0157372_10577232 | Ga0157372_105772322 | 267 |
| 258 | 3300020082 | Ga0206353_11454628 | Ga0206353_114546282 | 267 |
| 259 | 3300025904 | Ga0207647_10004822 | Ga0207647_100048228 | 267 |
| 260 | 3300025928 | Ga0207700_10020137 | Ga0207700_100201373 | 267 |
| 261 | 3300025929 | Ga0207664_10002066 | Ga0207664_1000206610 | 267 |
| 262 | 3300031838 | Ga0307518_10177682 | Ga0307518_101776822 | 267 |
| 263 | 3300037312 | Ga0395899_0025711 | Ga0395899_0025711_937_1797 | 267 |
| 264 | 3300037418 | Ga0395900_0001470 | Ga0395900_0001470_11900_12760 | 267 |
| 265 | 3300037466 | Ga0395898_0000355 | Ga0395898_0000355_27681_28541 | 267 |
| 266 | 3300048905 | Ga0496102_0613063 | Ga0496102_0613063_54_914 | 267 |
| 267 | 3300048906 | Ga0496103_0007844 | Ga0496103_0007844_3777_4637 | 267 |
| 268 | 3300048907 | Ga0496104_0204064 | Ga0496104_0204064_472_1332 | 267 |
| 269 | 3300048917 | Ga0496114_0036324 | Ga0496114_0036324_1635_2495 | 267 |
| 270 | 3300048918 | Ga0496115_0028473 | Ga0496115_0028473_105_965 | 267 |
| 271 | 3300048921 | Ga0496118_0037274 | Ga0496118_0037274_1335_2195 | 267 |
| 272 | 3300048922 | Ga0496119_0005866 | Ga0496119_0005866_1989_2819 | 267 |
| 273 | 3300048922 | Ga0496119_0064734 | Ga0496119_0064734_1195_2055 | 267 |
| 274 | 3300048923 | Ga0496120_0027182 | Ga0496120_0027182_991_1830 | 267 |
| 275 | 3300048924 | Ga0496121_0000046 | Ga0496121_0000046_150621_151439 | 267 |
| 276 | 3300048924 | Ga0496121_0095367 | Ga0496121_0095367_1081_1941 | 267 |
| 277 | 3300048925 | Ga0496122_0000235 | Ga0496122_0000235_43496_44335 | 267 |
| 278 | 3300048926 | Ga0496123_0000036 | Ga0496123_0000036_80439_81278 | 267 |
| 279 | 3300049568 | Ga0501031_0004291 | Ga0501031_0004291_5306_6247 | 267 |
| 280 | 3300049569 | Ga0501032_0050649 | Ga0501032_0050649_1584_2525 | 267 |
| 281 | 3300049570 | Ga0501033_0008500 | Ga0501033_0008500_2339_3280 | 267 |
| 282 | 3300049570 | Ga0501033_0107671 | Ga0501033_0107671_375_1358 | 267 |
| 283 | 3300049571 | Ga0501034_0067572 | Ga0501034_0067572_1895_2878 | 267 |
| 284 | 3300049571 | Ga0501034_0104109 | Ga0501034_0104109_53_994 | 267 |
| 285 | 3300049573 | Ga0501037_0130757 | Ga0501037_0130757_683_1666 | 267 |
| 286 | 3300049574 | Ga0501038_0021966 | Ga0501038_0021966_3238_4179 | 267 |
| 287 | 3300049579 | Ga0501043_0034912 | Ga0501043_0034912_2760_3701 | 267 |
| 288 | 3300049580 | Ga0501046_0031040 | Ga0501046_0031040_3341_4282 | 267 |
| 289 | 3300049582 | Ga0501048_0007540 | Ga0501048_0007540_5043_5984 | 267 |
| 290 | 3300049822 | Ga0501035_0060481 | Ga0501035_0060481_655_1638 | 267 |
| 291 | 3300049823 | Ga0501044_0193892 | Ga0501044_0193892_104_1045 | 267 |
| 292 | 3300053730 | Ga0500645_004661 | Ga0500645_004661_2462_3328 | 267 |
| 293 | 3300037418 | Ga0395900_0053053 | Ga0395900_0053053_1859_2809 | 268 |
| 294 | 3300049585 | Ga0501069_0156016 | Ga0501069_0156016_133_1113 | 268 |
| 295 | iso_pu_bacteria | 2537561592 | 2537900490 | 268 |
| 296 | iso_pu_bacteria | 2856741275 | 2856746860 | 268 |
| 297 | iso_pu_bacteria | 2891562705 | 2891565128 | 268 |
| 298 | 3300031456 | Ga0307513_10025493 | Ga0307513_100254933 | 269 |
| 299 | 3300049570 | Ga0501033_0062414 | Ga0501033_0062414_926_1825 | 269 |
| 300 | 3300049581 | Ga0501047_0021788 | Ga0501047_0021788_3414_4397 | 269 |
| 301 | 3300049744 | Ga0501083_0016310 | Ga0501083_0016310_4276_5175 | 269 |
| 302 | 3300049822 | Ga0501035_0196966 | Ga0501035_0196966_683_1582 | 269 |
| 303 | iso_pu_bacteria | 2751185788 | 2753300546 | 269 |
| 304 | iso_pu_bacteria | 2919042368 | 2919045253 | 269 |
| 305 | iso_pu_bacteria | 2928104781 | 2928106912 | 269 |
| 306 | iso_pu_bacteria | 2939660829 | 2939661447 | 269 |
| 307 | iso_pu_bacteria | 2984551494 | 2984552659 | 269 |
| 308 | iso_pu_bacteria | 2643221632 | 2644181879 | 271 |
| 309 | 3300049571 | Ga0501034_0148422 | Ga0501034_0148422_241_1086 | 273 |
| 310 | 3300049823 | Ga0501044_0292519 | Ga0501044_0292519_123_986 | 273 |
| 311 | 3300044683 | Ga0466965_0154196 | Ga0466965_0154196_232_1092 | 274 |
| 312 | iso_pu_bacteria | 2919055335 | 2919056246 | 275 |
| 313 | 3300005327 | Ga0070658_10039424 | Ga0070658_100394242 | 276 |
| 314 | 3300013105 | Ga0157369_10399219 | Ga0157369_103992192 | 276 |
| 315 | 3300020081 | Ga0206354_10047148 | Ga0206354_100471482 | 276 |
| 316 | 3300020082 | Ga0206353_10036517 | Ga0206353_100365172 | 276 |
| 317 | 3300025253 | Ga0209677_101216 | Ga0209677_1012165 | 276 |
| 318 | 3300025909 | Ga0207705_10166882 | Ga0207705_101668822 | 276 |
| 319 | 3300026078 | Ga0207702_10094742 | Ga0207702_100947423 | 276 |
| 320 | 3300037312 | Ga0395899_0013247 | Ga0395899_0013247_1362_2222 | 276 |
| 321 | 3300038443 | Ga0395901_0299355 | Ga0395901_0299355_35_895 | 276 |
| 322 | 3300044693 | Ga0466961_0010348 | Ga0466961_0010348_4843_5703 | 276 |
| 323 | 3300044765 | Ga0466970_0073000 | Ga0466970_0073000_131_991 | 276 |
| 324 | 3300045049 | Ga0466959_0223406 | Ga0466959_0223406_106_966 | 276 |
| 325 | 3300048918 | Ga0496115_0124841 | Ga0496115_0124841_451_1335 | 276 |
| 326 | 3300049586 | Ga0501070_0000407 | Ga0501070_0000407_23054_23914 | 276 |
| 327 | 3300049822 | Ga0501035_0044463 | Ga0501035_0044463_2760_3620 | 276 |
| 328 | 3300048903 | Ga0496100_0143344 | Ga0496100_0143344_82_966 | 277 |
| 329 | 3300048907 | Ga0496104_0047744 | Ga0496104_0047744_865_1749 | 277 |
| 330 | 3300048910 | Ga0496107_0086229 | Ga0496107_0086229_343_1221 | 277 |
| 331 | iso_pu_bacteria | 2844841374 | 2844844280 | 277 |
| 332 | iso_pu_bacteria | 2919523602 | 2919526248 | 277 |
| 333 | iso_pu_bacteria | 2928153084 | 2928154375 | 277 |
| 334 | 3300003322 | rootL2_10062257 | rootL2_100622572 | 279 |
| 335 | 3300003752 | Ga0055539_1000014 | Ga0055539_100001454 | 279 |
| 336 | 3300003756 | Ga0055533_1000002 | Ga0055533_1000002841 | 279 |
| 337 | 3300003759 | Ga0055525_1000421 | Ga0055525_10004216 | 279 |
| 338 | 3300003759 | Ga0055525_1001814 | Ga0055525_10018142 | 279 |
| 339 | 3300025225 | Ga0209566_100056 | Ga0209566_100056171 | 279 |
| 340 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012725 | 279 |
| 341 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012725 | 279 |
| 342 | 3300025230 | Ga0209563_100335 | Ga0209563_10033515 | 279 |
| 343 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012725 | 279 |
| 344 | 3300025272 | Ga0209455_1000565 | Ga0209455_100056528 | 279 |
| 345 | 3300044693 | Ga0466961_0148193 | Ga0466961_0148193_113_973 | 279 |
| 346 | 3300044765 | Ga0466970_0038464 | Ga0466970_0038464_1651_2511 | 279 |
| 347 | 3300044842 | Ga0466957_0037964 | Ga0466957_0037964_533_1393 | 279 |
| 348 | 3300045049 | Ga0466959_0052709 | Ga0466959_0052709_1815_2675 | 279 |
| 349 | 3300053080 | Ga0500635_0000241 | Ga0500635_0000241_15821_16705 | 279 |
| 350 | 3300002067 | JGI24735J21928_10004858 | JGI24735J21928_100048583 | 281 |
| 351 | 3300003578 | Ga0006562J51391_1006080 | Ga0006562J51391_10060803 | 281 |
| 352 | 3300003578 | Ga0006562J51391_1006082 | Ga0006562J51391_10060823 | 281 |
| 353 | 3300009036 | Ga0105244_10035749 | Ga0105244_100357493 | 281 |
| 354 | 3300048920 | Ga0496117_0011054 | Ga0496117_0011054_291_1151 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nq2-assembly1.cif.gz_D | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.914 | 16 | 247 |
| 2nq2-assembly1.cif.gz_C | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.9022 | 15 | 247 |
| 7kyo-assembly1.cif.gz_B | psabc from streptococcus pneumoniae in complex with fab | 0.8836 | 18 | 250 |
| 5b57-assembly1.cif.gz_C | inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia | 0.8831 | 18 | 247 |
| 2ihy-assembly1.cif.gz_A | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.8803 | 15 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58283_1_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9089 | 18 | 250 | 3.40.50.300 |
| af_Q2G1L8_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9059 | 15 | 247 | 3.40.50.300 |
| 2nq2C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9022 | 15 | 247 | 3.40.50.300 |
| af_Q2FWA1_1_260_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9001 | 17 | 247 | 3.40.50.300 |
| af_P0A9X1_1_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8967 | 15 | 244 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R9AMN4-F1-model_v4 | Metal ABC transporter ATP-binding protein | 0.9338 | 16 | 231 |
GO:0005524
GO:0016887 |
| AF-A0A1H5GCX7-F1-model_v4 | Iron complex transport system ATP-binding protein | 0.9214 | 18 | 247 |
GO:0005524
GO:0016887 |
| AF-A0A7X3RY25-F1-model_v4 | Heme ABC transporter ATP-binding protein | 0.9168 | 16 | 247 |
GO:0005524
GO:0016887 |
| AF-A0A6P1MAD8-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9149 | 15 | 248 |
GO:0005524
GO:0016887 |
| AF-A0A535BEJ5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9148 | 15 | 247 |
GO:0004842
GO:0005524 GO:0016567 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar