F419713

General Info

Members Datasets Scaffolds Average Seq Length
354 211 354 81

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100068708|Ga0075430_1000687082
Length 95
Sequence MTVRIVGGTFEFLPMRLSKLRTGHGVRQKFLLGLTSVLTLSEPFDVVKTFTYRPEYFGKPFCDLGHDLLRGPSEWTIGERELFGAFTASLNQCLF

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
144 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
145 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
146 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
147 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
148 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
149 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
150 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
151 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
152 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.28
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F7QKVOU01BNE3C 2088090002 Unclassified 504
2 LJN_F7QKVOU01B3MP4 2088090003 Unclassified 553
3 Ga0065704_10668715 3300005289 Unclassified 575
4 Ga0065712_10052162 3300005290 Bacteria 536
5 Ga0065712_10429222 3300005290 Bacteria 704
6 Ga0065707_10782458 3300005295 Unclassified 606
7 Ga0070690_100206213 3300005330 Bacteria 1370
8 Ga0070670_100000152 3300005331 Bacteria 63495
9 Ga0068869_100391587 3300005334 Unclassified 1141
10 Ga0068869_101064766 3300005334 Unclassified 706
11 Ga0068869_101602710 3300005334 Unclassified 580
12 Ga0070666_10509014 3300005335 Unclassified 873
13 Ga0070680_101781633 3300005336 Unclassified 534
14 Ga0068868_100863342 3300005338 Unclassified 820
15 Ga0068868_102430467 3300005338 Bacteria 501
16 Ga0070660_100396057 3300005339 Unclassified 1141
17 Ga0070691_11032947 3300005341 Unclassified 514
18 Ga0070661_100019030 3300005344 Bacteria 4888
19 Ga0070668_100253266 3300005347 Bacteria 1462
20 Ga0070668_100867519 3300005347 Bacteria 805
21 Ga0070669_100268863 3300005353 Bacteria 1362
22 Ga0070675_100096734 3300005354 Bacteria 2481
23 Ga0070675_100529090 3300005354 Bacteria 1064
24 Ga0070671_101389497 3300005355 Bacteria 620
25 Ga0070674_101391704 3300005356 Bacteria 628
26 Ga0070674_101959700 3300005356 Unclassified 533
27 Ga0070673_100144858 3300005364 Bacteria 2007
28 Ga0070673_101038641 3300005364 Unclassified 764
29 Ga0070688_100760177 3300005365 Unclassified 755
30 Ga0070659_100298336 3300005366 Bacteria 1343
31 Ga0070703_10171615 3300005406 Bacteria 831
32 Ga0070701_10067071 3300005438 Bacteria 1908
33 Ga0070705_100179537 3300005440 Unclassified 1433
34 Ga0070705_100283161 3300005440 Bacteria 1180
35 Ga0070705_100296034 3300005440 Bacteria 1157
36 Ga0070700_101624961 3300005441 Unclassified 553
37 Ga0070694_100060158 3300005444 Bacteria 2590
38 Ga0070694_100101248 3300005444 Bacteria 2038
39 Ga0070694_100683975 3300005444 Bacteria 833
40 Ga0070694_100758865 3300005444 Unclassified 793
41 Ga0070708_100819217 3300005445 Bacteria 875
42 Ga0070708_102216854 3300005445 Bacteria 507
43 Ga0070663_101958835 3300005455 Unclassified 527
44 Ga0070678_101068749 3300005456 Bacteria 744
45 Ga0070662_100330116 3300005457 Bacteria 1246
46 Ga0068867_100246932 3300005459 Bacteria 1450
47 Ga0068867_100307271 3300005459 Bacteria 1309
48 Ga0068867_101184896 3300005459 Archaea 701
49 Ga0070685_10519681 3300005466 Bacteria 845
50 Ga0070706_100046389 3300005467 Bacteria 4011
51 Ga0070707_100351674 3300005468 Bacteria 1431
52 Ga0070698_100001287 3300005471 Bacteria 27980
53 Ga0070698_100533862 3300005471 Bacteria 1112
54 Ga0070698_101976592 3300005471 Bacteria 536
55 Ga0070697_101544651 3300005536 Bacteria 593
56 Ga0068853_100128563 3300005539 Bacteria 2266
57 Ga0068853_100519734 3300005539 Bacteria 1125
58 Ga0070672_102085083 3300005543 Unclassified 511
59 Ga0070695_100698822 3300005545 Unclassified 805
60 Ga0070695_101667200 3300005545 Unclassified 533
61 Ga0070696_100685487 3300005546 Unclassified 834
62 Ga0070696_100693152 3300005546 Unclassified 830
63 Ga0070693_100334648 3300005547 Bacteria 1031
64 Ga0070693_100540734 3300005547 Bacteria 832
65 Ga0070665_102074726 3300005548 Bacteria 573
66 Ga0070704_100182567 3300005549 Bacteria 1679
67 Ga0070704_100478111 3300005549 Unclassified 1077
68 Ga0070664_100011733 3300005564 Bacteria 7114
69 Ga0068857_101821580 3300005577 Bacteria 596
70 Ga0068856_100514490 3300005614 Unclassified 1218
71 Ga0068852_100292276 3300005616 Bacteria 1574
72 Ga0068859_100117366 3300005617 Bacteria 2726
73 Ga0068859_100636591 3300005617 Unclassified 1159
74 Ga0068859_102350921 3300005617 Bacteria 587
75 Ga0068859_102388298 3300005617 Bacteria 583
76 Ga0068864_100381944 3300005618 Bacteria 1335
77 Ga0068864_101012030 3300005618 Unclassified 824
78 Ga0068864_101328610 3300005618 Bacteria 720
79 Ga0068866_10515914 3300005718 Unclassified 793
80 Ga0068861_100239405 3300005719 Bacteria 1543
81 Ga0068861_100771650 3300005719 Bacteria 900
82 Ga0068861_101133376 3300005719 Unclassified 753
83 Ga0068870_10203425 3300005840 Bacteria 1202
84 Ga0068870_11162492 3300005840 Unclassified 557
85 Ga0068863_100149161 3300005841 Bacteria 2237
86 Ga0068863_100562274 3300005841 Unclassified 1127
87 Ga0068863_100933074 3300005841 Bacteria 869
88 Ga0068860_100289759 3300005843 Bacteria 1602
89 Ga0068860_100802877 3300005843 Bacteria 954
90 Ga0068860_101943237 3300005843 Unclassified 610
91 Ga0068860_102800441 3300005843 Unclassified 506
92 Ga0068862_100124230 3300005844 Unclassified 2277
93 Ga0081455_10009605 3300005937 Bacteria 9934
94 Ga0081455_10015920 3300005937 Bacteria 7280
95 Ga0081455_10079432 3300005937 Bacteria 2693
96 Ga0081538_10023918 3300005981 Bacteria 4372
97 Ga0070717_10168336 3300006028 Bacteria 1905
98 Ga0068871_100091801 3300006358 Unclassified 2531
99 Ga0068871_102055326 3300006358 Unclassified 544
100 Ga0075428_100037332 3300006844 Bacteria 5349
101 Ga0075428_100117242 3300006844 Bacteria 2900
102 Ga0075430_100022159 3300006846 Bacteria 5400
103 Ga0075430_100029061 3300006846 Unclassified 4693
104 Ga0075430_100068708 3300006846 Bacteria 2972
105 Ga0075430_100274148 3300006846 Unclassified 1396
106 Ga0075431_100013769 3300006847 Bacteria 8169
107 Ga0075431_100032099 3300006847 Bacteria 5411
108 Ga0075431_100349562 3300006847 Bacteria 1486
109 Ga0075431_101702071 3300006847 Unclassified 587
110 Ga0075433_10155290 3300006852 Bacteria 2036
111 Ga0075433_10409902 3300006852 Bacteria 1195
112 Ga0075433_11400209 3300006852 Unclassified 605
113 Ga0075434_100711706 3300006871 Bacteria 1021
114 Ga0075429_100050904 3300006880 Bacteria 3604
115 Ga0075429_100599698 3300006880 Unclassified 965
116 Ga0075429_101247273 3300006880 Unclassified 649
117 Ga0068865_101175490 3300006881 Unclassified 678
118 Ga0075436_100009359 3300006914 Bacteria 6698
119 Ga0075436_100682402 3300006914 Unclassified 760
120 Ga0097620_100117364 3300006931 Bacteria 2726
121 Ga0097620_100636511 3300006931 Unclassified 1159
122 Ga0097620_102350824 3300006931 Bacteria 587
123 Ga0097620_102388003 3300006931 Bacteria 583
124 Ga0075435_100067463 3300007076 Bacteria 2913
125 Ga0075435_100658730 3300007076 Bacteria 909
126 Ga0075435_101729970 3300007076 Bacteria 549
127 Ga0105251_10109504 3300009011 Bacteria 1259
128 Ga0111539_11074286 3300009094 Bacteria 935
129 Ga0105245_11503254 3300009098 Unclassified 724
130 Ga0105247_11638639 3300009101 Bacteria 530
131 Ga0114129_10119044 3300009147 Bacteria 3637
132 Ga0114129_10265373 3300009147 Bacteria 2299
133 Ga0114129_10961831 3300009147 Unclassified 1078
134 Ga0105241_10594408 3300009174 Bacteria 999
135 Ga0105242_10289316 3300009176 Unclassified 1491
136 Ga0105242_10663016 3300009176 Bacteria 1016
137 Ga0105248_10120902 3300009177 Bacteria 2954
138 Ga0105248_10556077 3300009177 Bacteria 1294
139 Ga0105248_11150908 3300009177 Unclassified 877
140 Ga0105238_10734936 3300009551 Bacteria 1000
141 Ga0105249_11196957 3300009553 Unclassified 831
142 Ga0105246_10259990 3300011119 Unclassified 1382
143 Ga0105246_10739487 3300011119 Unclassified 866
144 Ga0157370_10609956 3300013104 Bacteria 999
145 Ga0157369_10634053 3300013105 Bacteria 1102
146 Ga0157374_12302362 3300013296 Bacteria 566
147 Ga0163162_10556486 3300013306 Bacteria 1275
148 Ga0157372_10451316 3300013307 Bacteria 1498
149 Ga0157372_11277295 3300013307 Unclassified 847
150 Ga0157375_10071870 3300013308 Unclassified 3474
151 Ga0163163_10000026 3300014325 Bacteria 179198
152 Ga0163163_10032994 3300014325 Bacteria 5004
153 Ga0163163_10113104 3300014325 Bacteria 2744
154 Ga0163163_10228191 3300014325 Bacteria 1911
155 Ga0157380_10177481 3300014326 Unclassified 1868
156 Ga0157380_10505693 3300014326 Bacteria 1175
157 Ga0157379_11385935 3300014968 Bacteria 681
158 Ga0157376_10073811 3300014969 Unclassified 2906
159 Ga0163161_11133229 3300017792 Unclassified 674
160 Ga0213876_10307497 3300021384 Bacteria 843
161 Ga0207713_1256055 3300025735 Unclassified 514
162 Ga0207643_10927374 3300025908 Unclassified 564
163 Ga0207684_10064915 3300025910 Bacteria 3100
164 Ga0207684_10517248 3300025910 Bacteria 1022
165 Ga0207654_10230459 3300025911 Bacteria 1233
166 Ga0207654_10285189 3300025911 Unclassified 1118
167 Ga0207654_11153873 3300025911 Unclassified 565
168 Ga0207707_10126806 3300025912 Bacteria 2232
169 Ga0207660_10073914 3300025917 Bacteria 2486
170 Ga0207660_10539025 3300025917 Bacteria 949
171 Ga0207657_10358602 3300025919 Unclassified 1149
172 Ga0207649_10028703 3300025920 Bacteria 3278
173 Ga0207646_10017630 3300025922 Bacteria 6673
174 Ga0207646_10826425 3300025922 Bacteria 824
175 Ga0207646_10873257 3300025922 Bacteria 799
176 Ga0207650_10000006 3300025925 Bacteria 544730
177 Ga0207650_11156235 3300025925 Unclassified 659
178 Ga0207687_11049690 3300025927 Bacteria 699
179 Ga0207690_10136772 3300025932 Bacteria 1800
180 Ga0207690_10146074 3300025932 Unclassified 1748
181 Ga0207706_10033682 3300025933 Bacteria 4558
182 Ga0207706_10323059 3300025933 Unclassified 1343
183 Ga0207706_11642727 3300025933 Bacteria 519
184 Ga0207686_10380601 3300025934 Bacteria 1070
185 Ga0207709_10117798 3300025935 Bacteria 1788
186 Ga0207711_11316270 3300025941 Bacteria 665
187 Ga0207689_10447549 3300025942 Bacteria 1079
188 Ga0207651_10071908 3300025960 Bacteria 2454
189 Ga0207640_11815722 3300025981 Unclassified 551
190 Ga0207677_12181139 3300026023 Bacteria 515
191 Ga0207639_10436423 3300026041 Unclassified 1186
192 Ga0207639_10831572 3300026041 Bacteria 861
193 Ga0207708_10032806 3300026075 Unclassified 3943
194 Ga0207708_10418422 3300026075 Unclassified 1111
195 Ga0207641_10885563 3300026088 Bacteria 886
196 Ga0207641_11134817 3300026088 Bacteria 781
197 Ga0207641_12118524 3300026088 Unclassified 563
198 Ga0207648_10088599 3300026089 Bacteria 2702
199 Ga0207648_10646436 3300026089 Bacteria 977
200 Ga0207676_10137998 3300026095 Unclassified 2083
201 Ga0207676_10138640 3300026095 Bacteria 2079
202 Ga0207674_10002702 3300026116 Bacteria 22142
203 Ga0207674_10170111 3300026116 Bacteria 2133
204 Ga0207675_100150706 3300026118 Bacteria 2213
205 Ga0207675_101295592 3300026118 Bacteria 749
206 Ga0207675_101315647 3300026118 Unclassified 743
207 Ga0207683_10821318 3300026121 Unclassified 863
208 Ga0207428_11010315 3300027907 Bacteria 584
209 Ga0268266_11790027 3300028379 Bacteria 589
210 Ga0268264_10371053 3300028381 Bacteria 1368
211 Ga0268264_11853490 3300028381 Unclassified 613
212 Ga0268264_11904054 3300028381 Unclassified 604
213 Ga0268264_12045638 3300028381 Unclassified 582
214 Ga0307408_100341335 3300031548 Unclassified 1268
215 Ga0307405_10455131 3300031731 Bacteria 1016
216 Ga0307405_11608945 3300031731 Bacteria 573
217 Ga0307413_10255121 3300031824 Unclassified 1304
218 Ga0307410_10215722 3300031852 Bacteria 1473
219 Ga0307406_10142726 3300031901 Unclassified 1698
220 Ga0307416_100210590 3300032002 Unclassified 1854
221 Ga0307416_100309432 3300032002 Bacteria 1575
222 Ga0307416_101542255 3300032002 Unclassified 770
223 Ga0307411_10697656 3300032005 Bacteria 884
224 Ga0307415_100013722 3300032126 Bacteria 4738
225 Ga0307415_100086567 3300032126 Unclassified 2255
226 Ga0373940_0079799 3300035088 Bacteria 966
227 Ga0373943_0315065 3300035170 Bacteria 891
228 Ga0373937_1096828 3300036401 Bacteria 745
229 Ga0395900_0048296 3300037418 Bacteria 4384
230 Ga0395898_0444302 3300037466 Bacteria 1235
231 Ga0395898_0726254 3300037466 Bacteria 935
232 Ga0395905_0012466 3300037471 Bacteria 8184
233 Ga0395901_0011930 3300038443 Bacteria 8812
234 Ga0395901_0695499 3300038443 Bacteria 1015
235 Ga0436365_1336455 3300039437 Bacteria 792
236 Ga0439443_004111 3300042003 Bacteria 1877
237 Ga0439448_0000526 3300042005 Bacteria 8896
238 Ga0439450_000415 3300042008 Bacteria 5509
239 Ga0439451_030552 3300042009 Bacteria 1083
240 Ga0439451_039496 3300042009 Bacteria 948
241 Ga0439454_068212 3300042011 Bacteria 627
242 Ga0439463_001136 3300042016 Bacteria 7143
243 Ga0450913_002108 3300042117 Bacteria 1189
244 Ga0450888_012260 3300042126 Bacteria 1014
245 Ga0450900_006681 3300042136 Bacteria 1402
246 Ga0450902_027726 3300042137 Bacteria 950
247 Ga0450905_001908 3300042142 Bacteria 2665
248 Ga0450889_007901 3300042144 Bacteria 1077
249 Ga0439444_0002015 3300042437 Bacteria 2718
250 Ga0439464_0001482 3300042439 Bacteria 5549
251 Ga0439460_0003044 3300042461 Bacteria 4049
252 Ga0450916_009151 3300042530 Bacteria 1218
253 Ga0439440_0017145 3300042993 Bacteria 1592
254 Ga0439440_0039449 3300042993 Bacteria 1146
255 Ga0439440_0165535 3300042993 Bacteria 640
256 Ga0466963_0095881 3300044694 Unclassified 2026
257 Ga0451576_0822201 3300045051 Bacteria 975
258 Ga0451576_0976111 3300045051 Bacteria 888
259 Ga0451576_1148609 3300045051 Bacteria 812
260 Ga0466967_0281439 3300045976 Bacteria 1596
261 Ga0495630_0359715 3300046517 Bacteria 1114
262 Ga0495644_0282688 3300046523 Bacteria 647
263 Ga0495640_0695243 3300046533 Bacteria 610
264 Ga0495586_0237646 3300046535 Bacteria 1038
265 Ga0495634_0358216 3300046642 Unclassified 872
266 Ga0495658_0023265 3300046683 Unclassified 3288
267 Ga0495675_0608579 3300047444 Bacteria 619
268 Ga0496112_0477156 3300048915 Bacteria 1184
269 Ga0501032_0586821 3300049569 Unclassified 709
270 Ga0501032_0689300 3300049569 Bacteria 648
271 Ga0501033_0017093 3300049570 Bacteria 5483
272 Ga0501033_0198680 3300049570 Bacteria 1433
273 Ga0501034_0298303 3300049571 Bacteria 1549
274 Ga0501034_1588875 3300049571 Bacteria 527
275 Ga0501036_0008156 3300049572 Bacteria 8585
276 Ga0501036_0012337 3300049572 Bacteria 7075
277 Ga0501036_1463830 3300049572 Bacteria 553
278 Ga0501037_0584243 3300049573 Bacteria 751
279 Ga0501038_0011620 3300049574 Bacteria 8033
280 Ga0501039_0041541 3300049575 Bacteria 3552
281 Ga0501039_0858764 3300049575 Bacteria 707
282 Ga0501040_0001440 3300049576 Bacteria 15073
283 Ga0501040_0017339 3300049576 Bacteria 4778
284 Ga0501040_0482716 3300049576 Unclassified 893
285 Ga0501040_1301309 3300049576 Bacteria 527
286 Ga0501040_1400566 3300049576 Bacteria 508
287 Ga0501041_0001926 3300049577 Bacteria 11653
288 Ga0501042_1340885 3300049578 Bacteria 522
289 Ga0501043_0310023 3300049579 Unclassified 1205
290 Ga0501046_0004952 3300049580 Bacteria 11962
291 Ga0501046_0701334 3300049580 Bacteria 713
292 Ga0501048_0110389 3300049582 Bacteria 1942
293 Ga0501048_0295977 3300049582 Unclassified 1151
294 Ga0501068_0028870 3300049584 Unclassified 3283
295 Ga0501068_0242299 3300049584 Bacteria 1148
296 Ga0501068_1209830 3300049584 Bacteria 501
297 Ga0501070_1254404 3300049586 Bacteria 567
298 Ga0501071_0747565 3300049587 Unclassified 753
299 Ga0501072_0014848 3300049588 Bacteria 5970
300 Ga0501074_0427883 3300049590 Bacteria 939
301 Ga0501074_0586874 3300049590 Unclassified 788
302 Ga0501075_0009052 3300049591 Bacteria 6951
303 Ga0501075_0086625 3300049591 Bacteria 2373
304 Ga0501075_0221265 3300049591 Bacteria 1444
305 Ga0501075_0817753 3300049591 Bacteria 709
306 Ga0501076_0004964 3300049592 Bacteria 9523
307 Ga0501076_0063875 3300049592 Bacteria 2934
308 Ga0501076_0095029 3300049592 Bacteria 2400
309 Ga0501076_0190394 3300049592 Unclassified 1674
310 Ga0501076_1222314 3300049592 Unclassified 618
311 Ga0501077_0083384 3300049593 Unclassified 2025
312 Ga0501077_0194263 3300049593 Unclassified 1289
313 Ga0501079_0010396 3300049741 Bacteria 7073
314 Ga0501079_0031445 3300049741 Bacteria 4080
315 Ga0501080_0874478 3300049742 Bacteria 785
316 Ga0501081_0000827 3300049743 Bacteria 18308
317 Ga0501081_0137849 3300049743 Bacteria 1747
318 Ga0501081_0503174 3300049743 Unclassified 903
319 Ga0501081_0643985 3300049743 Unclassified 794
320 Ga0501083_0201972 3300049744 Unclassified 1296
321 Ga0501035_0170561 3300049822 Unclassified 1880
322 Ga0501035_0349682 3300049822 Unclassified 1237
323 Ga0501044_1161079 3300049823 Unclassified 641
324 Ga0501045_0007238 3300049824 Bacteria 7703
325 Ga0501045_0071638 3300049824 Bacteria 2551
326 Ga0501045_0331327 3300049824 Bacteria 1133
327 nmdc:mga05p37_111311_c1 3300050507 Bacteria 3367
328 nmdc:mga05p37_276393_c1 3300050507 Bacteria 2005
329 nmdc:mga05p37_338944_c1 3300050507 Bacteria 1773
330 nmdc:mga09592_18700_c1 3300050508 Bacteria 5683
331 nmdc:mga0qj67_26961_c1 3300050509 Bacteria 4450
332 nmdc:mga0qj67_410960_c1 3300050509 Bacteria 1092
333 nmdc:mga06r32_606641_c1 3300050510 Bacteria 1065
334 nmdc:mga06r32_706981_c1 3300050510 Bacteria 973
335 nmdc:mga06r32_840776_c1 3300050510 Unclassified 877
336 nmdc:mga06r32_94651_c1 3300050510 Bacteria 2923
337 nmdc:mga0n895_451436_c1 3300050512 Bacteria 1298
338 nmdc:mga0rr50_16637_c1 3300050513 Bacteria 4891
339 nmdc:mga0rr50_472602_c1 3300050513 Unclassified 1064
340 nmdc:mga0rr50_686337_c1 3300050513 Bacteria 874
341 nmdc:mga08x19_524607_c1 3300050514 Bacteria 837
342 nmdc:mga0a205_1519245_c1 3300050515 Bacteria 518
343 nmdc:mga0a205_165872_c1 3300050515 Bacteria 2104
344 Ga0495619_0574876 3300053085 Bacteria 772
345 Ga0501084_0017911 3300054114 Bacteria 5897
346 Ga0501084_0067583 3300054114 Bacteria 2992
347 Ga0501084_0829294 3300054114 Unclassified 778
348 Ga0501084_1195622 3300054114 Bacteria 638
349 Ga0590071_025164 3300059421 Unclassified 1411
350 Ga0590074_031407 3300059423 Unclassified 939
351 Ga0590075_013152 3300059424 Unclassified 2013
352 Ga0501082_0043108 3300060353 Bacteria 3890
353 Ga0501082_0443680 3300060353 Unclassified 1134
354 Ga0530510_0061861 3300061734 Bacteria 2710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_451436_c1 nmdc:mga0n895_451436_c1_458_685 75
2 3300005347 Ga0070668_100253266 Ga0070668_1002532663 80
3 3300005547 Ga0070693_100334648 Ga0070693_1003346482 80
4 3300005614 Ga0068856_100514490 Ga0068856_1005144902 80
5 3300006852 Ga0075433_11400209 Ga0075433_114002091 80
6 3300006871 Ga0075434_100711706 Ga0075434_1007117062 80
7 3300006914 Ga0075436_100682402 Ga0075436_1006824023 80
8 3300007076 Ga0075435_100658730 Ga0075435_1006587302 80
9 3300013104 Ga0157370_10609956 Ga0157370_106099561 80
10 3300013105 Ga0157369_10634053 Ga0157369_106340532 80
11 3300013307 Ga0157372_11277295 Ga0157372_112772952 80
12 3300044694 Ga0466963_0095881 Ga0466963_0095881_645_887 80
13 3300050513 nmdc:mga0rr50_686337_c1 nmdc:mga0rr50_686337_c1_281_523 80
14 3300050514 nmdc:mga08x19_524607_c1 nmdc:mga08x19_524607_c1_30_272 80
15 2088090002 CNA_F7QKVOU01BNE3C CNA_00916910 81
16 2088090003 LJN_F7QKVOU01B3MP4 LJN_02990240 81
17 3300005289 Ga0065704_10668715 Ga0065704_106687151 81
18 3300005290 Ga0065712_10052162 Ga0065712_100521621 81
19 3300005290 Ga0065712_10429222 Ga0065712_104292221 81
20 3300005295 Ga0065707_10782458 Ga0065707_107824581 81
21 3300005330 Ga0070690_100206213 Ga0070690_1002062132 81
22 3300005331 Ga0070670_100000152 Ga0070670_10000015253 81
23 3300005334 Ga0068869_100391587 Ga0068869_1003915871 81
24 3300005334 Ga0068869_101064766 Ga0068869_1010647662 81
25 3300005334 Ga0068869_101602710 Ga0068869_1016027101 81
26 3300005335 Ga0070666_10509014 Ga0070666_105090141 81
27 3300005336 Ga0070680_101781633 Ga0070680_1017816331 81
28 3300005338 Ga0068868_100863342 Ga0068868_1008633422 81
29 3300005338 Ga0068868_102430467 Ga0068868_1024304671 81
30 3300005339 Ga0070660_100396057 Ga0070660_1003960572 81
31 3300005341 Ga0070691_11032947 Ga0070691_110329471 81
32 3300005344 Ga0070661_100019030 Ga0070661_1000190304 81
33 3300005347 Ga0070668_100867519 Ga0070668_1008675191 81
34 3300005353 Ga0070669_100268863 Ga0070669_1002688631 81
35 3300005354 Ga0070675_100096734 Ga0070675_1000967343 81
36 3300005354 Ga0070675_100529090 Ga0070675_1005290902 81
37 3300005355 Ga0070671_101389497 Ga0070671_1013894971 81
38 3300005356 Ga0070674_101391704 Ga0070674_1013917042 81
39 3300005356 Ga0070674_101959700 Ga0070674_1019597002 81
40 3300005364 Ga0070673_100144858 Ga0070673_1001448583 81
41 3300005364 Ga0070673_101038641 Ga0070673_1010386411 81
42 3300005365 Ga0070688_100760177 Ga0070688_1007601772 81
43 3300005366 Ga0070659_100298336 Ga0070659_1002983362 81
44 3300005406 Ga0070703_10171615 Ga0070703_101716152 81
45 3300005438 Ga0070701_10067071 Ga0070701_100670712 81
46 3300005440 Ga0070705_100179537 Ga0070705_1001795373 81
47 3300005440 Ga0070705_100283161 Ga0070705_1002831611 81
48 3300005440 Ga0070705_100296034 Ga0070705_1002960342 81
49 3300005441 Ga0070700_101624961 Ga0070700_1016249612 81
50 3300005444 Ga0070694_100060158 Ga0070694_1000601582 81
51 3300005444 Ga0070694_100101248 Ga0070694_1001012483 81
52 3300005444 Ga0070694_100683975 Ga0070694_1006839752 81
53 3300005444 Ga0070694_100758865 Ga0070694_1007588653 81
54 3300005445 Ga0070708_100819217 Ga0070708_1008192172 81
55 3300005445 Ga0070708_102216854 Ga0070708_1022168541 81
56 3300005455 Ga0070663_101958835 Ga0070663_1019588352 81
57 3300005456 Ga0070678_101068749 Ga0070678_1010687491 81
58 3300005457 Ga0070662_100330116 Ga0070662_1003301162 81
59 3300005459 Ga0068867_100246932 Ga0068867_1002469323 81
60 3300005459 Ga0068867_100307271 Ga0068867_1003072713 81
61 3300005459 Ga0068867_101184896 Ga0068867_1011848962 81
62 3300005466 Ga0070685_10519681 Ga0070685_105196812 81
63 3300005467 Ga0070706_100046389 Ga0070706_1000463895 81
64 3300005468 Ga0070707_100351674 Ga0070707_1003516742 81
65 3300005471 Ga0070698_100001287 Ga0070698_1000012874 81
66 3300005471 Ga0070698_100533862 Ga0070698_1005338622 81
67 3300005471 Ga0070698_101976592 Ga0070698_1019765921 81
68 3300005536 Ga0070697_101544651 Ga0070697_1015446512 81
69 3300005539 Ga0068853_100128563 Ga0068853_1001285632 81
70 3300005539 Ga0068853_100519734 Ga0068853_1005197343 81
71 3300005543 Ga0070672_102085083 Ga0070672_1020850832 81
72 3300005545 Ga0070695_100698822 Ga0070695_1006988221 81
73 3300005545 Ga0070695_101667200 Ga0070695_1016672001 81
74 3300005546 Ga0070696_100685487 Ga0070696_1006854872 81
75 3300005546 Ga0070696_100693152 Ga0070696_1006931522 81
76 3300005547 Ga0070693_100540734 Ga0070693_1005407341 81
77 3300005548 Ga0070665_102074726 Ga0070665_1020747262 81
78 3300005549 Ga0070704_100182567 Ga0070704_1001825672 81
79 3300005549 Ga0070704_100478111 Ga0070704_1004781112 81
80 3300005564 Ga0070664_100011733 Ga0070664_1000117337 81
81 3300005577 Ga0068857_101821580 Ga0068857_1018215802 81
82 3300005616 Ga0068852_100292276 Ga0068852_1002922763 81
83 3300005617 Ga0068859_100117366 Ga0068859_1001173663 81
84 3300005617 Ga0068859_100636591 Ga0068859_1006365912 81
85 3300005617 Ga0068859_102350921 Ga0068859_1023509212 81
86 3300005617 Ga0068859_102388298 Ga0068859_1023882981 81
87 3300005618 Ga0068864_100381944 Ga0068864_1003819442 81
88 3300005618 Ga0068864_101012030 Ga0068864_1010120301 81
89 3300005618 Ga0068864_101328610 Ga0068864_1013286101 81
90 3300005718 Ga0068866_10515914 Ga0068866_105159142 81
91 3300005719 Ga0068861_100239405 Ga0068861_1002394052 81
92 3300005719 Ga0068861_100771650 Ga0068861_1007716502 81
93 3300005719 Ga0068861_101133376 Ga0068861_1011333761 81
94 3300005840 Ga0068870_10203425 Ga0068870_102034252 81
95 3300005840 Ga0068870_11162492 Ga0068870_111624921 81
96 3300005841 Ga0068863_100149161 Ga0068863_1001491613 81
97 3300005841 Ga0068863_100562274 Ga0068863_1005622741 81
98 3300005841 Ga0068863_100933074 Ga0068863_1009330742 81
99 3300005843 Ga0068860_100289759 Ga0068860_1002897593 81
100 3300005843 Ga0068860_100802877 Ga0068860_1008028772 81
101 3300005843 Ga0068860_101943237 Ga0068860_1019432371 81
102 3300005843 Ga0068860_102800441 Ga0068860_1028004411 81
103 3300005844 Ga0068862_100124230 Ga0068862_1001242301 81
104 3300005937 Ga0081455_10009605 Ga0081455_100096057 81
105 3300005937 Ga0081455_10015920 Ga0081455_100159202 81
106 3300005937 Ga0081455_10079432 Ga0081455_100794324 81
107 3300005981 Ga0081538_10023918 Ga0081538_100239183 81
108 3300006028 Ga0070717_10168336 Ga0070717_101683365 81
109 3300006358 Ga0068871_100091801 Ga0068871_1000918014 81
110 3300006358 Ga0068871_102055326 Ga0068871_1020553261 81
111 3300006844 Ga0075428_100037332 Ga0075428_1000373327 81
112 3300006844 Ga0075428_100117242 Ga0075428_1001172424 81
113 3300006846 Ga0075430_100022159 Ga0075430_1000221593 81
114 3300006846 Ga0075430_100029061 Ga0075430_1000290613 81
115 3300006846 Ga0075430_100068708 Ga0075430_1000687082 81
116 3300006846 Ga0075430_100274148 Ga0075430_1002741482 81
117 3300006847 Ga0075431_100013769 Ga0075431_1000137694 81
118 3300006847 Ga0075431_100032099 Ga0075431_1000320994 81
119 3300006847 Ga0075431_100349562 Ga0075431_1003495623 81
120 3300006847 Ga0075431_101702071 Ga0075431_1017020711 81
121 3300006852 Ga0075433_10155290 Ga0075433_101552903 81
122 3300006852 Ga0075433_10409902 Ga0075433_104099022 81
123 3300006880 Ga0075429_100050904 Ga0075429_1000509045 81
124 3300006880 Ga0075429_100599698 Ga0075429_1005996982 81
125 3300006880 Ga0075429_101247273 Ga0075429_1012472732 81
126 3300006881 Ga0068865_101175490 Ga0068865_1011754901 81
127 3300006914 Ga0075436_100009359 Ga0075436_1000093596 81
128 3300006931 Ga0097620_100117364 Ga0097620_1001173643 81
129 3300006931 Ga0097620_100636511 Ga0097620_1006365112 81
130 3300006931 Ga0097620_102350824 Ga0097620_1023508242 81
131 3300006931 Ga0097620_102388003 Ga0097620_1023880031 81
132 3300007076 Ga0075435_100067463 Ga0075435_1000674634 81
133 3300007076 Ga0075435_101729970 Ga0075435_1017299701 81
134 3300009011 Ga0105251_10109504 Ga0105251_101095042 81
135 3300009094 Ga0111539_11074286 Ga0111539_110742862 81
136 3300009098 Ga0105245_11503254 Ga0105245_115032542 81
137 3300009101 Ga0105247_11638639 Ga0105247_116386392 81
138 3300009147 Ga0114129_10119044 Ga0114129_101190443 81
139 3300009147 Ga0114129_10265373 Ga0114129_102653732 81
140 3300009147 Ga0114129_10961831 Ga0114129_109618312 81
141 3300009174 Ga0105241_10594408 Ga0105241_105944082 81
142 3300009176 Ga0105242_10289316 Ga0105242_102893162 81
143 3300009176 Ga0105242_10663016 Ga0105242_106630161 81
144 3300009177 Ga0105248_10120902 Ga0105248_101209023 81
145 3300009177 Ga0105248_10556077 Ga0105248_105560772 81
146 3300009177 Ga0105248_11150908 Ga0105248_111509082 81
147 3300009551 Ga0105238_10734936 Ga0105238_107349362 81
148 3300009553 Ga0105249_11196957 Ga0105249_111969571 81
149 3300011119 Ga0105246_10259990 Ga0105246_102599902 81
150 3300011119 Ga0105246_10739487 Ga0105246_107394872 81
151 3300013296 Ga0157374_12302362 Ga0157374_123023622 81
152 3300013306 Ga0163162_10556486 Ga0163162_105564861 81
153 3300013307 Ga0157372_10451316 Ga0157372_104513162 81
154 3300013308 Ga0157375_10071870 Ga0157375_100718705 81
155 3300014325 Ga0163163_10000026 Ga0163163_1000002666 81
156 3300014325 Ga0163163_10032994 Ga0163163_100329943 81
157 3300014325 Ga0163163_10113104 Ga0163163_101131044 81
158 3300014325 Ga0163163_10228191 Ga0163163_102281913 81
159 3300014326 Ga0157380_10177481 Ga0157380_101774812 81
160 3300014326 Ga0157380_10505693 Ga0157380_105056932 81
161 3300014968 Ga0157379_11385935 Ga0157379_113859352 81
162 3300014969 Ga0157376_10073811 Ga0157376_100738111 81
163 3300017792 Ga0163161_11133229 Ga0163161_111332292 81
164 3300021384 Ga0213876_10307497 Ga0213876_103074972 81
165 3300025735 Ga0207713_1256055 Ga0207713_12560551 81
166 3300025908 Ga0207643_10927374 Ga0207643_109273742 81
167 3300025910 Ga0207684_10064915 Ga0207684_100649155 81
168 3300025910 Ga0207684_10517248 Ga0207684_105172481 81
169 3300025911 Ga0207654_10230459 Ga0207654_102304591 81
170 3300025911 Ga0207654_10285189 Ga0207654_102851892 81
171 3300025911 Ga0207654_11153873 Ga0207654_111538732 81
172 3300025912 Ga0207707_10126806 Ga0207707_101268063 81
173 3300025917 Ga0207660_10073914 Ga0207660_100739143 81
174 3300025917 Ga0207660_10539025 Ga0207660_105390251 81
175 3300025919 Ga0207657_10358602 Ga0207657_103586022 81
176 3300025920 Ga0207649_10028703 Ga0207649_100287034 81
177 3300025922 Ga0207646_10017630 Ga0207646_100176305 81
178 3300025922 Ga0207646_10826425 Ga0207646_108264252 81
179 3300025922 Ga0207646_10873257 Ga0207646_108732572 81
180 3300025925 Ga0207650_10000006 Ga0207650_1000000686 81
181 3300025925 Ga0207650_11156235 Ga0207650_111562351 81
182 3300025927 Ga0207687_11049690 Ga0207687_110496901 81
183 3300025932 Ga0207690_10136772 Ga0207690_101367723 81
184 3300025932 Ga0207690_10146074 Ga0207690_101460742 81
185 3300025933 Ga0207706_10033682 Ga0207706_100336822 81
186 3300025933 Ga0207706_10323059 Ga0207706_103230591 81
187 3300025933 Ga0207706_11642727 Ga0207706_116427272 81
188 3300025934 Ga0207686_10380601 Ga0207686_103806012 81
189 3300025935 Ga0207709_10117798 Ga0207709_101177984 81
190 3300025941 Ga0207711_11316270 Ga0207711_113162702 81
191 3300025942 Ga0207689_10447549 Ga0207689_104475492 81
192 3300025960 Ga0207651_10071908 Ga0207651_100719082 81
193 3300025981 Ga0207640_11815722 Ga0207640_118157221 81
194 3300026023 Ga0207677_12181139 Ga0207677_121811391 81
195 3300026041 Ga0207639_10436423 Ga0207639_104364232 81
196 3300026041 Ga0207639_10831572 Ga0207639_108315723 81
197 3300026075 Ga0207708_10032806 Ga0207708_100328064 81
198 3300026075 Ga0207708_10418422 Ga0207708_104184222 81
199 3300026088 Ga0207641_10885563 Ga0207641_108855632 81
200 3300026088 Ga0207641_11134817 Ga0207641_111348171 81
201 3300026088 Ga0207641_12118524 Ga0207641_121185241 81
202 3300026089 Ga0207648_10088599 Ga0207648_100885994 81
203 3300026089 Ga0207648_10646436 Ga0207648_106464362 81
204 3300026095 Ga0207676_10137998 Ga0207676_101379983 81
205 3300026095 Ga0207676_10138640 Ga0207676_101386403 81
206 3300026116 Ga0207674_10002702 Ga0207674_1000270213 81
207 3300026116 Ga0207674_10170111 Ga0207674_101701113 81
208 3300026118 Ga0207675_100150706 Ga0207675_1001507063 81
209 3300026118 Ga0207675_101295592 Ga0207675_1012955923 81
210 3300026118 Ga0207675_101315647 Ga0207675_1013156471 81
211 3300026121 Ga0207683_10821318 Ga0207683_108213181 81
212 3300027907 Ga0207428_11010315 Ga0207428_110103152 81
213 3300028379 Ga0268266_11790027 Ga0268266_117900272 81
214 3300028381 Ga0268264_10371053 Ga0268264_103710533 81
215 3300028381 Ga0268264_11853490 Ga0268264_118534902 81
216 3300028381 Ga0268264_11904054 Ga0268264_119040541 81
217 3300028381 Ga0268264_12045638 Ga0268264_120456381 81
218 3300031548 Ga0307408_100341335 Ga0307408_1003413352 81
219 3300031731 Ga0307405_10455131 Ga0307405_104551312 81
220 3300031731 Ga0307405_11608945 Ga0307405_116089452 81
221 3300031824 Ga0307413_10255121 Ga0307413_102551212 81
222 3300031852 Ga0307410_10215722 Ga0307410_102157222 81
223 3300031901 Ga0307406_10142726 Ga0307406_101427263 81
224 3300032002 Ga0307416_100210590 Ga0307416_1002105903 81
225 3300032002 Ga0307416_100309432 Ga0307416_1003094323 81
226 3300032002 Ga0307416_101542255 Ga0307416_1015422552 81
227 3300032005 Ga0307411_10697656 Ga0307411_106976562 81
228 3300032126 Ga0307415_100013722 Ga0307415_1000137223 81
229 3300032126 Ga0307415_100086567 Ga0307415_1000865673 81
230 3300035088 Ga0373940_0079799 Ga0373940_0079799_681_926 81
231 3300035170 Ga0373943_0315065 Ga0373943_0315065_153_398 81
232 3300036401 Ga0373937_1096828 Ga0373937_1096828_148_393 81
233 3300037418 Ga0395900_0048296 Ga0395900_0048296_3410_3655 81
234 3300037466 Ga0395898_0444302 Ga0395898_0444302_966_1211 81
235 3300037466 Ga0395898_0726254 Ga0395898_0726254_195_440 81
236 3300037471 Ga0395905_0012466 Ga0395905_0012466_5625_5870 81
237 3300038443 Ga0395901_0011930 Ga0395901_0011930_7211_7456 81
238 3300038443 Ga0395901_0695499 Ga0395901_0695499_503_748 81
239 3300039437 Ga0436365_1336455 Ga0436365_1336455_320_565 81
240 3300042003 Ga0439443_004111 Ga0439443_004111_930_1175 81
241 3300042005 Ga0439448_0000526 Ga0439448_0000526_2659_2904 81
242 3300042008 Ga0439450_000415 Ga0439450_000415_765_1010 81
243 3300042009 Ga0439451_030552 Ga0439451_030552_71_316 81
244 3300042009 Ga0439451_039496 Ga0439451_039496_300_545 81
245 3300042011 Ga0439454_068212 Ga0439454_068212_284_529 81
246 3300042016 Ga0439463_001136 Ga0439463_001136_4217_4462 81
247 3300042117 Ga0450913_002108 Ga0450913_002108_378_623 81
248 3300042126 Ga0450888_012260 Ga0450888_012260_251_496 81
249 3300042136 Ga0450900_006681 Ga0450900_006681_391_636 81
250 3300042137 Ga0450902_027726 Ga0450902_027726_593_838 81
251 3300042142 Ga0450905_001908 Ga0450905_001908_1818_2063 81
252 3300042144 Ga0450889_007901 Ga0450889_007901_795_1040 81
253 3300042437 Ga0439444_0002015 Ga0439444_0002015_948_1193 81
254 3300042439 Ga0439464_0001482 Ga0439464_0001482_3678_3923 81
255 3300042461 Ga0439460_0003044 Ga0439460_0003044_2213_2458 81
256 3300042530 Ga0450916_009151 Ga0450916_009151_809_1054 81
257 3300042993 Ga0439440_0017145 Ga0439440_0017145_909_1154 81
258 3300042993 Ga0439440_0039449 Ga0439440_0039449_685_930 81
259 3300042993 Ga0439440_0165535 Ga0439440_0165535_329_574 81
260 3300045051 Ga0451576_0822201 Ga0451576_0822201_607_852 81
261 3300045051 Ga0451576_0976111 Ga0451576_0976111_529_774 81
262 3300045051 Ga0451576_1148609 Ga0451576_1148609_189_434 81
263 3300045976 Ga0466967_0281439 Ga0466967_0281439_1145_1390 81
264 3300046517 Ga0495630_0359715 Ga0495630_0359715_491_736 81
265 3300046523 Ga0495644_0282688 Ga0495644_0282688_43_288 81
266 3300046533 Ga0495640_0695243 Ga0495640_0695243_330_575 81
267 3300046535 Ga0495586_0237646 Ga0495586_0237646_745_990 81
268 3300046642 Ga0495634_0358216 Ga0495634_0358216_34_279 81
269 3300046683 Ga0495658_0023265 Ga0495658_0023265_1892_2137 81
270 3300047444 Ga0495675_0608579 Ga0495675_0608579_295_540 81
271 3300048915 Ga0496112_0477156 Ga0496112_0477156_191_436 81
272 3300049569 Ga0501032_0586821 Ga0501032_0586821_375_620 81
273 3300049569 Ga0501032_0689300 Ga0501032_0689300_284_529 81
274 3300049570 Ga0501033_0017093 Ga0501033_0017093_4001_4246 81
275 3300049570 Ga0501033_0198680 Ga0501033_0198680_108_353 81
276 3300049571 Ga0501034_0298303 Ga0501034_0298303_641_886 81
277 3300049571 Ga0501034_1588875 Ga0501034_1588875_198_443 81
278 3300049572 Ga0501036_0008156 Ga0501036_0008156_4784_5029 81
279 3300049572 Ga0501036_0012337 Ga0501036_0012337_4061_4306 81
280 3300049572 Ga0501036_1463830 Ga0501036_1463830_85_330 81
281 3300049573 Ga0501037_0584243 Ga0501037_0584243_159_404 81
282 3300049574 Ga0501038_0011620 Ga0501038_0011620_4248_4493 81
283 3300049575 Ga0501039_0041541 Ga0501039_0041541_666_911 81
284 3300049575 Ga0501039_0858764 Ga0501039_0858764_111_356 81
285 3300049576 Ga0501040_0001440 Ga0501040_0001440_2800_3045 81
286 3300049576 Ga0501040_0017339 Ga0501040_0017339_1876_2121 81
287 3300049576 Ga0501040_0482716 Ga0501040_0482716_316_561 81
288 3300049576 Ga0501040_1301309 Ga0501040_1301309_39_284 81
289 3300049576 Ga0501040_1400566 Ga0501040_1400566_120_365 81
290 3300049577 Ga0501041_0001926 Ga0501041_0001926_6874_7119 81
291 3300049578 Ga0501042_1340885 Ga0501042_1340885_104_349 81
292 3300049579 Ga0501043_0310023 Ga0501043_0310023_784_1029 81
293 3300049580 Ga0501046_0004952 Ga0501046_0004952_6750_6995 81
294 3300049580 Ga0501046_0701334 Ga0501046_0701334_253_498 81
295 3300049582 Ga0501048_0110389 Ga0501048_0110389_641_886 81
296 3300049582 Ga0501048_0295977 Ga0501048_0295977_202_447 81
297 3300049584 Ga0501068_0028870 Ga0501068_0028870_1544_1789 81
298 3300049584 Ga0501068_0242299 Ga0501068_0242299_434_679 81
299 3300049584 Ga0501068_1209830 Ga0501068_1209830_26_271 81
300 3300049586 Ga0501070_1254404 Ga0501070_1254404_51_296 81
301 3300049587 Ga0501071_0747565 Ga0501071_0747565_281_526 81
302 3300049588 Ga0501072_0014848 Ga0501072_0014848_5566_5811 81
303 3300049590 Ga0501074_0427883 Ga0501074_0427883_352_597 81
304 3300049590 Ga0501074_0586874 Ga0501074_0586874_60_305 81
305 3300049591 Ga0501075_0009052 Ga0501075_0009052_1571_1816 81
306 3300049591 Ga0501075_0086625 Ga0501075_0086625_694_939 81
307 3300049591 Ga0501075_0221265 Ga0501075_0221265_862_1107 81
308 3300049591 Ga0501075_0817753 Ga0501075_0817753_331_576 81
309 3300049592 Ga0501076_0004964 Ga0501076_0004964_3912_4157 81
310 3300049592 Ga0501076_0063875 Ga0501076_0063875_1788_2033 81
311 3300049592 Ga0501076_0095029 Ga0501076_0095029_1357_1602 81
312 3300049592 Ga0501076_0190394 Ga0501076_0190394_1171_1416 81
313 3300049592 Ga0501076_1222314 Ga0501076_1222314_136_381 81
314 3300049593 Ga0501077_0083384 Ga0501077_0083384_1469_1714 81
315 3300049593 Ga0501077_0194263 Ga0501077_0194263_792_1037 81
316 3300049741 Ga0501079_0010396 Ga0501079_0010396_4865_5110 81
317 3300049741 Ga0501079_0031445 Ga0501079_0031445_1618_1863 81
318 3300049742 Ga0501080_0874478 Ga0501080_0874478_41_286 81
319 3300049743 Ga0501081_0000827 Ga0501081_0000827_3727_3972 81
320 3300049743 Ga0501081_0137849 Ga0501081_0137849_1355_1600 81
321 3300049743 Ga0501081_0503174 Ga0501081_0503174_209_454 81
322 3300049743 Ga0501081_0643985 Ga0501081_0643985_279_524 81
323 3300049744 Ga0501083_0201972 Ga0501083_0201972_281_526 81
324 3300049822 Ga0501035_0170561 Ga0501035_0170561_1385_1630 81
325 3300049822 Ga0501035_0349682 Ga0501035_0349682_597_842 81
326 3300049823 Ga0501044_1161079 Ga0501044_1161079_207_452 81
327 3300049824 Ga0501045_0007238 Ga0501045_0007238_4818_5063 81
328 3300049824 Ga0501045_0071638 Ga0501045_0071638_554_799 81
329 3300049824 Ga0501045_0331327 Ga0501045_0331327_726_971 81
330 3300050507 nmdc:mga05p37_111311_c1 nmdc:mga05p37_111311_c1_1937_2182 81
331 3300050507 nmdc:mga05p37_276393_c1 nmdc:mga05p37_276393_c1_1725_1970 81
332 3300050507 nmdc:mga05p37_338944_c1 nmdc:mga05p37_338944_c1_1505_1750 81
333 3300050508 nmdc:mga09592_18700_c1 nmdc:mga09592_18700_c1_922_1167 81
334 3300050509 nmdc:mga0qj67_26961_c1 nmdc:mga0qj67_26961_c1_3949_4194 81
335 3300050509 nmdc:mga0qj67_410960_c1 nmdc:mga0qj67_410960_c1_469_714 81
336 3300050510 nmdc:mga06r32_606641_c1 nmdc:mga06r32_606641_c1_218_463 81
337 3300050510 nmdc:mga06r32_706981_c1 nmdc:mga06r32_706981_c1_323_568 81
338 3300050510 nmdc:mga06r32_840776_c1 nmdc:mga06r32_840776_c1_376_621 81
339 3300050510 nmdc:mga06r32_94651_c1 nmdc:mga06r32_94651_c1_2123_2368 81
340 3300050513 nmdc:mga0rr50_16637_c1 nmdc:mga0rr50_16637_c1_1736_1981 81
341 3300050513 nmdc:mga0rr50_472602_c1 nmdc:mga0rr50_472602_c1_29_274 81
342 3300050515 nmdc:mga0a205_1519245_c1 nmdc:mga0a205_1519245_c1_68_313 81
343 3300050515 nmdc:mga0a205_165872_c1 nmdc:mga0a205_165872_c1_126_371 81
344 3300053085 Ga0495619_0574876 Ga0495619_0574876_39_284 81
345 3300054114 Ga0501084_0017911 Ga0501084_0017911_210_455 81
346 3300054114 Ga0501084_0067583 Ga0501084_0067583_127_372 81
347 3300054114 Ga0501084_0829294 Ga0501084_0829294_194_439 81
348 3300054114 Ga0501084_1195622 Ga0501084_1195622_137_382 81
349 3300059421 Ga0590071_025164 Ga0590071_025164_751_996 81
350 3300059423 Ga0590074_031407 Ga0590074_031407_287_532 81
351 3300059424 Ga0590075_013152 Ga0590075_013152_847_1092 81
352 3300060353 Ga0501082_0043108 Ga0501082_0043108_2290_2535 81
353 3300060353 Ga0501082_0443680 Ga0501082_0443680_442_687 81
354 3300061734 Ga0530510_0061861 Ga0530510_0061861_2440_2685 81

Feature Viewer

pLDDT pTM Quality
65.16 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map