F419906

General Info

Members Datasets Scaffolds Average Seq Length
354 209 310 269

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0010186|Ga0501033_0010186_1692_2717
Length 306
Sequence MSDATRAVAAGTEPAGVQEPPSAASLETVLSLRDATLGFADRTLWSGLDLNVHGGEFIAVLGANGSGKTSLLRVILGQQKLVSGSIDFLGEPVTRGNRRIGYVPQQRLADEGTPLRARDLVGLGLDGHRWGVPWPSRRRRERIDGLLDAVGAVPYGSVPIATLSGGEQQRLRVGQALAGDPRLLLCDEPLLSLDLAHQRAVSELIDRQRRERQLGVLFVTHDVNPVLDLVDRVLYLAGGKFRIGTPDQVLRSEVLSELYDAPVDVIRTRGRIVVVGTADAPGAHPDGLHAHHDTMPGAATGGSSER

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
5 2643221546 Microbacterium sp. Root53 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221597 Microbacterium sp. Root180 Isolate Unclassified
8 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
9 2643221649 Leifsonia sp. Root4 Isolate Unclassified
10 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
11 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
12 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
13 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
14 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
15 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
16 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
17 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
18 2891562705 Microbispora tritici MT50 Isolate Unclassified
19 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
20 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
21 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
22 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
23 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
24 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
25 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
26 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
27 2919069694 Microbacterium sp. 1154 Isolate Unclassified
28 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
29 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
30 2928153084 Leifsonia sp. 563 Isolate Unclassified
31 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
32 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
33 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
34 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
35 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
36 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
37 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
38 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
39 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
40 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
47 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
48 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
49 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
207 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
208 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
209 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.16
Metatranscriptomes 1.41
Isolates 12.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 14.41
Nodule 0
Rhizoplane 3.95
Rhizosphere 58.47
Stem 0
Stem Tuber 0
Unclassified 22.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004858 3300002067 Bacteria 4481
2 JGI25164J39214_1000397 3300002772 Bacteria 25332
3 JGI25165J46597_1000005 3300003214 Bacteria 623702
4 rootL2_10062257 3300003322 Bacteria 1750
5 Ga0006562J51391_1006080 3300003578 Bacteria 11098
6 Ga0006562J51391_1006082 3300003578 Bacteria 4290
7 Ga0055539_1000014 3300003752 Bacteria 381086
8 Ga0055533_1000002 3300003756 Bacteria 1196393
9 Ga0055525_1000421 3300003759 Bacteria 25425
10 Ga0055525_1001814 3300003759 Bacteria 2942
11 Ga0055527_1000004 3300003760 Bacteria 570634
12 Ga0055542_1000019 3300003762 Bacteria 341174
13 Ga0055529_1000008 3300003763 Bacteria 394786
14 Ga0070658_10000298 3300005327 Bacteria 43158
15 Ga0070658_10035237 3300005327 Bacteria 4031
16 Ga0070658_10039424 3300005327 Bacteria 3811
17 Ga0070658_10055107 3300005327 Bacteria 3230
18 Ga0070690_100045890 3300005330 Bacteria 2777
19 Ga0070682_100044876 3300005337 Bacteria 2738
20 Ga0070682_100083837 3300005337 Bacteria 2070
21 Ga0068868_100377852 3300005338 Bacteria 1218
22 Ga0070660_100042247 3300005339 Bacteria 3479
23 Ga0070660_100413854 3300005339 Bacteria 1116
24 Ga0070661_100103383 3300005344 Bacteria 2121
25 Ga0070659_100000783 3300005366 Bacteria 23117
26 Ga0070659_100062048 3300005366 Bacteria 2954
27 Ga0070667_100032534 3300005367 Bacteria 4350
28 Ga0070714_100005110 3300005435 Bacteria 9981
29 Ga0070713_100624238 3300005436 Bacteria 1025
30 Ga0070685_10012833 3300005466 Bacteria 4409
31 Ga0068853_100011464 3300005539 Bacteria 7205
32 Ga0068853_100108666 3300005539 Bacteria 2461
33 Ga0070672_100129148 3300005543 Bacteria 2076
34 Ga0068855_100010920 3300005563 Bacteria 10962
35 Ga0068855_100182336 3300005563 Bacteria 2373
36 Ga0068857_100010949 3300005577 Bacteria 7893
37 Ga0068854_100299106 3300005578 Bacteria 1301
38 Ga0068852_100106792 3300005616 Bacteria 2539
39 Ga0068852_100107538 3300005616 Bacteria 2530
40 Ga0068859_100071413 3300005617 Bacteria 3508
41 Ga0068858_100000867 3300005842 Bacteria 31292
42 Ga0075365_10002458 3300006038 Bacteria 9098
43 Ga0075365_10005786 3300006038 Bacteria 6715
44 Ga0075369_10022083 3300006186 Bacteria 2623
45 Ga0097620_100071411 3300006931 Bacteria 3508
46 Ga0105244_10035749 3300009036 Bacteria 2608
47 Ga0105240_10011822 3300009093 Bacteria 12121
48 Ga0105240_10292597 3300009093 Bacteria 1866
49 Ga0105245_10004196 3300009098 Bacteria 12794
50 Ga0105247_10013352 3300009101 Bacteria 4930
51 Ga0105243_10080277 3300009148 Bacteria 2660
52 Ga0105241_10002520 3300009174 Bacteria 13742
53 Ga0105248_10007269 3300009177 Bacteria 12148
54 Ga0105237_10100332 3300009545 Bacteria 2886
55 Ga0105237_10100854 3300009545 Bacteria 2879
56 Ga0105238_10136855 3300009551 Bacteria 2427
57 Ga0157371_10086687 3300013102 Bacteria 2217
58 Ga0157370_10097567 3300013104 Bacteria 2757
59 Ga0157369_10026412 3300013105 Bacteria 6440
60 Ga0157369_10084741 3300013105 Bacteria 3387
61 Ga0157369_10240299 3300013105 Bacteria 1892
62 Ga0157369_10399219 3300013105 Bacteria 1426
63 Ga0157374_10582799 3300013296 Bacteria 1128
64 Ga0157372_10577232 3300013307 Bacteria 1310
65 Ga0157379_10019290 3300014968 Bacteria 6022
66 Ga0206354_10047148 3300020081 Bacteria 5041
67 Ga0206353_10036517 3300020082 Bacteria 7349
68 Ga0206353_11454628 3300020082 Bacteria 1761
69 Ga0209566_100056 3300025225 Bacteria 209595
70 Ga0209674_100001 3300025226 Bacteria 4013750
71 Ga0209672_100011 3300025228 Bacteria 856297
72 Ga0209563_100001 3300025230 Bacteria 4013775
73 Ga0209563_100335 3300025230 Bacteria 18136
74 Ga0207427_100024 3300025231 Bacteria 438403
75 Ga0209437_100243 3300025233 Bacteria 88712
76 Ga0209258_102049 3300025242 Bacteria 5744
77 Ga0209677_100001 3300025253 Bacteria 4013787
78 Ga0209677_101216 3300025253 Bacteria 11724
79 Ga0209148_1000023 3300025254 Bacteria 680511
80 Ga0209148_1000931 3300025254 Bacteria 19265
81 Ga0209233_1000001 3300025261 Bacteria 2992747
82 Ga0209455_1000023 3300025272 Bacteria 680449
83 Ga0209455_1000565 3300025272 Bacteria 24721
84 Ga0207655_1004351 3300025728 Bacteria 10076
85 Ga0207655_1024450 3300025728 Bacteria 2960
86 Ga0207647_10004822 3300025904 Bacteria 9977
87 Ga0207705_10000001 3300025909 Bacteria 2061880
88 Ga0207705_10166882 3300025909 Bacteria 1656
89 Ga0207654_10000001 3300025911 Bacteria 1816198
90 Ga0207695_10001965 3300025913 Bacteria 31843
91 Ga0207695_10114224 3300025913 Bacteria 2676
92 Ga0207695_10383851 3300025913 Bacteria 1290
93 Ga0207671_10082894 3300025914 Bacteria 2407
94 Ga0207671_10128664 3300025914 Bacteria 1942
95 Ga0207657_10096560 3300025919 Bacteria 2458
96 Ga0207694_10080900 3300025924 Bacteria 2550
97 Ga0207687_10018338 3300025927 Bacteria 4617
98 Ga0207700_10020137 3300025928 Bacteria 4523
99 Ga0207664_10002066 3300025929 Bacteria 13221
100 Ga0207690_10000713 3300025932 Bacteria 21429
101 Ga0207709_10004264 3300025935 Bacteria 8279
102 Ga0207691_10320742 3300025940 Bacteria 1328
103 Ga0207711_10012169 3300025941 Bacteria 7152
104 Ga0207711_10183693 3300025941 Bacteria 1903
105 Ga0207667_10003872 3300025949 Bacteria 18418
106 Ga0207667_10020205 3300025949 Bacteria 7412
107 Ga0207667_10029884 3300025949 Bacteria 5903
108 Ga0207658_10032533 3300025986 Bacteria 3712
109 Ga0207703_10000121 3300026035 Bacteria 94523
110 Ga0207639_10025875 3300026041 Bacteria 4259
111 Ga0207639_10106852 3300026041 Bacteria 2273
112 Ga0207678_10019846 3300026067 Bacteria 5908
113 Ga0207702_10094742 3300026078 Bacteria 2621
114 Ga0207702_10259014 3300026078 Bacteria 1637
115 Ga0207702_10321066 3300026078 Bacteria 1475
116 Ga0207674_10004042 3300026116 Bacteria 17798
117 Ga0207698_10005350 3300026142 Bacteria 7916
118 Ga0207698_10058374 3300026142 Bacteria 2990
119 Ga0307513_10025493 3300031456 Bacteria 6848
120 Ga0307514_10126020 3300031649 Bacteria 1774
121 Ga0307518_10177682 3300031838 Bacteria 1443
122 Ga0307416_100126040 3300032002 Bacteria 2294
123 Ga0307507_10005233 3300033179 Bacteria 21590
124 Ga0395899_0013247 3300037312 Bacteria 6310
125 Ga0395899_0025711 3300037312 Bacteria 4444
126 Ga0395900_0001470 3300037418 Bacteria 28112
127 Ga0395900_0053053 3300037418 Bacteria 4173
128 Ga0395898_0000355 3300037466 Bacteria 101003
129 Ga0395898_0610244 3300037466 Bacteria 1034
130 Ga0395901_0299355 3300038443 Bacteria 1668
131 Ga0439465_0032346 3300041413 Bacteria 1670
132 Ga0451791_1705021 3300041451 Bacteria 1537
133 Ga0439462_0005836 3300042015 Bacteria 3047
134 Ga0466965_0000004 3300044683 Bacteria 229348
135 Ga0466965_0154196 3300044683 Bacteria 1202
136 Ga0466961_0010348 3300044693 Bacteria 5948
137 Ga0466961_0148193 3300044693 Bacteria 1466
138 Ga0466961_0181630 3300044693 Bacteria 1306
139 Ga0466961_0182917 3300044693 Bacteria 1301
140 Ga0466963_0304781 3300044694 Bacteria 1121
141 Ga0466970_0038464 3300044765 Bacteria 2537
142 Ga0466970_0073000 3300044765 Bacteria 1846
143 Ga0466970_0099695 3300044765 Bacteria 1581
144 Ga0466957_0037964 3300044842 Bacteria 2901
145 Ga0466957_0050230 3300044842 Bacteria 2538
146 Ga0466960_0247307 3300044901 Bacteria 989
147 Ga0466959_0052709 3300045049 Bacteria 2978
148 Ga0466959_0223406 3300045049 Bacteria 1305
149 Ga0466967_0506050 3300045976 Bacteria 1186
150 Ga0495590_0000091 3300046457 Bacteria 55288
151 Ga0495650_0000211 3300046471 Bacteria 125248
152 Ga0495672_0022559 3300047320 Bacteria 4090
153 Ga0495672_0063499 3300047320 Bacteria 2119
154 Ga0496100_0143344 3300048903 Bacteria 1696
155 Ga0496102_0029611 3300048905 Bacteria 4900
156 Ga0496102_0613063 3300048905 Bacteria 1011
157 Ga0496103_0007844 3300048906 Bacteria 6345
158 Ga0496104_0047744 3300048907 Bacteria 4036
159 Ga0496104_0204064 3300048907 Bacteria 1888
160 Ga0496105_0066260 3300048908 Bacteria 2981
161 Ga0496107_0086229 3300048910 Bacteria 2292
162 Ga0496114_0036324 3300048917 Bacteria 4072
163 Ga0496114_0080296 3300048917 Bacteria 2754
164 Ga0496115_0028473 3300048918 Bacteria 4379
165 Ga0496115_0124841 3300048918 Bacteria 2120
166 Ga0496115_0174848 3300048918 Bacteria 1775
167 Ga0496116_0098782 3300048919 Bacteria 1750
168 Ga0496117_0000174 3300048920 Bacteria 132648
169 Ga0496117_0000964 3300048920 Bacteria 44066
170 Ga0496117_0000988 3300048920 Bacteria 43571
171 Ga0496117_0010998 3300048920 Bacteria 8147
172 Ga0496117_0011054 3300048920 Bacteria 8128
173 Ga0496117_0032545 3300048920 Bacteria 3960
174 Ga0496117_0052738 3300048920 Bacteria 2862
175 Ga0496117_0110585 3300048920 Bacteria 1712
176 Ga0496117_0166409 3300048920 Bacteria 1285
177 Ga0496118_0001023 3300048921 Bacteria 43511
178 Ga0496118_0012972 3300048921 Bacteria 7934
179 Ga0496118_0028229 3300048921 Bacteria 4732
180 Ga0496118_0036785 3300048921 Bacteria 3951
181 Ga0496118_0037274 3300048921 Bacteria 3917
182 Ga0496118_0046371 3300048921 Bacteria 3382
183 Ga0496119_0001425 3300048922 Bacteria 28914
184 Ga0496119_0004747 3300048922 Bacteria 13353
185 Ga0496119_0005538 3300048922 Bacteria 12031
186 Ga0496119_0005866 3300048922 Bacteria 11594
187 Ga0496119_0016295 3300048922 Bacteria 5665
188 Ga0496119_0026116 3300048922 Bacteria 4058
189 Ga0496119_0053427 3300048922 Bacteria 2468
190 Ga0496119_0064734 3300048922 Bacteria 2169
191 Ga0496120_0001113 3300048923 Bacteria 34863
192 Ga0496120_0004584 3300048923 Bacteria 11506
193 Ga0496120_0008857 3300048923 Bacteria 7217
194 Ga0496120_0014330 3300048923 Bacteria 5291
195 Ga0496120_0021735 3300048923 Bacteria 4048
196 Ga0496120_0027182 3300048923 Bacteria 3524
197 Ga0496120_0044676 3300048923 Bacteria 2572
198 Ga0496121_0000046 3300048924 Bacteria 335942
199 Ga0496121_0041971 3300048924 Bacteria 3988
200 Ga0496121_0094095 3300048924 Bacteria 2332
201 Ga0496121_0095367 3300048924 Bacteria 2312
202 Ga0496122_0000071 3300048925 Bacteria 222537
203 Ga0496122_0000235 3300048925 Bacteria 124769
204 Ga0496122_0001637 3300048925 Bacteria 34821
205 Ga0496122_0123911 3300048925 Bacteria 1659
206 Ga0496122_0165277 3300048925 Bacteria 1343
207 Ga0496123_0000006 3300048926 Bacteria 647258
208 Ga0496123_0000036 3300048926 Bacteria 265722
209 Ga0496123_0042348 3300048926 Bacteria 3143
210 Ga0496124_0000323 3300048927 Bacteria 88352
211 Ga0496124_0006954 3300048927 Bacteria 12152
212 Ga0496125_0015829 3300048928 Bacteria 7266
213 Ga0496126_0002769 3300048929 Bacteria 23107
214 Ga0496126_0038102 3300048929 Bacteria 4475
215 Ga0496126_0185990 3300048929 Bacteria 1762
216 Ga0501031_0004291 3300049568 Bacteria 9220
217 Ga0501031_0036199 3300049568 Bacteria 3220
218 Ga0501032_0050649 3300049569 Bacteria 2800
219 Ga0501032_0059247 3300049569 Bacteria 2570
220 Ga0501032_0153001 3300049569 Bacteria 1516
221 Ga0501033_0008500 3300049570 Bacteria 7944
222 Ga0501033_0010186 3300049570 Bacteria 7219
223 Ga0501033_0029502 3300049570 Bacteria 4122
224 Ga0501033_0062414 3300049570 Bacteria 2744
225 Ga0501033_0107671 3300049570 Bacteria 2030
226 Ga0501033_0189576 3300049570 Bacteria 1472
227 Ga0501034_0002837 3300049571 Bacteria 20198
228 Ga0501034_0035337 3300049571 Bacteria 5066
229 Ga0501034_0049941 3300049571 Bacteria 4220
230 Ga0501034_0066419 3300049571 Bacteria 3620
231 Ga0501034_0067572 3300049571 Bacteria 3586
232 Ga0501034_0104109 3300049571 Bacteria 2831
233 Ga0501034_0144109 3300049571 Bacteria 2360
234 Ga0501034_0148422 3300049571 Bacteria 2321
235 Ga0501034_0319702 3300049571 Bacteria 1485
236 Ga0501036_0035942 3300049572 Bacteria 4192
237 Ga0501037_0001056 3300049573 Bacteria 20390
238 Ga0501037_0084604 3300049573 Bacteria 2297
239 Ga0501037_0114478 3300049573 Bacteria 1941
240 Ga0501037_0130757 3300049573 Bacteria 1800
241 Ga0501037_0131877 3300049573 Bacteria 1792
242 Ga0501037_0157727 3300049573 Bacteria 1619
243 Ga0501037_0340940 3300049573 Bacteria 1035
244 Ga0501038_0021966 3300049574 Bacteria 5723
245 Ga0501038_0072159 3300049574 Bacteria 2926
246 Ga0501038_0148504 3300049574 Bacteria 1912
247 Ga0501038_0462772 3300049574 Bacteria 974
248 Ga0501039_0361517 3300049575 Bacteria 1140
249 Ga0501042_0007500 3300049578 Bacteria 7149
250 Ga0501043_0001586 3300049579 Bacteria 19754
251 Ga0501043_0034912 3300049579 Bacteria 3955
252 Ga0501043_0180566 3300049579 Bacteria 1644
253 Ga0501046_0031040 3300049580 Bacteria 4334
254 Ga0501046_0049498 3300049580 Bacteria 3323
255 Ga0501047_0006847 3300049581 Bacteria 10709
256 Ga0501047_0021788 3300049581 Bacteria 6153
257 Ga0501047_0065962 3300049581 Bacteria 3489
258 Ga0501047_0070058 3300049581 Bacteria 3376
259 Ga0501047_0155844 3300049581 Bacteria 2158
260 Ga0501048_0007540 3300049582 Bacteria 8245
261 Ga0501067_0070493 3300049583 Bacteria 1936
262 Ga0501068_0128710 3300049584 Bacteria 1582
263 Ga0501069_0024065 3300049585 Bacteria 3322
264 Ga0501069_0156016 3300049585 Bacteria 1313
265 Ga0501070_0000407 3300049586 Bacteria 39131
266 Ga0501070_0061984 3300049586 Bacteria 3098
267 Ga0501070_0419550 3300049586 Bacteria 1081
268 Ga0501072_0029509 3300049588 Bacteria 4285
269 Ga0501073_0011248 3300049589 Bacteria 6547
270 Ga0501073_0038283 3300049589 Bacteria 3403
271 Ga0501077_0267048 3300049593 Bacteria 1088
272 Ga0501080_0010478 3300049742 Bacteria 8488
273 Ga0501080_0048839 3300049742 Bacteria 3937
274 Ga0501083_0000178 3300049744 Bacteria 41100
275 Ga0501083_0010591 3300049744 Bacteria 6492
276 Ga0501083_0016310 3300049744 Bacteria 5202
277 Ga0501035_0002897 3300049822 Bacteria 16522
278 Ga0501035_0044463 3300049822 Bacteria 3999
279 Ga0501035_0049454 3300049822 Bacteria 3767
280 Ga0501035_0060481 3300049822 Bacteria 3372
281 Ga0501035_0196966 3300049822 Bacteria 1730
282 Ga0501044_0002388 3300049823 Bacteria 21404
283 Ga0501044_0033799 3300049823 Bacteria 5369
284 Ga0501044_0193892 3300049823 Bacteria 1992
285 Ga0501044_0292519 3300049823 Bacteria 1560
286 Ga0501044_0420702 3300049823 Bacteria 1246
287 nmdc:mga00v17_28267_c1 3300050491 Bacteria 3283
288 nmdc:mga00v17_43141_c1 3300050491 Bacteria 2715
289 nmdc:mga0yw44_13884_c1 3300050492 Bacteria 4257
290 nmdc:mga0sz30_8410_c1 3300050516 Bacteria 3897
291 Ga0500635_0000241 3300053080 Bacteria 23974
292 Ga0500651_0000692 3300053093 Bacteria 16729
293 Ga0500556_0000133 3300053104 Bacteria 63387
294 Ga0500559_0000534 3300053136 Bacteria 26496
295 Ga0500559_0004644 3300053136 Bacteria 6477
296 Ga0500568_0000007 3300053139 Bacteria 292579
297 Ga0500568_0000099 3300053139 Bacteria 80197
298 Ga0500568_0003779 3300053139 Bacteria 8288
299 Ga0500568_0006347 3300053139 Bacteria 5945
300 Ga0500573_0000005 3300053140 Bacteria 315762
301 Ga0500573_0001951 3300053140 Bacteria 10078
302 Ga0500573_0162087 3300053140 Bacteria 1216
303 Ga0500573_0202246 3300053140 Bacteria 1053
304 Ga0500588_0009258 3300053146 Bacteria 2336
305 Ga0500590_002660 3300053148 Bacteria 8024
306 Ga0500604_0002879 3300053151 Unclassified 4663
307 Ga0500616_0000010 3300053153 Bacteria 761410
308 Ga0500616_0000807 3300053153 Bacteria 35698
309 Ga0500620_000019 3300053155 Bacteria 32857
310 Ga0500645_004661 3300053730 Bacteria 5219

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0036199 Ga0501031_0036199_2280_3086 238
2 3300049574 Ga0501038_0148504 Ga0501038_0148504_1049_1855 238
3 3300047320 Ga0495672_0063499 Ga0495672_0063499_592_1419 243
4 3300053151 Ga0500604_0002879 Ga0500604_0002879_2600_3427 243
5 3300044683 Ga0466965_0000004 Ga0466965_0000004_166447_167262 244
6 3300048922 Ga0496119_0016295 Ga0496119_0016295_3576_4388 244
7 3300048923 Ga0496120_0014330 Ga0496120_0014330_1178_1990 244
8 3300050491 nmdc:mga00v17_43141_c1 nmdc:mga00v17_43141_c1_147_962 245
9 3300006038 Ga0075365_10002458 Ga0075365_100024583 246
10 3300044693 Ga0466961_0182917 Ga0466961_0182917_459_1268 246
11 3300048923 Ga0496120_0008857 Ga0496120_0008857_4578_5372 246
12 3300050492 nmdc:mga0yw44_13884_c1 nmdc:mga0yw44_13884_c1_1072_1887 246
13 3300053140 Ga0500573_0162087 Ga0500573_0162087_242_997 246
14 3300053140 Ga0500573_0202246 Ga0500573_0202246_244_999 246
15 3300006038 Ga0075365_10005786 Ga0075365_100057863 247
16 3300009148 Ga0105243_10080277 Ga0105243_100802772 247
17 3300013102 Ga0157371_10086687 Ga0157371_100866872 247
18 3300025919 Ga0207657_10096560 Ga0207657_100965602 247
19 3300005327 Ga0070658_10000298 Ga0070658_1000029841 248
20 3300005337 Ga0070682_100083837 Ga0070682_1000838371 248
21 3300005366 Ga0070659_100062048 Ga0070659_1000620482 248
22 3300013104 Ga0157370_10097567 Ga0157370_100975673 248
23 3300025909 Ga0207705_10000001 Ga0207705_10000001993 248
24 3300026067 Ga0207678_10019846 Ga0207678_100198463 248
25 3300031649 Ga0307514_10126020 Ga0307514_101260202 248
26 3300050491 nmdc:mga00v17_28267_c1 nmdc:mga00v17_28267_c1_2172_2987 248
27 3300049578 Ga0501042_0007500 Ga0501042_0007500_5788_6687 249
28 3300053140 Ga0500573_0001951 Ga0500573_0001951_1349_2113 249
29 3300041451 Ga0451791_1705021 Ga0451791_1705021_718_1485 250
30 3300048929 Ga0496126_0002769 Ga0496126_0002769_5134_5973 250
31 3300053093 Ga0500651_0000692 Ga0500651_0000692_15452_16255 250
32 3300053136 Ga0500559_0000534 Ga0500559_0000534_16708_17517 250
33 3300053148 Ga0500590_002660 Ga0500590_002660_3564_4367 250
34 3300005339 Ga0070660_100413854 Ga0070660_1004138542 251
35 3300049569 Ga0501032_0153001 Ga0501032_0153001_485_1291 251
36 3300049571 Ga0501034_0319702 Ga0501034_0319702_316_1122 251
37 3300049573 Ga0501037_0084604 Ga0501037_0084604_911_1717 251
38 3300049574 Ga0501038_0072159 Ga0501038_0072159_1797_2603 251
39 3300049575 Ga0501039_0361517 Ga0501039_0361517_249_1055 251
40 3300044765 Ga0466970_0099695 Ga0466970_0099695_301_1104 252
41 3300046471 Ga0495650_0000211 Ga0495650_0000211_122782_123621 252
42 3300053104 Ga0500556_0000133 Ga0500556_0000133_16705_17520 252
43 iso_pu_bacteria 2966921586 2966922881 252
44 3300003760 Ga0055527_1000004 Ga0055527_1000004356 253
45 3300003762 Ga0055542_1000019 Ga0055542_1000019144 253
46 3300003763 Ga0055529_1000008 Ga0055529_1000008221 253
47 3300006186 Ga0075369_10022083 Ga0075369_100220833 253
48 3300013105 Ga0157369_10026412 Ga0157369_100264123 253
49 3300025228 Ga0209672_100011 Ga0209672_100011356 253
50 3300025242 Ga0209258_102049 Ga0209258_1020495 253
51 3300025254 Ga0209148_1000023 Ga0209148_1000023194 253
52 3300025272 Ga0209455_1000023 Ga0209455_1000023194 253
53 3300042015 Ga0439462_0005836 Ga0439462_0005836_1543_2346 253
54 3300048919 Ga0496116_0098782 Ga0496116_0098782_560_1381 253
55 3300048920 Ga0496117_0052738 Ga0496117_0052738_532_1353 253
56 3300048921 Ga0496118_0012972 Ga0496118_0012972_4539_5360 253
57 3300048922 Ga0496119_0026116 Ga0496119_0026116_1316_2137 253
58 3300048923 Ga0496120_0004584 Ga0496120_0004584_2315_3136 253
59 3300048925 Ga0496122_0000071 Ga0496122_0000071_49838_50659 253
60 3300048926 Ga0496123_0000006 Ga0496123_0000006_474562_475383 253
61 3300048927 Ga0496124_0006954 Ga0496124_0006954_998_1819 253
62 3300048928 Ga0496125_0015829 Ga0496125_0015829_3248_4069 253
63 3300048929 Ga0496126_0038102 Ga0496126_0038102_560_1381 253
64 3300049571 Ga0501034_0035337 Ga0501034_0035337_1591_2421 253
65 3300049573 Ga0501037_0114478 Ga0501037_0114478_25_855 253
66 3300049579 Ga0501043_0001586 Ga0501043_0001586_4641_5471 253
67 3300049581 Ga0501047_0065962 Ga0501047_0065962_170_1000 253
68 3300049583 Ga0501067_0070493 Ga0501067_0070493_172_1002 253
69 3300049585 Ga0501069_0024065 Ga0501069_0024065_352_1182 253
70 3300049589 Ga0501073_0011248 Ga0501073_0011248_1675_2505 253
71 3300049593 Ga0501077_0267048 Ga0501077_0267048_182_1012 253
72 3300049742 Ga0501080_0010478 Ga0501080_0010478_5187_6017 253
73 3300049744 Ga0501083_0010591 Ga0501083_0010591_2266_3096 253
74 3300005327 Ga0070658_10035237 Ga0070658_100352373 254
75 3300005338 Ga0068868_100377852 Ga0068868_1003778522 254
76 3300005339 Ga0070660_100042247 Ga0070660_1000422472 254
77 3300005344 Ga0070661_100103383 Ga0070661_1001033832 254
78 3300005366 Ga0070659_100000783 Ga0070659_10000078313 254
79 3300005367 Ga0070667_100032534 Ga0070667_1000325343 254
80 3300005466 Ga0070685_10012833 Ga0070685_100128333 254
81 3300005539 Ga0068853_100011464 Ga0068853_1000114642 254
82 3300005563 Ga0068855_100010920 Ga0068855_1000109207 254
83 3300005563 Ga0068855_100182336 Ga0068855_1001823363 254
84 3300005578 Ga0068854_100299106 Ga0068854_1002991062 254
85 3300005616 Ga0068852_100106792 Ga0068852_1001067923 254
86 3300005617 Ga0068859_100071413 Ga0068859_1000714132 254
87 3300005842 Ga0068858_100000867 Ga0068858_1000008672 254
88 3300006931 Ga0097620_100071411 Ga0097620_1000714112 254
89 3300009093 Ga0105240_10292597 Ga0105240_102925972 254
90 3300009098 Ga0105245_10004196 Ga0105245_1000419611 254
91 3300009551 Ga0105238_10136855 Ga0105238_101368553 254
92 3300014968 Ga0157379_10019290 Ga0157379_100192902 254
93 3300025913 Ga0207695_10114224 Ga0207695_101142243 254
94 3300025913 Ga0207695_10383851 Ga0207695_103838512 254
95 3300025924 Ga0207694_10080900 Ga0207694_100809002 254
96 3300025927 Ga0207687_10018338 Ga0207687_100183383 254
97 3300025932 Ga0207690_10000713 Ga0207690_100007132 254
98 3300025941 Ga0207711_10183693 Ga0207711_101836932 254
99 3300025949 Ga0207667_10003872 Ga0207667_100038726 254
100 3300025949 Ga0207667_10020205 Ga0207667_100202053 254
101 3300025949 Ga0207667_10029884 Ga0207667_100298842 254
102 3300025986 Ga0207658_10032533 Ga0207658_100325332 254
103 3300026035 Ga0207703_10000121 Ga0207703_1000012168 254
104 3300026041 Ga0207639_10025875 Ga0207639_100258752 254
105 3300026078 Ga0207702_10259014 Ga0207702_102590142 254
106 3300026078 Ga0207702_10321066 Ga0207702_103210662 254
107 3300026142 Ga0207698_10058374 Ga0207698_100583742 254
108 3300048920 Ga0496117_0110585 Ga0496117_0110585_358_1176 254
109 3300048924 Ga0496121_0041971 Ga0496121_0041971_875_1693 254
110 3300048929 Ga0496126_0185990 Ga0496126_0185990_333_1148 254
111 3300053139 Ga0500568_0000099 Ga0500568_0000099_68661_69467 254
112 3300053139 Ga0500568_0003779 Ga0500568_0003779_1601_2410 254
113 iso_pu_bacteria 2857733635 2857735031 254
114 3300005330 Ga0070690_100045890 Ga0070690_1000458903 255
115 3300005539 Ga0068853_100108666 Ga0068853_1001086662 255
116 3300005543 Ga0070672_100129148 Ga0070672_1001291482 255
117 3300009101 Ga0105247_10013352 Ga0105247_100133523 255
118 3300009177 Ga0105248_10007269 Ga0105248_100072693 255
119 3300009545 Ga0105237_10100332 Ga0105237_101003323 255
120 3300025728 Ga0207655_1024450 Ga0207655_10244502 255
121 3300025914 Ga0207671_10082894 Ga0207671_100828942 255
122 3300025940 Ga0207691_10320742 Ga0207691_103207422 255
123 3300026041 Ga0207639_10106852 Ga0207639_101068522 255
124 3300044693 Ga0466961_0181630 Ga0466961_0181630_272_1063 255
125 3300044694 Ga0466963_0304781 Ga0466963_0304781_203_994 255
126 3300044842 Ga0466957_0050230 Ga0466957_0050230_250_1041 255
127 3300044901 Ga0466960_0247307 Ga0466960_0247307_110_901 255
128 3300046457 Ga0495590_0000091 Ga0495590_0000091_32224_33060 255
129 3300048920 Ga0496117_0000174 Ga0496117_0000174_129577_130410 255
130 3300048920 Ga0496117_0000988 Ga0496117_0000988_41669_42484 255
131 3300048921 Ga0496118_0001023 Ga0496118_0001023_41653_42468 255
132 3300048922 Ga0496119_0004747 Ga0496119_0004747_10364_11206 255
133 3300048922 Ga0496119_0053427 Ga0496119_0053427_11_826 255
134 3300048923 Ga0496120_0021735 Ga0496120_0021735_1380_2222 255
135 3300048923 Ga0496120_0044676 Ga0496120_0044676_723_1538 255
136 3300048925 Ga0496122_0123911 Ga0496122_0123911_55_870 255
137 3300048926 Ga0496123_0042348 Ga0496123_0042348_1188_2003 255
138 3300048927 Ga0496124_0000323 Ga0496124_0000323_1058_1873 255
139 3300049569 Ga0501032_0059247 Ga0501032_0059247_317_1132 255
140 3300049573 Ga0501037_0001056 Ga0501037_0001056_7040_7855 255
141 3300049579 Ga0501043_0180566 Ga0501043_0180566_689_1504 255
142 3300049581 Ga0501047_0006847 Ga0501047_0006847_9835_10650 255
143 3300049744 Ga0501083_0000178 Ga0501083_0000178_10492_11391 255
144 3300049822 Ga0501035_0002897 Ga0501035_0002897_6238_7053 255
145 3300049823 Ga0501044_0002388 Ga0501044_0002388_8791_9606 255
146 3300053146 Ga0500588_0009258 Ga0500588_0009258_1183_2022 255
147 3300053153 Ga0500616_0000807 Ga0500616_0000807_25447_26262 255
148 3300005577 Ga0068857_100010949 Ga0068857_1000109496 256
149 3300005616 Ga0068852_100107538 Ga0068852_1001075383 256
150 3300009093 Ga0105240_10011822 Ga0105240_100118227 256
151 3300009174 Ga0105241_10002520 Ga0105241_100025205 256
152 3300009545 Ga0105237_10100854 Ga0105237_101008542 256
153 3300025254 Ga0209148_1000931 Ga0209148_100093110 256
154 3300025728 Ga0207655_1004351 Ga0207655_10043516 256
155 3300025911 Ga0207654_10000001 Ga0207654_10000001439 256
156 3300025913 Ga0207695_10001965 Ga0207695_1000196511 256
157 3300025914 Ga0207671_10128664 Ga0207671_101286642 256
158 3300025935 Ga0207709_10004264 Ga0207709_100042644 256
159 3300026116 Ga0207674_10004042 Ga0207674_1000404210 256
160 3300026142 Ga0207698_10005350 Ga0207698_100053505 256
161 3300041413 Ga0439465_0032346 Ga0439465_0032346_562_1383 256
162 3300047320 Ga0495672_0022559 Ga0495672_0022559_3080_3919 256
163 3300048905 Ga0496102_0029611 Ga0496102_0029611_669_1529 256
164 3300048920 Ga0496117_0010998 Ga0496117_0010998_2083_2943 256
165 3300048921 Ga0496118_0028229 Ga0496118_0028229_3345_4205 256
166 3300048924 Ga0496121_0094095 Ga0496121_0094095_1418_2236 256
167 3300049571 Ga0501034_0144109 Ga0501034_0144109_1291_2094 256
168 3300049581 Ga0501047_0070058 Ga0501047_0070058_653_1555 256
169 iso_pu_bacteria 2904501621 2904502425 256
170 iso_pu_bacteria 2908674828 2908677436 256
171 iso_pu_bacteria 2928500415 2928503607 256
172 3300048925 Ga0496122_0165277 Ga0496122_0165277_14_829 257
173 3300049570 Ga0501033_0029502 Ga0501033_0029502_2100_2906 257
174 3300049572 Ga0501036_0035942 Ga0501036_0035942_3256_4062 257
175 3300049573 Ga0501037_0340940 Ga0501037_0340940_110_916 257
176 3300049584 Ga0501068_0128710 Ga0501068_0128710_475_1281 257
177 3300049586 Ga0501070_0061984 Ga0501070_0061984_460_1266 257
178 3300050516 nmdc:mga0sz30_8410_c1 nmdc:mga0sz30_8410_c1_1911_2726 257
179 3300053139 Ga0500568_0006347 Ga0500568_0006347_3520_4308 257
180 iso_pu_bacteria 2585428157 2588107466 257
181 3300013296 Ga0157374_10582799 Ga0157374_105827991 258
182 3300025941 Ga0207711_10012169 Ga0207711_100121698 258
183 3300048925 Ga0496122_0001637 Ga0496122_0001637_12441_13274 258
184 3300049571 Ga0501034_0002837 Ga0501034_0002837_13937_14728 258
185 3300049571 Ga0501034_0049941 Ga0501034_0049941_2797_3591 258
186 3300049573 Ga0501037_0157727 Ga0501037_0157727_579_1370 258
187 3300049588 Ga0501072_0029509 Ga0501072_0029509_1263_2054 258
188 3300049589 Ga0501073_0038283 Ga0501073_0038283_237_1028 258
189 3300053136 Ga0500559_0004644 Ga0500559_0004644_4010_4870 258
190 3300048920 Ga0496117_0000964 Ga0496117_0000964_40106_40945 259
191 3300048920 Ga0496117_0032545 Ga0496117_0032545_900_1733 259
192 3300048921 Ga0496118_0036785 Ga0496118_0036785_2549_3388 259
193 3300048921 Ga0496118_0046371 Ga0496118_0046371_457_1290 259
194 3300048922 Ga0496119_0001425 Ga0496119_0001425_23545_24384 259
195 3300048922 Ga0496119_0005538 Ga0496119_0005538_9565_10398 259
196 3300048923 Ga0496120_0001113 Ga0496120_0001113_4601_5434 259
197 3300053140 Ga0500573_0000005 Ga0500573_0000005_153993_154790 259
198 3300049823 Ga0501044_0420702 Ga0501044_0420702_226_1029 260
199 iso_pu_bacteria 2757320536 2758225432 260
200 iso_pu_bacteria 8004212874 8004212943 260
201 iso_pu_bacteria 8016254467 8016255847 260
202 3300048908 Ga0496105_0066260 Ga0496105_0066260_1605_2435 261
203 3300049573 Ga0501037_0131877 Ga0501037_0131877_721_1572 261
204 3300049574 Ga0501038_0462772 Ga0501038_0462772_73_924 261
205 3300049580 Ga0501046_0049498 Ga0501046_0049498_1039_1890 261
206 3300049581 Ga0501047_0155844 Ga0501047_0155844_1056_1907 261
207 3300049586 Ga0501070_0419550 Ga0501070_0419550_139_990 261
208 3300053153 Ga0500616_0000010 Ga0500616_0000010_331288_332163 261
209 3300053155 Ga0500620_000019 Ga0500620_000019_1265_2122 261
210 iso_pu_bacteria 2643221546 2643751847 261
211 iso_pu_bacteria 2643221597 2643997272 261
212 iso_pu_bacteria 2773857758 2774379567 261
213 iso_pu_bacteria 2904509784 2904512948 261
214 iso_pu_bacteria 2908678064 2908679410 261
215 iso_pu_bacteria 2919069694 2919070049 261
216 iso_pu_bacteria 2974294766 2974295623 261
217 iso_pu_bacteria 2974324384 2974324574 261
218 iso_pu_bacteria 2977228692 2977229607 261
219 iso_pu_bacteria 2977236895 2977238345 261
220 iso_pu_bacteria 2977264416 2977264871 261
221 iso_pu_bacteria 2984542743 2984543873 261
222 3300045976 Ga0466967_0506050 Ga0466967_0506050_287_1168 262
223 iso_pu_bacteria 2643221566 2643847306 262
224 3300002772 JGI25164J39214_1000397 JGI25164J39214_10003973 263
225 3300003214 JGI25165J46597_1000005 JGI25165J46597_1000005387 263
226 3300025231 Ga0207427_100024 Ga0207427_100024219 263
227 3300025233 Ga0209437_100243 Ga0209437_10024327 263
228 3300025261 Ga0209233_1000001 Ga0209233_1000001262 263
229 3300049570 Ga0501033_0189576 Ga0501033_0189576_173_1033 263
230 iso_pu_bacteria 2643221649 2644280203 263
231 iso_pu_bacteria 2844852863 2844853594 263
232 3300048920 Ga0496117_0166409 Ga0496117_0166409_205_1014 264
233 iso_pu_bacteria 2906799679 2906802839 264
234 iso_pu_bacteria 8056037122 8056040393 264
235 iso_pu_bacteria 8057345674 8057346576 264
236 3300048917 Ga0496114_0080296 Ga0496114_0080296_198_1013 265
237 3300049571 Ga0501034_0066419 Ga0501034_0066419_98_1123 265
238 3300049742 Ga0501080_0048839 Ga0501080_0048839_2735_3676 265
239 3300053139 Ga0500568_0000007 Ga0500568_0000007_215749_216561 265
240 iso_pu_bacteria 2582580736 2583152010 265
241 iso_pu_bacteria 2585428094 2587861917 265
242 iso_pu_bacteria 2917736166 2917739061 265
243 3300005327 Ga0070658_10055107 Ga0070658_100551074 266
244 3300032002 Ga0307416_100126040 Ga0307416_1001260402 266
245 3300033179 Ga0307507_10005233 Ga0307507_1000523318 266
246 3300037466 Ga0395898_0610244 Ga0395898_0610244_171_1010 266
247 3300048918 Ga0496115_0174848 Ga0496115_0174848_100_984 266
248 3300049570 Ga0501033_0010186 Ga0501033_0010186_1692_2717 266
249 3300049822 Ga0501035_0049454 Ga0501035_0049454_886_1911 266
250 3300049823 Ga0501044_0033799 Ga0501044_0033799_2556_3581 266
251 iso_pu_bacteria 2857729791 2857730683 266
252 3300005337 Ga0070682_100044876 Ga0070682_1000448762 267
253 3300005435 Ga0070714_100005110 Ga0070714_1000051102 267
254 3300005436 Ga0070713_100624238 Ga0070713_1006242382 267
255 3300013105 Ga0157369_10084741 Ga0157369_100847412 267
256 3300013105 Ga0157369_10240299 Ga0157369_102402992 267
257 3300013307 Ga0157372_10577232 Ga0157372_105772322 267
258 3300020082 Ga0206353_11454628 Ga0206353_114546282 267
259 3300025904 Ga0207647_10004822 Ga0207647_100048228 267
260 3300025928 Ga0207700_10020137 Ga0207700_100201373 267
261 3300025929 Ga0207664_10002066 Ga0207664_1000206610 267
262 3300031838 Ga0307518_10177682 Ga0307518_101776822 267
263 3300037312 Ga0395899_0025711 Ga0395899_0025711_937_1797 267
264 3300037418 Ga0395900_0001470 Ga0395900_0001470_11900_12760 267
265 3300037466 Ga0395898_0000355 Ga0395898_0000355_27681_28541 267
266 3300048905 Ga0496102_0613063 Ga0496102_0613063_54_914 267
267 3300048906 Ga0496103_0007844 Ga0496103_0007844_3777_4637 267
268 3300048907 Ga0496104_0204064 Ga0496104_0204064_472_1332 267
269 3300048917 Ga0496114_0036324 Ga0496114_0036324_1635_2495 267
270 3300048918 Ga0496115_0028473 Ga0496115_0028473_105_965 267
271 3300048921 Ga0496118_0037274 Ga0496118_0037274_1335_2195 267
272 3300048922 Ga0496119_0005866 Ga0496119_0005866_1989_2819 267
273 3300048922 Ga0496119_0064734 Ga0496119_0064734_1195_2055 267
274 3300048923 Ga0496120_0027182 Ga0496120_0027182_991_1830 267
275 3300048924 Ga0496121_0000046 Ga0496121_0000046_150621_151439 267
276 3300048924 Ga0496121_0095367 Ga0496121_0095367_1081_1941 267
277 3300048925 Ga0496122_0000235 Ga0496122_0000235_43496_44335 267
278 3300048926 Ga0496123_0000036 Ga0496123_0000036_80439_81278 267
279 3300049568 Ga0501031_0004291 Ga0501031_0004291_5306_6247 267
280 3300049569 Ga0501032_0050649 Ga0501032_0050649_1584_2525 267
281 3300049570 Ga0501033_0008500 Ga0501033_0008500_2339_3280 267
282 3300049570 Ga0501033_0107671 Ga0501033_0107671_375_1358 267
283 3300049571 Ga0501034_0067572 Ga0501034_0067572_1895_2878 267
284 3300049571 Ga0501034_0104109 Ga0501034_0104109_53_994 267
285 3300049573 Ga0501037_0130757 Ga0501037_0130757_683_1666 267
286 3300049574 Ga0501038_0021966 Ga0501038_0021966_3238_4179 267
287 3300049579 Ga0501043_0034912 Ga0501043_0034912_2760_3701 267
288 3300049580 Ga0501046_0031040 Ga0501046_0031040_3341_4282 267
289 3300049582 Ga0501048_0007540 Ga0501048_0007540_5043_5984 267
290 3300049822 Ga0501035_0060481 Ga0501035_0060481_655_1638 267
291 3300049823 Ga0501044_0193892 Ga0501044_0193892_104_1045 267
292 3300053730 Ga0500645_004661 Ga0500645_004661_2462_3328 267
293 3300037418 Ga0395900_0053053 Ga0395900_0053053_1859_2809 268
294 3300049585 Ga0501069_0156016 Ga0501069_0156016_133_1113 268
295 iso_pu_bacteria 2537561592 2537900490 268
296 iso_pu_bacteria 2856741275 2856746860 268
297 iso_pu_bacteria 2891562705 2891565128 268
298 3300031456 Ga0307513_10025493 Ga0307513_100254933 269
299 3300049570 Ga0501033_0062414 Ga0501033_0062414_926_1825 269
300 3300049581 Ga0501047_0021788 Ga0501047_0021788_3414_4397 269
301 3300049744 Ga0501083_0016310 Ga0501083_0016310_4276_5175 269
302 3300049822 Ga0501035_0196966 Ga0501035_0196966_683_1582 269
303 iso_pu_bacteria 2751185788 2753300546 269
304 iso_pu_bacteria 2919042368 2919045253 269
305 iso_pu_bacteria 2928104781 2928106912 269
306 iso_pu_bacteria 2939660829 2939661447 269
307 iso_pu_bacteria 2984551494 2984552659 269
308 iso_pu_bacteria 2643221632 2644181879 271
309 3300049571 Ga0501034_0148422 Ga0501034_0148422_241_1086 273
310 3300049823 Ga0501044_0292519 Ga0501044_0292519_123_986 273
311 3300044683 Ga0466965_0154196 Ga0466965_0154196_232_1092 274
312 iso_pu_bacteria 2919055335 2919056246 275
313 3300005327 Ga0070658_10039424 Ga0070658_100394242 276
314 3300013105 Ga0157369_10399219 Ga0157369_103992192 276
315 3300020081 Ga0206354_10047148 Ga0206354_100471482 276
316 3300020082 Ga0206353_10036517 Ga0206353_100365172 276
317 3300025253 Ga0209677_101216 Ga0209677_1012165 276
318 3300025909 Ga0207705_10166882 Ga0207705_101668822 276
319 3300026078 Ga0207702_10094742 Ga0207702_100947423 276
320 3300037312 Ga0395899_0013247 Ga0395899_0013247_1362_2222 276
321 3300038443 Ga0395901_0299355 Ga0395901_0299355_35_895 276
322 3300044693 Ga0466961_0010348 Ga0466961_0010348_4843_5703 276
323 3300044765 Ga0466970_0073000 Ga0466970_0073000_131_991 276
324 3300045049 Ga0466959_0223406 Ga0466959_0223406_106_966 276
325 3300048918 Ga0496115_0124841 Ga0496115_0124841_451_1335 276
326 3300049586 Ga0501070_0000407 Ga0501070_0000407_23054_23914 276
327 3300049822 Ga0501035_0044463 Ga0501035_0044463_2760_3620 276
328 3300048903 Ga0496100_0143344 Ga0496100_0143344_82_966 277
329 3300048907 Ga0496104_0047744 Ga0496104_0047744_865_1749 277
330 3300048910 Ga0496107_0086229 Ga0496107_0086229_343_1221 277
331 iso_pu_bacteria 2844841374 2844844280 277
332 iso_pu_bacteria 2919523602 2919526248 277
333 iso_pu_bacteria 2928153084 2928154375 277
334 3300003322 rootL2_10062257 rootL2_100622572 279
335 3300003752 Ga0055539_1000014 Ga0055539_100001454 279
336 3300003756 Ga0055533_1000002 Ga0055533_1000002841 279
337 3300003759 Ga0055525_1000421 Ga0055525_10004216 279
338 3300003759 Ga0055525_1001814 Ga0055525_10018142 279
339 3300025225 Ga0209566_100056 Ga0209566_100056171 279
340 3300025226 Ga0209674_100001 Ga0209674_1000012725 279
341 3300025230 Ga0209563_100001 Ga0209563_1000012725 279
342 3300025230 Ga0209563_100335 Ga0209563_10033515 279
343 3300025253 Ga0209677_100001 Ga0209677_1000012725 279
344 3300025272 Ga0209455_1000565 Ga0209455_100056528 279
345 3300044693 Ga0466961_0148193 Ga0466961_0148193_113_973 279
346 3300044765 Ga0466970_0038464 Ga0466970_0038464_1651_2511 279
347 3300044842 Ga0466957_0037964 Ga0466957_0037964_533_1393 279
348 3300045049 Ga0466959_0052709 Ga0466959_0052709_1815_2675 279
349 3300053080 Ga0500635_0000241 Ga0500635_0000241_15821_16705 279
350 3300002067 JGI24735J21928_10004858 JGI24735J21928_100048583 281
351 3300003578 Ga0006562J51391_1006080 Ga0006562J51391_10060803 281
352 3300003578 Ga0006562J51391_1006082 Ga0006562J51391_10060823 281
353 3300009036 Ga0105244_10035749 Ga0105244_100357493 281
354 3300048920 Ga0496117_0011054 Ga0496117_0011054_291_1151 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

191

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.914 16 247
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9022 15 247
7kyo-assembly1.cif.gz_B psabc from streptococcus pneumoniae in complex with fab 0.8836 18 250
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.8831 18 247
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.8803 15 247
ID Description Score Start End Superfamily
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9089 18 250 3.40.50.300
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9059 15 247 3.40.50.300
2nq2C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9022 15 247 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9001 17 247 3.40.50.300
af_P0A9X1_1_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8967 15 244 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5R9AMN4-F1-model_v4 Metal ABC transporter ATP-binding protein 0.9338 16 231 GO:0005524
GO:0016887
AF-A0A1H5GCX7-F1-model_v4 Iron complex transport system ATP-binding protein 0.9214 18 247 GO:0005524
GO:0016887
AF-A0A7X3RY25-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9168 16 247 GO:0005524
GO:0016887
AF-A0A6P1MAD8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9149 15 248 GO:0005524
GO:0016887
AF-A0A535BEJ5-F1-model_v4 ABC transporter ATP-binding protein 0.9148 15 247 GO:0004842
GO:0005524
GO:0016567
GO:0016887

Feature Viewer

pLDDT pTM Quality
82.14 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map