F419741

General Info

Members Datasets Scaffolds Average Seq Length
354 231 708 97

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10861217|Ga0105243_108612172
Length 107
Sequence MDSGFAREENKMAYAIMHYFPGGTKEQYEASIAAVHPAGGKSLPKGQVFHVAGPSAGGWSIVAVHESKKNWEQFRDDILMPQMKKGIKGGFTSPPQETSFEVHNLQK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 2519899620 Rhizobium sp. Pop5 Isolate Nodule
228 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
229 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
230 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
231 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 1.98
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 1.41
Rhizoplane 8.19
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 26.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10861217 3300009148 Bacteria 898
2 2214962986 2209111006 Unclassified 533
3 Ga0058862_12773554 3300004803 Bacteria 605
4 Ga0065715_10940716 3300005293 Unclassified 562
5 Ga0065707_10745446 3300005295 Unclassified 620
6 Ga0070676_10836192 3300005328 Bacteria 682
7 Ga0070683_100442519 3300005329 Bacteria 1240
8 Ga0070690_100082795 3300005330 Bacteria 2101
9 Ga0070690_100125928 3300005330 Bacteria 1725
10 Ga0070690_100225596 3300005330 Bacteria 1315
11 Ga0070690_101278649 3300005330 Unclassified 587
12 Ga0070670_100058715 3300005331 Plasmid 3302
13 Ga0070666_10245204 3300005335 Bacteria 1267
14 Ga0070660_100412180 3300005339 Unclassified 1118
15 Ga0070692_10651377 3300005345 Unclassified 703
16 Ga0070668_100098003 3300005347 Unclassified 2319
17 Ga0070668_100894439 3300005347 Unclassified 793
18 Ga0070671_100103673 3300005355 Bacteria 2386
19 Ga0070671_100299893 3300005355 Bacteria 1368
20 Ga0070674_100984535 3300005356 Unclassified 739
21 Ga0070673_100135401 3300005364 Bacteria 2073
22 Ga0070673_100190309 3300005364 Unclassified 1762
23 Ga0070673_100238612 3300005364 Bacteria 1580
24 Ga0070688_100051647 3300005365 Bacteria 2566
25 Ga0070659_100887361 3300005366 Bacteria 779
26 Ga0070667_100220097 3300005367 Bacteria 1690
27 Ga0070709_10031774 3300005434 Bacteria 3179
28 Ga0070714_100045140 3300005435 Bacteria 3733
29 Ga0070713_101089806 3300005436 Unclassified 772
30 Ga0070710_10197021 3300005437 Bacteria 1270
31 Ga0070710_10348187 3300005437 Bacteria 980
32 Ga0070710_11473987 3300005437 Unclassified 511
33 Ga0070701_10914385 3300005438 Unclassified 606
34 Ga0070701_11185580 3300005438 Bacteria 541
35 Ga0070705_101346417 3300005440 Bacteria 593
36 Ga0070700_101014307 3300005441 Unclassified 683
37 Ga0070663_100495226 3300005455 Bacteria 1014
38 Ga0070663_101803379 3300005455 Bacteria 548
39 Ga0070678_100377719 3300005456 Unclassified 1225
40 Ga0070678_101518811 3300005456 Bacteria 627
41 Ga0070662_100220535 3300005457 Unclassified 1513
42 Ga0068867_100014971 3300005459 Archaea 5498
43 Ga0068867_100371434 3300005459 Unclassified 1199
44 Ga0068867_102353668 3300005459 Unclassified 506
45 Ga0070706_100300872 3300005467 Bacteria 1497
46 Ga0070679_101190740 3300005530 Unclassified 707
47 Ga0070684_100443828 3300005535 Unclassified 1199
48 Ga0070697_100092639 3300005536 Unclassified 2501
49 Ga0070672_100139968 3300005543 Bacteria 1995
50 Ga0070672_100146757 3300005543 Bacteria 1949
51 Ga0070672_100214553 3300005543 Bacteria 1613
52 Ga0070686_100803268 3300005544 Unclassified 758
53 Ga0070693_101201368 3300005547 Bacteria 582
54 Ga0070665_100269750 3300005548 Unclassified 1703
55 Ga0070704_100133413 3300005549 Bacteria 1928
56 Ga0068855_100576290 3300005563 Bacteria 1216
57 Ga0068855_102603950 3300005563 Bacteria 502
58 Ga0070664_100652668 3300005564 Bacteria 978
59 Ga0068854_100225117 3300005578 Bacteria 1486
60 Ga0068856_100891905 3300005614 Bacteria 908
61 Ga0068856_101960965 3300005614 Bacteria 596
62 Ga0068859_100508440 3300005617 Unclassified 1300
63 Ga0068864_100442483 3300005618 Bacteria 1242
64 Ga0068864_101978196 3300005618 Bacteria 589
65 Ga0068866_10260131 3300005718 Bacteria 1066
66 Ga0068866_10749583 3300005718 Unclassified 674
67 Ga0068866_11130303 3300005718 Bacteria 562
68 Ga0068861_100488041 3300005719 Unclassified 1111
69 Ga0068870_11135796 3300005840 Unclassified 563
70 Ga0068863_100995894 3300005841 Bacteria 841
71 Ga0068858_100270406 3300005842 Unclassified 1617
72 Ga0068858_101255422 3300005842 Bacteria 729
73 Ga0068860_100371828 3300005843 Bacteria 1410
74 Ga0068860_100913165 3300005843 Unclassified 894
75 Ga0068862_100068302 3300005844 Bacteria 3066
76 Ga0068862_100240535 3300005844 Bacteria 1646
77 Ga0070717_10119172 3300006028 Bacteria 2259
78 Ga0075365_10525421 3300006038 Bacteria 837
79 Ga0070712_100377198 3300006175 Bacteria 1167
80 Ga0097621_100683505 3300006237 Unclassified 944
81 Ga0068871_100163676 3300006358 Bacteria 1903
82 Ga0068871_100797715 3300006358 Unclassified 870
83 Ga0075431_100762479 3300006847 Unclassified 942
84 Ga0075431_101152846 3300006847 Bacteria 739
85 Ga0075433_11070040 3300006852 Bacteria 702
86 Ga0075433_11873175 3300006852 Bacteria 515
87 Ga0075434_100246148 3300006871 Bacteria 1807
88 Ga0075429_100283217 3300006880 Bacteria 1451
89 Ga0068865_100383500 3300006881 Bacteria 1147
90 Ga0068865_100806636 3300006881 Bacteria 810
91 Ga0068865_101829161 3300006881 Bacteria 549
92 Ga0075436_100034634 3300006914 Unclassified 3482
93 Ga0075436_100081201 3300006914 Bacteria 2248
94 Ga0097620_100508485 3300006931 Unclassified 1300
95 Ga0075435_100107743 3300007076 Bacteria 2314
96 Ga0075435_100608030 3300007076 Bacteria 948
97 Ga0105240_12104773 3300009093 Bacteria 586
98 Ga0111539_10942218 3300009094 Unclassified 1004
99 Ga0105245_10122901 3300009098 Bacteria 2427
100 Ga0105245_10290388 3300009098 Bacteria 1601
101 Ga0105245_11112690 3300009098 Bacteria 836
102 Ga0114129_10689044 3300009147 Unclassified 1314
103 Ga0114129_11051387 3300009147 Unclassified 1022
104 Ga0114129_12744306 3300009147 Unclassified 586
105 Ga0105243_10097460 3300009148 Bacteria 2434
106 Ga0105243_10195590 3300009148 Bacteria 1770
107 Ga0105241_10552212 3300009174 Bacteria 1034
108 Ga0105248_10059599 3300009177 Bacteria 4288
109 Ga0105248_10108520 3300009177 Bacteria 3130
110 Ga0105248_11197492 3300009177 Bacteria 859
111 Ga0105237_11362359 3300009545 Bacteria 716
112 Ga0105237_12026796 3300009545 Bacteria 584
113 Ga0105237_12180501 3300009545 Bacteria 563
114 Ga0105238_11026870 3300009551 Bacteria 846
115 Ga0105249_10667072 3300009553 Bacteria 1098
116 Ga0105239_10459624 3300010375 Bacteria 1445
117 Ga0105239_10599334 3300010375 Bacteria 1257
118 Ga0105239_10607334 3300010375 Bacteria 1248
119 Ga0105239_12765822 3300010375 Bacteria 573
120 Ga0105246_10316097 3300011119 Unclassified 1267
121 Ga0157370_10464396 3300013104 Bacteria 1163
122 Ga0157370_11378662 3300013104 Unclassified 635
123 Ga0157369_10349742 3300013105 Bacteria 1535
124 Ga0157374_11319804 3300013296 Bacteria 744
125 Ga0157378_10189341 3300013297 Unclassified 1940
126 Ga0157378_10573884 3300013297 Bacteria 1136
127 Ga0157378_12706346 3300013297 Bacteria 548
128 Ga0163162_10117012 3300013306 Bacteria 2767
129 Ga0157372_10960075 3300013307 Unclassified 991
130 Ga0157372_11458242 3300013307 Unclassified 789
131 Ga0157372_12919502 3300013307 Bacteria 547
132 Ga0157375_10115079 3300013308 Bacteria 2792
133 Ga0157375_10223203 3300013308 Unclassified 2043
134 Ga0157375_10489666 3300013308 Bacteria 1394
135 Ga0163163_10529499 3300014325 Bacteria 1241
136 Ga0157380_10056698 3300014326 Unclassified 3117
137 Ga0157380_10366077 3300014326 Bacteria 1355
138 Ga0157377_10408106 3300014745 Unclassified 927
139 Ga0157377_10444573 3300014745 Bacteria 893
140 Ga0157379_10317940 3300014968 Bacteria 1421
141 Ga0157379_12132247 3300014968 Bacteria 556
142 Ga0157376_12123560 3300014969 Bacteria 600
143 Ga0163161_10350109 3300017792 Bacteria 1174
144 Ga0197907_10520947 3300020069 Unclassified 1770
145 Ga0206356_10819662 3300020070 Bacteria 1380
146 Ga0206351_10950440 3300020077 Bacteria 1808
147 Ga0206352_11172524 3300020078 Bacteria 615
148 Ga0206350_10204836 3300020080 Unclassified 1439
149 Ga0224712_10033571 3300022467 Bacteria 1879
150 Ga0207688_10725198 3300025901 Unclassified 629
151 Ga0207688_10943493 3300025901 Unclassified 546
152 Ga0207699_10030071 3300025906 Bacteria 3036
153 Ga0207684_10972143 3300025910 Bacteria 711
154 Ga0207654_10736855 3300025911 Bacteria 709
155 Ga0207693_10246630 3300025915 Unclassified 1402
156 Ga0207657_10807581 3300025919 Bacteria 725
157 Ga0207652_11069648 3300025921 Unclassified 707
158 Ga0207681_10582150 3300025923 Bacteria 923
159 Ga0207694_10715204 3300025924 Bacteria 845
160 Ga0207650_10090870 3300025925 Unclassified 2332
161 Ga0207650_10582329 3300025925 Bacteria 940
162 Ga0207687_10508936 3300025927 Bacteria 1006
163 Ga0207664_10230817 3300025929 Bacteria 1608
164 Ga0207664_11633261 3300025929 Bacteria 567
165 Ga0207644_10216777 3300025931 Bacteria 1515
166 Ga0207706_10143176 3300025933 Bacteria 2103
167 Ga0207706_10210985 3300025933 Unclassified 1702
168 Ga0207686_10514519 3300025934 Bacteria 931
169 Ga0207709_10127373 3300025935 Bacteria 1729
170 Ga0207709_10248331 3300025935 Bacteria 1298
171 Ga0207669_10106354 3300025937 Unclassified 1869
172 Ga0207669_10766934 3300025937 Bacteria 798
173 Ga0207669_10940963 3300025937 Bacteria 724
174 Ga0207704_10161822 3300025938 Bacteria 1594
175 Ga0207704_10911835 3300025938 Bacteria 739
176 Ga0207665_10266107 3300025939 Bacteria 1272
177 Ga0207691_10028747 3300025940 Bacteria 5203
178 Ga0207691_10296355 3300025940 Bacteria 1390
179 Ga0207711_10104620 3300025941 Plasmid 2509
180 Ga0207711_10729056 3300025941 Bacteria 924
181 Ga0207711_11382040 3300025941 Bacteria 646
182 Ga0207661_10868125 3300025944 Unclassified 831
183 Ga0207661_11022894 3300025944 Bacteria 761
184 Ga0207679_10492403 3300025945 Bacteria 1093
185 Ga0207667_10379303 3300025949 Unclassified 1441
186 Ga0207651_10027678 3300025960 Bacteria 3565
187 Ga0207651_11449111 3300025960 Bacteria 618
188 Ga0207712_10224782 3300025961 Bacteria 1503
189 Ga0207712_10286048 3300025961 Bacteria 1347
190 Ga0207668_10128653 3300025972 Unclassified 1930
191 Ga0207658_10688792 3300025986 Bacteria 923
192 Ga0207677_10392890 3300026023 Bacteria 1174
193 Ga0207703_10051787 3300026035 Bacteria 3330
194 Ga0207703_11295340 3300026035 Bacteria 701
195 Ga0207639_10546186 3300026041 Unclassified 1063
196 Ga0207639_12152077 3300026041 Bacteria 519
197 Ga0207678_11502760 3300026067 Bacteria 595
198 Ga0207708_10303652 3300026075 Bacteria 1299
199 Ga0207708_10305226 3300026075 Bacteria 1295
200 Ga0207641_10667500 3300026088 Unclassified 1022
201 Ga0207648_10072445 3300026089 Bacteria 3003
202 Ga0207648_10385460 3300026089 Unclassified 1268
203 Ga0207648_11138398 3300026089 Unclassified 732
204 Ga0207676_11050855 3300026095 Bacteria 804
205 Ga0207675_100112702 3300026118 Bacteria 2567
206 Ga0207675_100556964 3300026118 Unclassified 1146
207 Ga0207675_101163026 3300026118 Bacteria 792
208 Ga0207683_10086363 3300026121 Bacteria 2789
209 Ga0207683_10289219 3300026121 Unclassified 1498
210 Ga0207698_10699943 3300026142 Bacteria 1008
211 Ga0268266_10546168 3300028379 Bacteria 1110
212 Ga0268265_10099387 3300028380 Unclassified 2346
213 Ga0268264_10433038 3300028381 Bacteria 1270
214 Ga0268264_10791440 3300028381 Unclassified 947
215 Ga0265334_10071666 3300028573 Bacteria 1290
216 Ga0265318_10008200 3300028577 Bacteria 4667
217 Ga0265322_10067936 3300028654 Bacteria 1011
218 Ga0265330_10000449 3300031235 Bacteria 27525
219 Ga0265330_10005957 3300031235 Bacteria 6034
220 Ga0265330_10097093 3300031235 Unclassified 1262
221 Ga0265330_10117254 3300031235 Unclassified 1135
222 Ga0265320_10060361 3300031240 Bacteria 1811
223 Ga0265320_10427667 3300031240 Unclassified 585
224 Ga0265329_10190009 3300031242 Unclassified 673
225 Ga0265340_10407279 3300031247 Unclassified 600
226 Ga0265316_10002089 3300031344 Bacteria 21002
227 Ga0265316_10017669 3300031344 Bacteria 6153
228 Ga0265316_10030184 3300031344 Bacteria 4447
229 Ga0265316_10046136 3300031344 Bacteria 3454
230 Ga0307408_100149932 3300031548 Bacteria 1840
231 Ga0307408_101224629 3300031548 Bacteria 701
232 Ga0265314_10620552 3300031711 Unclassified 555
233 Ga0265342_10004423 3300031712 Bacteria 11082
234 Ga0265342_10097463 3300031712 Unclassified 1679
235 Ga0307405_12150556 3300031731 Bacteria 502
236 Ga0307413_11028764 3300031824 Bacteria 708
237 Ga0307406_11083418 3300031901 Bacteria 691
238 Ga0307409_101500012 3300031995 Unclassified 702
239 Ga0307416_100541114 3300032002 Bacteria 1236
240 Ga0307416_101313158 3300032002 Bacteria 829
241 Ga0307416_101630894 3300032002 Bacteria 750
242 Ga0307416_102506378 3300032002 Bacteria 614
243 Ga0373944_0027264 3300035089 Bacteria 1693
244 Ga0373943_0211722 3300035170 Unclassified 1077
245 Ga0373946_0027683 3300035171 Bacteria 2244
246 Ga0373955_0048998 3300035172 Bacteria 2293
247 Ga0373962_0191151 3300035242 Bacteria 689
248 Ga0373924_0225710 3300035410 Bacteria 828
249 Ga0373931_0754611 3300035691 Bacteria 646
250 Ga0373937_0019898 3300036401 Bacteria 6012
251 Ga0373925_0008357 3300037068 Bacteria 7537
252 Ga0395900_0028121 3300037418 Bacteria 5757
253 Ga0395900_0449314 3300037418 Bacteria 1245
254 Ga0395898_0024020 3300037466 Bacteria 6151
255 Ga0395898_0434604 3300037466 Bacteria 1251
256 Ga0395898_0526933 3300037466 Bacteria 1123
257 Ga0395905_0118541 3300037471 Unclassified 2488
258 Ga0395901_0090074 3300038443 Bacteria 3210
259 Ga0395901_0228332 3300038443 Bacteria 1944
260 Ga0436363_0787776 3300039450 Bacteria 8034
261 Ga0436363_1329673 3300039450 Bacteria 797
262 Ga0436362_0016002 3300039453 Bacteria 848
263 Ga0439435_0071600 3300042436 Bacteria 1027
264 Ga0439464_0100413 3300042439 Unclassified 879
265 Ga0439460_0022540 3300042461 Unclassified 1728
266 Ga0451577_0123541 3300042876 Bacteria 2319
267 Ga0453683_0036616 3300044673 Bacteria 3088
268 Ga0466963_0761054 3300044694 Bacteria 683
269 Ga0453684_0064185 3300044712 Bacteria 4692
270 Ga0451576_0015432 3300045051 Bacteria 8461
271 Ga0466967_1031070 3300045976 Unclassified 819
272 Ga0495629_0130864 3300046459 Bacteria 1748
273 Ga0495629_0148816 3300046459 Bacteria 1628
274 Ga0495629_0211904 3300046459 Bacteria 1338
275 Ga0495641_0265156 3300046461 Bacteria 773
276 Ga0495653_0160354 3300046463 Bacteria 1562
277 Ga0495582_0061149 3300046473 Bacteria 2079
278 Ga0495594_0274911 3300046499 Unclassified 960
279 Ga0495630_0113785 3300046517 Bacteria 2050
280 Ga0495666_0562709 3300046526 Unclassified 508
281 Ga0495652_0129976 3300046529 Bacteria 1995
282 Ga0495586_0677107 3300046535 Bacteria 596
283 Ga0495587_0176500 3300046536 Bacteria 1212
284 Ga0495587_0226628 3300046536 Bacteria 1054
285 Ga0495645_0399492 3300046543 Bacteria 876
286 Ga0495633_0588443 3300046558 Bacteria 500
287 Ga0495667_0033794 3300046559 Bacteria 3422
288 Ga0495635_0102782 3300046663 Bacteria 1953
289 Ga0495657_0079337 3300046675 Bacteria 2126
290 Ga0495657_0827657 3300046675 Bacteria 528
291 Ga0495599_0353064 3300046678 Unclassified 881
292 Ga0495646_0313603 3300046680 Unclassified 827
293 Ga0495647_0009625 3300046681 Bacteria 3279
294 Ga0495658_0163797 3300046683 Bacteria 1373
295 Ga0495658_0212385 3300046683 Bacteria 1210
296 Ga0495613_0095801 3300046689 Bacteria 2146
297 Ga0495600_0148147 3300046809 Bacteria 1521
298 Ga0495600_0454390 3300046809 Unclassified 792
299 Ga0495581_0536387 3300047315 Bacteria 679
300 Ga0495680_0052950 3300047322 Bacteria 3161
301 Ga0495680_0896611 3300047322 Bacteria 573
302 Ga0495684_0002304 3300047471 Bacteria 15284
303 Ga0495684_0012183 3300047471 Bacteria 6633
304 Ga0495684_0142681 3300047471 Bacteria 1795
305 Ga0495614_0022936 3300048089 Bacteria 2691
306 Ga0495614_0258203 3300048089 Bacteria 798
307 Ga0496100_0007140 3300048903 Bacteria 6136
308 Ga0496101_0112435 3300048904 Bacteria 2051
309 Ga0496101_0791775 3300048904 Bacteria 748
310 Ga0496102_0005008 3300048905 Bacteria 11226
311 Ga0496102_0571687 3300048905 Bacteria 1053
312 Ga0496104_0061393 3300048907 Bacteria 3564
313 Ga0496104_0092503 3300048907 Bacteria 2891
314 Ga0496104_0493762 3300048907 Unclassified 1135
315 Ga0496105_0000305 3300048908 Bacteria 32361
316 Ga0496105_0046861 3300048908 Bacteria 3568
317 Ga0496105_0797228 3300048908 Bacteria 718
318 Ga0496106_0006008 3300048909 Bacteria 8979
319 Ga0496108_0020260 3300048911 Bacteria 5465
320 Ga0496108_0035405 3300048911 Bacteria 4150
321 Ga0496108_1103595 3300048911 Unclassified 674
322 Ga0496109_0056994 3300048912 Bacteria 3565
323 Ga0496109_0154633 3300048912 Bacteria 2148
324 Ga0496109_0213844 3300048912 Unclassified 1813
325 Ga0496109_1280816 3300048912 Unclassified 669
326 Ga0496109_1536025 3300048912 Bacteria 600
327 Ga0496110_0277684 3300048913 Bacteria 1525
328 Ga0496111_0055312 3300048914 Bacteria 2870
329 Ga0496111_0099294 3300048914 Bacteria 2138
330 Ga0496112_0424588 3300048915 Bacteria 1268
331 Ga0496113_1290392 3300048916 Bacteria 568
332 Ga0496114_0004294 3300048917 Bacteria 11032
333 Ga0496114_0067726 3300048917 Bacteria 2995
334 Ga0496114_0752723 3300048917 Bacteria 852
335 Ga0496115_0042414 3300048918 Bacteria 3624
336 nmdc:mga05p37_1015589_c1 3300050507 Bacteria 879
337 nmdc:mga05p37_1471308_c1 3300050507 Unclassified 680
338 nmdc:mga05p37_1506208_c1 3300050507 Bacteria 669
339 nmdc:mga09592_325541_c1 3300050508 Bacteria 1331
340 nmdc:mga06r32_732337_c1 3300050510 Unclassified 953
341 nmdc:mga0n895_312404_c1 3300050512 Unclassified 1593
342 nmdc:mga0rr50_22118_c1 3300050513 Bacteria 4357
343 nmdc:mga08x19_642438_c1 3300050514 Unclassified 753
344 nmdc:mga08x19_810295_c1 3300050514 Bacteria 665
345 Ga0495601_0175056 3300053077 Bacteria 1403
346 Ga0500610_0279755 3300053079 Bacteria 749
347 Ga0495595_0009597 3300053084 Bacteria 4010
348 Ga0495619_0037342 3300053085 Bacteria 3164
349 Ga0495619_0293223 3300053085 Unclassified 1127
350 2520377264 2519899620 Bacteria 6499161
351 2756677867 2756170246 Bacteria 7451806
352 2844006008 2844002411 Bacteria 7168230
353 2871473200 2871466892 Bacteria 6923287
354 2906384455 2906378014 Bacteria 6911440
355 Ga0105243_10861217
356 2214962986
357 Ga0058862_12773554
358 Ga0065715_10940716
359 Ga0065707_10745446
360 Ga0070676_10836192
361 Ga0070683_100442519
362 Ga0070690_100082795
363 Ga0070690_100125928
364 Ga0070690_100225596
365 Ga0070690_101278649
366 Ga0070670_100058715
367 Ga0070666_10245204
368 Ga0070660_100412180
369 Ga0070692_10651377
370 Ga0070668_100098003
371 Ga0070668_100894439
372 Ga0070671_100103673
373 Ga0070671_100299893
374 Ga0070674_100984535
375 Ga0070673_100135401
376 Ga0070673_100190309
377 Ga0070673_100238612
378 Ga0070688_100051647
379 Ga0070659_100887361
380 Ga0070667_100220097
381 Ga0070709_10031774
382 Ga0070714_100045140
383 Ga0070713_101089806
384 Ga0070710_10197021
385 Ga0070710_10348187
386 Ga0070710_11473987
387 Ga0070701_10914385
388 Ga0070701_11185580
389 Ga0070705_101346417
390 Ga0070700_101014307
391 Ga0070663_100495226
392 Ga0070663_101803379
393 Ga0070678_100377719
394 Ga0070678_101518811
395 Ga0070662_100220535
396 Ga0068867_100014971
397 Ga0068867_100371434
398 Ga0068867_102353668
399 Ga0070706_100300872
400 Ga0070679_101190740
401 Ga0070684_100443828
402 Ga0070697_100092639
403 Ga0070672_100139968
404 Ga0070672_100146757
405 Ga0070672_100214553
406 Ga0070686_100803268
407 Ga0070693_101201368
408 Ga0070665_100269750
409 Ga0070704_100133413
410 Ga0068855_100576290
411 Ga0068855_102603950
412 Ga0070664_100652668
413 Ga0068854_100225117
414 Ga0068856_100891905
415 Ga0068856_101960965
416 Ga0068859_100508440
417 Ga0068864_100442483
418 Ga0068864_101978196
419 Ga0068866_10260131
420 Ga0068866_10749583
421 Ga0068866_11130303
422 Ga0068861_100488041
423 Ga0068870_11135796
424 Ga0068863_100995894
425 Ga0068858_100270406
426 Ga0068858_101255422
427 Ga0068860_100371828
428 Ga0068860_100913165
429 Ga0068862_100068302
430 Ga0068862_100240535
431 Ga0070717_10119172
432 Ga0075365_10525421
433 Ga0070712_100377198
434 Ga0097621_100683505
435 Ga0068871_100163676
436 Ga0068871_100797715
437 Ga0075431_100762479
438 Ga0075431_101152846
439 Ga0075433_11070040
440 Ga0075433_11873175
441 Ga0075434_100246148
442 Ga0075429_100283217
443 Ga0068865_100383500
444 Ga0068865_100806636
445 Ga0068865_101829161
446 Ga0075436_100034634
447 Ga0075436_100081201
448 Ga0097620_100508485
449 Ga0075435_100107743
450 Ga0075435_100608030
451 Ga0105240_12104773
452 Ga0111539_10942218
453 Ga0105245_10122901
454 Ga0105245_10290388
455 Ga0105245_11112690
456 Ga0114129_10689044
457 Ga0114129_11051387
458 Ga0114129_12744306
459 Ga0105243_10097460
460 Ga0105243_10195590
461 Ga0105241_10552212
462 Ga0105248_10059599
463 Ga0105248_10108520
464 Ga0105248_11197492
465 Ga0105237_11362359
466 Ga0105237_12026796
467 Ga0105237_12180501
468 Ga0105238_11026870
469 Ga0105249_10667072
470 Ga0105239_10459624
471 Ga0105239_10599334
472 Ga0105239_10607334
473 Ga0105239_12765822
474 Ga0105246_10316097
475 Ga0157370_10464396
476 Ga0157370_11378662
477 Ga0157369_10349742
478 Ga0157374_11319804
479 Ga0157378_10189341
480 Ga0157378_10573884
481 Ga0157378_12706346
482 Ga0163162_10117012
483 Ga0157372_10960075
484 Ga0157372_11458242
485 Ga0157372_12919502
486 Ga0157375_10115079
487 Ga0157375_10223203
488 Ga0157375_10489666
489 Ga0163163_10529499
490 Ga0157380_10056698
491 Ga0157380_10366077
492 Ga0157377_10408106
493 Ga0157377_10444573
494 Ga0157379_10317940
495 Ga0157379_12132247
496 Ga0157376_12123560
497 Ga0163161_10350109
498 Ga0197907_10520947
499 Ga0206356_10819662
500 Ga0206351_10950440
501 Ga0206352_11172524
502 Ga0206350_10204836
503 Ga0224712_10033571
504 Ga0207688_10725198
505 Ga0207688_10943493
506 Ga0207699_10030071
507 Ga0207684_10972143
508 Ga0207654_10736855
509 Ga0207693_10246630
510 Ga0207657_10807581
511 Ga0207652_11069648
512 Ga0207681_10582150
513 Ga0207694_10715204
514 Ga0207650_10090870
515 Ga0207650_10582329
516 Ga0207687_10508936
517 Ga0207664_10230817
518 Ga0207664_11633261
519 Ga0207644_10216777
520 Ga0207706_10143176
521 Ga0207706_10210985
522 Ga0207686_10514519
523 Ga0207709_10127373
524 Ga0207709_10248331
525 Ga0207669_10106354
526 Ga0207669_10766934
527 Ga0207669_10940963
528 Ga0207704_10161822
529 Ga0207704_10911835
530 Ga0207665_10266107
531 Ga0207691_10028747
532 Ga0207691_10296355
533 Ga0207711_10104620
534 Ga0207711_10729056
535 Ga0207711_11382040
536 Ga0207661_10868125
537 Ga0207661_11022894
538 Ga0207679_10492403
539 Ga0207667_10379303
540 Ga0207651_10027678
541 Ga0207651_11449111
542 Ga0207712_10224782
543 Ga0207712_10286048
544 Ga0207668_10128653
545 Ga0207658_10688792
546 Ga0207677_10392890
547 Ga0207703_10051787
548 Ga0207703_11295340
549 Ga0207639_10546186
550 Ga0207639_12152077
551 Ga0207678_11502760
552 Ga0207708_10303652
553 Ga0207708_10305226
554 Ga0207641_10667500
555 Ga0207648_10072445
556 Ga0207648_10385460
557 Ga0207648_11138398
558 Ga0207676_11050855
559 Ga0207675_100112702
560 Ga0207675_100556964
561 Ga0207675_101163026
562 Ga0207683_10086363
563 Ga0207683_10289219
564 Ga0207698_10699943
565 Ga0268266_10546168
566 Ga0268265_10099387
567 Ga0268264_10433038
568 Ga0268264_10791440
569 Ga0265334_10071666
570 Ga0265318_10008200
571 Ga0265322_10067936
572 Ga0265330_10000449
573 Ga0265330_10005957
574 Ga0265330_10097093
575 Ga0265330_10117254
576 Ga0265320_10060361
577 Ga0265320_10427667
578 Ga0265329_10190009
579 Ga0265340_10407279
580 Ga0265316_10002089
581 Ga0265316_10017669
582 Ga0265316_10030184
583 Ga0265316_10046136
584 Ga0307408_100149932
585 Ga0307408_101224629
586 Ga0265314_10620552
587 Ga0265342_10004423
588 Ga0265342_10097463
589 Ga0307405_12150556
590 Ga0307413_11028764
591 Ga0307406_11083418
592 Ga0307409_101500012
593 Ga0307416_100541114
594 Ga0307416_101313158
595 Ga0307416_101630894
596 Ga0307416_102506378
597 Ga0373944_0027264
598 Ga0373943_0211722
599 Ga0373946_0027683
600 Ga0373955_0048998
601 Ga0373962_0191151
602 Ga0373924_0225710
603 Ga0373931_0754611
604 Ga0373937_0019898
605 Ga0373925_0008357
606 Ga0395900_0028121
607 Ga0395900_0449314
608 Ga0395898_0024020
609 Ga0395898_0434604
610 Ga0395898_0526933
611 Ga0395905_0118541
612 Ga0395901_0090074
613 Ga0395901_0228332
614 Ga0436363_0787776
615 Ga0436363_1329673
616 Ga0436362_0016002
617 Ga0439435_0071600
618 Ga0439464_0100413
619 Ga0439460_0022540
620 Ga0451577_0123541
621 Ga0453683_0036616
622 Ga0466963_0761054
623 Ga0453684_0064185
624 Ga0451576_0015432
625 Ga0466967_1031070
626 Ga0495629_0130864
627 Ga0495629_0148816
628 Ga0495629_0211904
629 Ga0495641_0265156
630 Ga0495653_0160354
631 Ga0495582_0061149
632 Ga0495594_0274911
633 Ga0495630_0113785
634 Ga0495666_0562709
635 Ga0495652_0129976
636 Ga0495586_0677107
637 Ga0495587_0176500
638 Ga0495587_0226628
639 Ga0495645_0399492
640 Ga0495633_0588443
641 Ga0495667_0033794
642 Ga0495635_0102782
643 Ga0495657_0079337
644 Ga0495657_0827657
645 Ga0495599_0353064
646 Ga0495646_0313603
647 Ga0495647_0009625
648 Ga0495658_0163797
649 Ga0495658_0212385
650 Ga0495613_0095801
651 Ga0495600_0148147
652 Ga0495600_0454390
653 Ga0495581_0536387
654 Ga0495680_0052950
655 Ga0495680_0896611
656 Ga0495684_0002304
657 Ga0495684_0012183
658 Ga0495684_0142681
659 Ga0495614_0022936
660 Ga0495614_0258203
661 Ga0496100_0007140
662 Ga0496101_0112435
663 Ga0496101_0791775
664 Ga0496102_0005008
665 Ga0496102_0571687
666 Ga0496104_0061393
667 Ga0496104_0092503
668 Ga0496104_0493762
669 Ga0496105_0000305
670 Ga0496105_0046861
671 Ga0496105_0797228
672 Ga0496106_0006008
673 Ga0496108_0020260
674 Ga0496108_0035405
675 Ga0496108_1103595
676 Ga0496109_0056994
677 Ga0496109_0154633
678 Ga0496109_0213844
679 Ga0496109_1280816
680 Ga0496109_1536025
681 Ga0496110_0277684
682 Ga0496111_0055312
683 Ga0496111_0099294
684 Ga0496112_0424588
685 Ga0496113_1290392
686 Ga0496114_0004294
687 Ga0496114_0067726
688 Ga0496114_0752723
689 Ga0496115_0042414
690 nmdc:mga05p37_1015589_c1
691 nmdc:mga05p37_1471308_c1
692 nmdc:mga05p37_1506208_c1
693 nmdc:mga09592_325541_c1
694 nmdc:mga06r32_732337_c1
695 nmdc:mga0n895_312404_c1
696 nmdc:mga0rr50_22118_c1
697 nmdc:mga08x19_642438_c1
698 nmdc:mga08x19_810295_c1
699 Ga0495601_0175056
700 Ga0500610_0279755
701 Ga0495595_0009597
702 Ga0495619_0037342
703 Ga0495619_0293223
704 2520377264
705 2756677867
706 2844006008
707 2871473200
708 2906384455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.7308 2 92
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.7224 1 95
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.716 1 95
1jj4-assembly1.cif.gz_A human papillomavirus type 18 e2 dna-binding domain bound to its dna target 0.7066 1 90
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.7003 2 91
ID Description Score Start End Superfamily
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7224 1 95 3.30.70.100
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.716 1 95 3.30.70.100
af_Q54CJ9_3_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7069 2 93 3.30.70.100
af_Q54J03_9_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7007 2 90 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6985 2 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6P1NTU8-F1-model_v4 Uncharacterized protein 1.003 2 95
AF-A0A7W3P8K9-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.002 1 95
AF-Q6MJK6-F1-model_v4 ABM domain-containing protein 1 1 95
AF-F2A3R9-F1-model_v4 deleted 0.9915 1 95
AF-Q6MJK6-F1-model_v4 ABM domain-containing protein 0.9898 1 95

Map