F419686

General Info

Members Datasets Scaffolds Average Seq Length
354 199 708 405

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100086271|Ga0068856_1000862712
Length 443
Sequence MSRGRVLIVSYYFPPAGGSGVHRVLKLCKYLPEFGWDVDVLAPDDPKWVAHDPTLEQDVPEGVVVHRARYIGPDHAQSGADKIAAAQGWQTVTARAAVAGRRMLLPDAAAPWVPFAARTGIAAVRERGIDAVLTSSPPTSAHLIGNVISRRTGVPWVADFRDSWLANPHRRYERRTVRYKRSLLSGIARRTMAPAAALTAVTDVIREEAEGYMSRPVPSRTISNGCDFDDFAAYQHRGSAKLRLLHAGYFFGVRSPRPLLQAVRSLLDRRPALRDVLEVRFVGGFRPADREWAESLDLGPVMTVEGTLPHDQTLQAMKEADALVLLIPNASGIGRTVLSGKVFEYLAAERPILGLVPPDGAAADLLRSAGHDWIADPDDVNAITDTVERLVDAWIANRLGDVVIPPELRARLDRRARAEEMAAVLAEVTGRTAVGPVAMGAEL

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.95
Rhizosphere 83.05
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100086271 3300005614 Bacteria 3119
2 Ga0070683_100024169 3300005329 Bacteria 5439
3 Ga0070683_100076076 3300005329 Bacteria 3138
4 Ga0070683_100108198 3300005329 Bacteria 2621
5 Ga0070666_10083292 3300005335 Bacteria 2188
6 Ga0070682_100095851 3300005337 Bacteria 1949
7 Ga0068868_100016188 3300005338 Bacteria 5532
8 Ga0070660_100000839 3300005339 Bacteria 20439
9 Ga0070660_100076121 3300005339 Bacteria 2628
10 Ga0070689_100042046 3300005340 Bacteria 3509
11 Ga0070692_10044228 3300005345 Bacteria 2293
12 Ga0070669_100064878 3300005353 Bacteria 2690
13 Ga0070675_100146976 3300005354 Bacteria 2019
14 Ga0070671_100153629 3300005355 Bacteria 1944
15 Ga0070674_100009904 3300005356 Bacteria 5736
16 Ga0070674_100113924 3300005356 Bacteria 1991
17 Ga0070688_100006249 3300005365 Bacteria 6349
18 Ga0070703_10012016 3300005406 Unclassified 2450
19 Ga0070709_10103904 3300005434 Bacteria 1898
20 Ga0070713_100062872 3300005436 Bacteria 3110
21 Ga0070710_10007802 3300005437 Bacteria 5193
22 Ga0070710_10070313 3300005437 Bacteria 2016
23 Ga0070711_100094382 3300005439 Bacteria 2162
24 Ga0070711_100145632 3300005439 Unclassified 1781
25 Ga0070705_100014082 3300005440 Bacteria 4106
26 Ga0070705_100055991 3300005440 Bacteria 2320
27 Ga0070700_100101822 3300005441 Bacteria 1893
28 Ga0070708_100066161 3300005445 Bacteria 3243
29 Ga0070678_100005721 3300005456 Bacteria 7221
30 Ga0070678_100143999 3300005456 Bacteria 1911
31 Ga0070681_10001932 3300005458 Bacteria 18705
32 Ga0070681_10277048 3300005458 Bacteria 1588
33 Ga0068867_100008232 3300005459 Bacteria 7363
34 Ga0070685_10049958 3300005466 Bacteria 2414
35 Ga0070706_100009992 3300005467 Bacteria 8813
36 Ga0070706_100051592 3300005467 Bacteria 3796
37 Ga0070706_100142403 3300005467 Bacteria 2238
38 Ga0070706_100162175 3300005467 Bacteria 2088
39 Ga0070707_100017184 3300005468 Bacteria 6798
40 Ga0070707_100029888 3300005468 Bacteria 5186
41 Ga0070707_100034168 3300005468 Bacteria 4849
42 Ga0070698_100034694 3300005471 Bacteria 5220
43 Ga0070698_100095068 3300005471 Bacteria 2958
44 Ga0070699_100064047 3300005518 Bacteria 3189
45 Ga0070679_100031905 3300005530 Bacteria 5208
46 Ga0070679_100354360 3300005530 Unclassified 1415
47 Ga0070684_100000993 3300005535 Bacteria 20241
48 Ga0068853_100171383 3300005539 Bacteria 1964
49 Ga0070686_100002823 3300005544 Bacteria 9568
50 Ga0070686_100009701 3300005544 Bacteria 5412
51 Ga0070693_100138173 3300005547 Bacteria 1531
52 Ga0070704_100158724 3300005549 Bacteria 1786
53 Ga0068855_100061817 3300005563 Bacteria 4375
54 Ga0070664_100108429 3300005564 Bacteria 2421
55 Ga0068857_100000778 3300005577 Bacteria 23783
56 Ga0070702_100007029 3300005615 Bacteria 5367
57 Ga0070702_100007665 3300005615 Bacteria 5178
58 Ga0070702_100140415 3300005615 Bacteria 1538
59 Ga0068852_100020952 3300005616 Bacteria 5206
60 Ga0068859_100086560 3300005617 Bacteria 3181
61 Ga0068859_100200715 3300005617 Bacteria 2079
62 Ga0068864_100120337 3300005618 Unclassified 2347
63 Ga0068866_10029762 3300005718 Bacteria 2614
64 Ga0068866_10052463 3300005718 Bacteria 2081
65 Ga0068861_100057396 3300005719 Bacteria 2973
66 Ga0068858_100018296 3300005842 Bacteria 6561
67 Ga0068860_100003145 3300005843 Bacteria 17056
68 Ga0081455_10057466 3300005937 Bacteria 3297
69 Ga0081540_1004742 3300005983 Bacteria 10280
70 Ga0070717_10019715 3300006028 Bacteria 5293
71 Ga0075432_10024511 3300006058 Bacteria 2068
72 Ga0070712_100024494 3300006175 Bacteria 4001
73 Ga0097621_100032308 3300006237 Bacteria 4160
74 Ga0068871_100008935 3300006358 Bacteria 7230
75 Ga0075428_100012023 3300006844 Bacteria 9630
76 Ga0075430_100015798 3300006846 Bacteria 6429
77 Ga0075430_100056276 3300006846 Bacteria 3307
78 Ga0075431_100250999 3300006847 Bacteria 1798
79 Ga0075433_10021316 3300006852 Bacteria 5433
80 Ga0075434_100108487 3300006871 Unclassified 2786
81 Ga0075434_100112063 3300006871 Bacteria 2739
82 Ga0075429_100001156 3300006880 Bacteria 21278
83 Ga0068865_100032580 3300006881 Bacteria 3483
84 Ga0068865_100084567 3300006881 Bacteria 2286
85 Ga0075436_100011378 3300006914 Bacteria 6108
86 Ga0075436_100054595 3300006914 Bacteria 2758
87 Ga0097620_100086561 3300006931 Bacteria 3181
88 Ga0097620_100200709 3300006931 Bacteria 2079
89 Ga0075435_100021549 3300007076 Bacteria 4958
90 Ga0075435_100120554 3300007076 Bacteria 2188
91 Ga0105250_10053943 3300009092 Bacteria 1612
92 Ga0105240_10089813 3300009093 Bacteria 3757
93 Ga0111539_10090825 3300009094 Bacteria 3589
94 Ga0111539_10294928 3300009094 Bacteria 1887
95 Ga0105247_10033960 3300009101 Bacteria 3106
96 Ga0114129_10001101 3300009147 Bacteria 35510
97 Ga0114129_10043477 3300009147 Bacteria 6320
98 Ga0114129_10082242 3300009147 Bacteria 4475
99 Ga0114129_10120789 3300009147 Bacteria 3607
100 Ga0105243_10001387 3300009148 Bacteria 21471
101 Ga0105243_10034145 3300009148 Bacteria 3936
102 Ga0105241_10004998 3300009174 Bacteria 9786
103 Ga0105242_10206057 3300009176 Bacteria 1749
104 Ga0105248_10036710 3300009177 Bacteria 5481
105 Ga0105248_10062008 3300009177 Bacteria 4199
106 Ga0105248_10108823 3300009177 Unclassified 3125
107 Ga0105238_10068922 3300009551 Unclassified 3538
108 Ga0157370_10001997 3300013104 Bacteria 25058
109 Ga0157374_10002319 3300013296 Bacteria 16049
110 Ga0157374_10214474 3300013296 Bacteria 1888
111 Ga0157374_10252864 3300013296 Bacteria 1734
112 Ga0157378_10005390 3300013297 Bacteria 11215
113 Ga0157378_10037688 3300013297 Bacteria 4284
114 Ga0163162_10018315 3300013306 Bacteria 6859
115 Ga0163162_10244233 3300013306 Bacteria 1927
116 Ga0157375_10004196 3300013308 Bacteria 12510
117 Ga0157375_10014238 3300013308 Bacteria 7089
118 Ga0157375_10079995 3300013308 Bacteria 3305
119 Ga0157377_10003943 3300014745 Bacteria 6765
120 Ga0157377_10049524 3300014745 Bacteria 2362
121 Ga0157379_10001684 3300014968 Bacteria 18272
122 Ga0157376_10004518 3300014969 Bacteria 9697
123 Ga0207653_10058887 3300025885 Bacteria 1292
124 Ga0207692_10022146 3300025898 Bacteria 2920
125 Ga0207642_10045102 3300025899 Bacteria 1955
126 Ga0207688_10010946 3300025901 Bacteria 4936
127 Ga0207688_10103245 3300025901 Bacteria 1648
128 Ga0207684_10151926 3300025910 Bacteria 1992
129 Ga0207707_10037205 3300025912 Bacteria 4252
130 Ga0207707_10150501 3300025912 Bacteria 2035
131 Ga0207693_10005828 3300025915 Bacteria 10227
132 Ga0207693_10159885 3300025915 Bacteria 1772
133 Ga0207663_10069505 3300025916 Bacteria 2266
134 Ga0207657_10000954 3300025919 Bacteria 30553
135 Ga0207657_10016024 3300025919 Bacteria 7234
136 Ga0207646_10004037 3300025922 Bacteria 16215
137 Ga0207646_10111915 3300025922 Bacteria 2450
138 Ga0207694_10098036 3300025924 Bacteria 2320
139 Ga0207700_10056243 3300025928 Bacteria 2961
140 Ga0207664_10180978 3300025929 Bacteria 1809
141 Ga0207686_10030671 3300025934 Unclassified 3186
142 Ga0207686_10049991 3300025934 Bacteria 2598
143 Ga0207709_10004908 3300025935 Bacteria 7656
144 Ga0207709_10006010 3300025935 Bacteria 6839
145 Ga0207670_10032184 3300025936 Bacteria 3370
146 Ga0207669_10069950 3300025937 Bacteria 2198
147 Ga0207704_10033802 3300025938 Bacteria 2912
148 Ga0207665_10023271 3300025939 Bacteria 4080
149 Ga0207711_10079152 3300025941 Bacteria 2868
150 Ga0207661_10024451 3300025944 Bacteria 4580
151 Ga0207661_10180277 3300025944 Bacteria 1845
152 Ga0207679_10152895 3300025945 Bacteria 1880
153 Ga0207667_10050691 3300025949 Bacteria 4378
154 Ga0207667_10269837 3300025949 Bacteria 1739
155 Ga0207640_10043269 3300025981 Bacteria 2877
156 Ga0207677_10108439 3300026023 Bacteria 2062
157 Ga0207677_10162414 3300026023 Unclassified 1737
158 Ga0207703_10108137 3300026035 Bacteria 2368
159 Ga0207639_10125177 3300026041 Bacteria 2118
160 Ga0207708_10006475 3300026075 Bacteria 8676
161 Ga0207702_10098592 3300026078 Bacteria 2574
162 Ga0207641_10395645 3300026088 Bacteria 1326
163 Ga0207648_10001368 3300026089 Bacteria 26927
164 Ga0207648_10066570 3300026089 Bacteria 3142
165 Ga0207676_10243421 3300026095 Unclassified 1615
166 Ga0207674_10000430 3300026116 Bacteria 54816
167 Ga0207675_100005508 3300026118 Bacteria 12112
168 Ga0207683_10000068 3300026121 Bacteria 78969
169 Ga0207683_10024247 3300026121 Bacteria 5222
170 Ga0207683_10049725 3300026121 Bacteria 3671
171 Ga0207698_10112707 3300026142 Bacteria 2283
172 Ga0268264_10049304 3300028381 Bacteria 3503
173 Ga0265319_1020702 3300028563 Bacteria 2431
174 Ga0265340_10017513 3300031247 Bacteria 3707
175 Ga0265327_10074465 3300031251 Bacteria 1691
176 Ga0265313_10069565 3300031595 Bacteria 1624
177 Ga0307406_10073401 3300031901 Bacteria 2250
178 Ga0307409_100126499 3300031995 Bacteria 2175
179 Ga0373940_0016636 3300035088 Bacteria 1824
180 Ga0373951_0003328 3300035091 Bacteria 3932
181 Ga0373945_0007179 3300035116 Bacteria 3606
182 Ga0373943_0003226 3300035170 Bacteria 7403
183 Ga0373947_0007484 3300035725 Bacteria 6319
184 Ga0373947_0036128 3300035725 Unclassified 2929
185 Ga0373925_0003734 3300037068 Bacteria 11691
186 Ga0395899_0016787 3300037312 Bacteria 5581
187 Ga0395899_0021605 3300037312 Bacteria 4880
188 Ga0395899_0091721 3300037312 Bacteria 2201
189 Ga0395900_0007128 3300037418 Bacteria 11582
190 Ga0395900_0009988 3300037418 Bacteria 9715
191 Ga0395900_0010574 3300037418 Bacteria 9436
192 Ga0395900_0033683 3300037418 Bacteria 5272
193 Ga0395900_0063295 3300037418 Bacteria 3802
194 Ga0395900_0078379 3300037418 Bacteria 3395
195 Ga0395900_0110897 3300037418 Bacteria 2818
196 Ga0395898_0003530 3300037466 Bacteria 17432
197 Ga0395898_0014746 3300037466 Bacteria 8024
198 Ga0395898_0017243 3300037466 Bacteria 7374
199 Ga0395898_0018854 3300037466 Bacteria 7030
200 Ga0395898_0026619 3300037466 Bacteria 5817
201 Ga0395898_0031592 3300037466 Bacteria 5290
202 Ga0395898_0055157 3300037466 Unclassified 3876
203 Ga0395898_0070640 3300037466 Bacteria 3375
204 Ga0395898_0076767 3300037466 Bacteria 3225
205 Ga0395898_0096241 3300037466 Bacteria 2844
206 Ga0395898_0111084 3300037466 Bacteria 2627
207 Ga0395898_0146339 3300037466 Bacteria 2261
208 Ga0395905_0002703 3300037471 Bacteria 19433
209 Ga0395905_0054618 3300037471 Bacteria 3738
210 Ga0395905_0068294 3300037471 Bacteria 3329
211 Ga0395905_0093097 3300037471 Bacteria 2826
212 Ga0395905_0106776 3300037471 Bacteria 2629
213 Ga0395905_0256606 3300037471 Bacteria 1633
214 Ga0395901_0003380 3300038443 Bacteria 16066
215 Ga0395901_0005697 3300038443 Bacteria 12606
216 Ga0395901_0010494 3300038443 Bacteria 9382
217 Ga0395901_0030653 3300038443 Bacteria 5542
218 Ga0395901_0030831 3300038443 Bacteria 5526
219 Ga0395901_0044920 3300038443 Bacteria 4583
220 Ga0395901_0066859 3300038443 Bacteria 3743
221 Ga0395901_0169226 3300038443 Bacteria 2293
222 Ga0395901_0436109 3300038443 Bacteria 1342
223 Ga0466961_0159195 3300044693 Bacteria 1408
224 Ga0466963_0001075 3300044694 Bacteria 14257
225 Ga0466963_0020578 3300044694 Bacteria 4149
226 Ga0466963_0165663 3300044694 Unclassified 1539
227 Ga0466971_0000066 3300044719 Bacteria 39780
228 Ga0466957_0000016 3300044842 Bacteria 66255
229 Ga0466957_0135731 3300044842 Bacteria 1581
230 Ga0466959_0037601 3300045049 Bacteria 3577
231 Ga0466958_0000822 3300045836 Bacteria 13714
232 Ga0466958_0106736 3300045836 Bacteria 1746
233 Ga0466967_0045826 3300045976 Unclassified 3802
234 Ga0466967_0070238 3300045976 Bacteria 3132
235 Ga0466967_0113955 3300045976 Bacteria 2488
236 Ga0466967_0130436 3300045976 Bacteria 2333
237 Ga0466967_0155412 3300045976 Unclassified 2142
238 Ga0495629_0019264 3300046459 Bacteria 4877
239 Ga0495641_0002293 3300046461 Bacteria 15222
240 Ga0495653_0040139 3300046463 Bacteria 3660
241 Ga0495582_0000466 3300046473 Bacteria 22163
242 Ga0495639_0046144 3300046475 Unclassified 1972
243 Ga0495662_0005245 3300046476 Bacteria 6495
244 Ga0495584_0065756 3300046491 Bacteria 1824
245 Ga0495584_0114824 3300046491 Bacteria 1363
246 Ga0495584_0120467 3300046491 Bacteria 1329
247 Ga0495608_0130518 3300046511 Bacteria 1608
248 Ga0495630_0040309 3300046517 Bacteria 3490
249 Ga0495666_0032919 3300046526 Unclassified 2535
250 Ga0495642_0054860 3300046528 Bacteria 1644
251 Ga0495665_0003184 3300046531 Bacteria 8890
252 Ga0495640_0035774 3300046533 Bacteria 3513
253 Ga0495667_0025242 3300046559 Bacteria 4005
254 Ga0495667_0038818 3300046559 Bacteria 3170
255 Ga0495656_0136083 3300046615 Bacteria 1174
256 Ga0495634_0065312 3300046642 Bacteria 2412
257 Ga0495635_0153125 3300046663 Bacteria 1570
258 Ga0495588_0031898 3300046674 Bacteria 2654
259 Ga0495647_0012781 3300046681 Bacteria 2896
260 Ga0495658_0001410 3300046683 Bacteria 12622
261 Ga0495613_0003414 3300046689 Bacteria 11871
262 Ga0495624_0044117 3300046690 Bacteria 2843
263 Ga0495589_0037507 3300046794 Unclassified 2429
264 Ga0495600_0051688 3300046809 Bacteria 2682
265 Ga0495581_0002504 3300047315 Bacteria 10424
266 Ga0495581_0010100 3300047315 Bacteria 5462
267 Ga0495674_0002089 3300047319 Bacteria 19621
268 Ga0495674_0261635 3300047319 Bacteria 1421
269 Ga0495676_0000951 3300047321 Bacteria 24308
270 Ga0495676_0150597 3300047321 Unclassified 1656
271 Ga0495684_0027244 3300047471 Bacteria 4388
272 Ga0495593_0012137 3300047673 Bacteria 4929
273 Ga0496100_0008034 3300048903 Bacteria 5863
274 Ga0496100_0009189 3300048903 Bacteria 5546
275 Ga0496100_0041440 3300048903 Unclassified 2935
276 Ga0496100_0082148 3300048903 Bacteria 2178
277 Ga0496101_0002731 3300048904 Bacteria 10832
278 Ga0496101_0026322 3300048904 Bacteria 4044
279 Ga0496101_0034076 3300048904 Unclassified 3595
280 Ga0496101_0054996 3300048904 Bacteria 2873
281 Ga0496101_0134053 3300048904 Bacteria 1883
282 Ga0496101_0260247 3300048904 Bacteria 1353
283 Ga0496102_0067238 3300048905 Unclassified 3286
284 Ga0496102_0069230 3300048905 Bacteria 3239
285 Ga0496102_0094478 3300048905 Bacteria 2770
286 Ga0496102_0121530 3300048905 Bacteria 2439
287 Ga0496102_0157302 3300048905 Bacteria 2136
288 Ga0496104_0018371 3300048907 Bacteria 6380
289 Ga0496104_0019846 3300048907 Bacteria 6156
290 Ga0496104_0055421 3300048907 Unclassified 3749
291 Ga0496104_0180613 3300048907 Bacteria 2021
292 Ga0496105_0011295 3300048908 Bacteria 7050
293 Ga0496106_0005774 3300048909 Bacteria 9150
294 Ga0496106_0009632 3300048909 Bacteria 7134
295 Ga0496106_0094492 3300048909 Bacteria 2311
296 Ga0496106_0111934 3300048909 Unclassified 2126
297 Ga0496106_0150533 3300048909 Bacteria 1835
298 Ga0496107_0005567 3300048910 Bacteria 8626
299 Ga0496107_0007519 3300048910 Bacteria 7517
300 Ga0496107_0047148 3300048910 Bacteria 3103
301 Ga0496107_0058689 3300048910 Unclassified 2783
302 Ga0496107_0067471 3300048910 Bacteria 2595
303 Ga0496108_0001860 3300048911 Bacteria 16877
304 Ga0496108_0028865 3300048911 Bacteria 4591
305 Ga0496108_0251015 3300048911 Bacteria 1539
306 Ga0496109_0000482 3300048912 Bacteria 33977
307 Ga0496109_0003222 3300048912 Bacteria 13592
308 Ga0496109_0023102 3300048912 Bacteria 5516
309 Ga0496109_0027976 3300048912 Bacteria 5040
310 Ga0496109_0119853 3300048912 Bacteria 2450
311 Ga0496109_0149916 3300048912 Bacteria 2183
312 Ga0496110_0009157 3300048913 Bacteria 7996
313 Ga0496110_0009710 3300048913 Bacteria 7794
314 Ga0496110_0010174 3300048913 Bacteria 7641
315 Ga0496110_0085452 3300048913 Bacteria 2816
316 Ga0496110_0122540 3300048913 Bacteria 2343
317 Ga0496111_0001335 3300048914 Bacteria 13905
318 Ga0496111_0019450 3300048914 Bacteria 4717
319 Ga0496111_0028165 3300048914 Bacteria 3980
320 Ga0496111_0195540 3300048914 Bacteria 1503
321 Ga0496112_0007729 3300048915 Bacteria 9565
322 Ga0496112_0023074 3300048915 Bacteria 5939
323 Ga0496112_0025359 3300048915 Bacteria 5693
324 Ga0496112_0131452 3300048915 Unclassified 2474
325 Ga0496112_0191892 3300048915 Bacteria 2004
326 Ga0496114_0004670 3300048917 Bacteria 10647
327 Ga0496114_0010712 3300048917 Bacteria 7297
328 Ga0496114_0032594 3300048917 Bacteria 4289
329 Ga0496115_0004556 3300048918 Bacteria 10030
330 Ga0496115_0007390 3300048918 Bacteria 8083
331 Ga0496115_0025041 3300048918 Bacteria 4642
332 Ga0496115_0046300 3300048918 Bacteria 3475
333 Ga0501067_0002140 3300049583 Bacteria 10873
334 Ga0501069_0024801 3300049585 Bacteria 3274
335 Ga0501070_0000124 3300049586 Bacteria 68928
336 Ga0501070_0069389 3300049586 Bacteria 2918
337 Ga0501070_0090185 3300049586 Bacteria 2537
338 Ga0501079_0155155 3300049741 Unclassified 1785
339 Ga0501080_0300584 3300049742 Bacteria 1456
340 nmdc:mga05p37_16229_c1 3300050507 Bacteria 8966
341 nmdc:mga05p37_190836_c1 3300050507 Unclassified 2488
342 nmdc:mga05p37_208858_c1 3300050507 Bacteria 2361
343 nmdc:mga05p37_75534_c1 3300050507 Bacteria 4148
344 nmdc:mga09592_490_c1 3300050508 Bacteria 29665
345 nmdc:mga0qj67_19965_c1 3300050509 Bacteria 5128
346 nmdc:mga06r32_42551_c1 3300050510 Bacteria 4319
347 nmdc:mga0n895_62197_c1 3300050512 Bacteria 3689
348 nmdc:mga08x19_12682_c1 3300050514 Bacteria 5081
349 nmdc:mga08x19_22667_c1 3300050514 Bacteria 3889
350 nmdc:mga08x19_73836_c1 3300050514 Bacteria 2228
351 Ga0495619_0005041 3300053085 Bacteria 8388
352 Ga0495619_0027433 3300053085 Bacteria 3667
353 Ga0466962_0000960 3300061719 Bacteria 13098
354 Ga0530510_0041400 3300061734 Bacteria 3326
355 Ga0068856_100086271
356 Ga0070683_100024169
357 Ga0070683_100076076
358 Ga0070683_100108198
359 Ga0070666_10083292
360 Ga0070682_100095851
361 Ga0068868_100016188
362 Ga0070660_100000839
363 Ga0070660_100076121
364 Ga0070689_100042046
365 Ga0070692_10044228
366 Ga0070669_100064878
367 Ga0070675_100146976
368 Ga0070671_100153629
369 Ga0070674_100009904
370 Ga0070674_100113924
371 Ga0070688_100006249
372 Ga0070703_10012016
373 Ga0070709_10103904
374 Ga0070713_100062872
375 Ga0070710_10007802
376 Ga0070710_10070313
377 Ga0070711_100094382
378 Ga0070711_100145632
379 Ga0070705_100014082
380 Ga0070705_100055991
381 Ga0070700_100101822
382 Ga0070708_100066161
383 Ga0070678_100005721
384 Ga0070678_100143999
385 Ga0070681_10001932
386 Ga0070681_10277048
387 Ga0068867_100008232
388 Ga0070685_10049958
389 Ga0070706_100009992
390 Ga0070706_100051592
391 Ga0070706_100142403
392 Ga0070706_100162175
393 Ga0070707_100017184
394 Ga0070707_100029888
395 Ga0070707_100034168
396 Ga0070698_100034694
397 Ga0070698_100095068
398 Ga0070699_100064047
399 Ga0070679_100031905
400 Ga0070679_100354360
401 Ga0070684_100000993
402 Ga0068853_100171383
403 Ga0070686_100002823
404 Ga0070686_100009701
405 Ga0070693_100138173
406 Ga0070704_100158724
407 Ga0068855_100061817
408 Ga0070664_100108429
409 Ga0068857_100000778
410 Ga0070702_100007029
411 Ga0070702_100007665
412 Ga0070702_100140415
413 Ga0068852_100020952
414 Ga0068859_100086560
415 Ga0068859_100200715
416 Ga0068864_100120337
417 Ga0068866_10029762
418 Ga0068866_10052463
419 Ga0068861_100057396
420 Ga0068858_100018296
421 Ga0068860_100003145
422 Ga0081455_10057466
423 Ga0081540_1004742
424 Ga0070717_10019715
425 Ga0075432_10024511
426 Ga0070712_100024494
427 Ga0097621_100032308
428 Ga0068871_100008935
429 Ga0075428_100012023
430 Ga0075430_100015798
431 Ga0075430_100056276
432 Ga0075431_100250999
433 Ga0075433_10021316
434 Ga0075434_100108487
435 Ga0075434_100112063
436 Ga0075429_100001156
437 Ga0068865_100032580
438 Ga0068865_100084567
439 Ga0075436_100011378
440 Ga0075436_100054595
441 Ga0097620_100086561
442 Ga0097620_100200709
443 Ga0075435_100021549
444 Ga0075435_100120554
445 Ga0105250_10053943
446 Ga0105240_10089813
447 Ga0111539_10090825
448 Ga0111539_10294928
449 Ga0105247_10033960
450 Ga0114129_10001101
451 Ga0114129_10043477
452 Ga0114129_10082242
453 Ga0114129_10120789
454 Ga0105243_10001387
455 Ga0105243_10034145
456 Ga0105241_10004998
457 Ga0105242_10206057
458 Ga0105248_10036710
459 Ga0105248_10062008
460 Ga0105248_10108823
461 Ga0105238_10068922
462 Ga0157370_10001997
463 Ga0157374_10002319
464 Ga0157374_10214474
465 Ga0157374_10252864
466 Ga0157378_10005390
467 Ga0157378_10037688
468 Ga0163162_10018315
469 Ga0163162_10244233
470 Ga0157375_10004196
471 Ga0157375_10014238
472 Ga0157375_10079995
473 Ga0157377_10003943
474 Ga0157377_10049524
475 Ga0157379_10001684
476 Ga0157376_10004518
477 Ga0207653_10058887
478 Ga0207692_10022146
479 Ga0207642_10045102
480 Ga0207688_10010946
481 Ga0207688_10103245
482 Ga0207684_10151926
483 Ga0207707_10037205
484 Ga0207707_10150501
485 Ga0207693_10005828
486 Ga0207693_10159885
487 Ga0207663_10069505
488 Ga0207657_10000954
489 Ga0207657_10016024
490 Ga0207646_10004037
491 Ga0207646_10111915
492 Ga0207694_10098036
493 Ga0207700_10056243
494 Ga0207664_10180978
495 Ga0207686_10030671
496 Ga0207686_10049991
497 Ga0207709_10004908
498 Ga0207709_10006010
499 Ga0207670_10032184
500 Ga0207669_10069950
501 Ga0207704_10033802
502 Ga0207665_10023271
503 Ga0207711_10079152
504 Ga0207661_10024451
505 Ga0207661_10180277
506 Ga0207679_10152895
507 Ga0207667_10050691
508 Ga0207667_10269837
509 Ga0207640_10043269
510 Ga0207677_10108439
511 Ga0207677_10162414
512 Ga0207703_10108137
513 Ga0207639_10125177
514 Ga0207708_10006475
515 Ga0207702_10098592
516 Ga0207641_10395645
517 Ga0207648_10001368
518 Ga0207648_10066570
519 Ga0207676_10243421
520 Ga0207674_10000430
521 Ga0207675_100005508
522 Ga0207683_10000068
523 Ga0207683_10024247
524 Ga0207683_10049725
525 Ga0207698_10112707
526 Ga0268264_10049304
527 Ga0265319_1020702
528 Ga0265340_10017513
529 Ga0265327_10074465
530 Ga0265313_10069565
531 Ga0307406_10073401
532 Ga0307409_100126499
533 Ga0373940_0016636
534 Ga0373951_0003328
535 Ga0373945_0007179
536 Ga0373943_0003226
537 Ga0373947_0007484
538 Ga0373947_0036128
539 Ga0373925_0003734
540 Ga0395899_0016787
541 Ga0395899_0021605
542 Ga0395899_0091721
543 Ga0395900_0007128
544 Ga0395900_0009988
545 Ga0395900_0010574
546 Ga0395900_0033683
547 Ga0395900_0063295
548 Ga0395900_0078379
549 Ga0395900_0110897
550 Ga0395898_0003530
551 Ga0395898_0014746
552 Ga0395898_0017243
553 Ga0395898_0018854
554 Ga0395898_0026619
555 Ga0395898_0031592
556 Ga0395898_0055157
557 Ga0395898_0070640
558 Ga0395898_0076767
559 Ga0395898_0096241
560 Ga0395898_0111084
561 Ga0395898_0146339
562 Ga0395905_0002703
563 Ga0395905_0054618
564 Ga0395905_0068294
565 Ga0395905_0093097
566 Ga0395905_0106776
567 Ga0395905_0256606
568 Ga0395901_0003380
569 Ga0395901_0005697
570 Ga0395901_0010494
571 Ga0395901_0030653
572 Ga0395901_0030831
573 Ga0395901_0044920
574 Ga0395901_0066859
575 Ga0395901_0169226
576 Ga0395901_0436109
577 Ga0466961_0159195
578 Ga0466963_0001075
579 Ga0466963_0020578
580 Ga0466963_0165663
581 Ga0466971_0000066
582 Ga0466957_0000016
583 Ga0466957_0135731
584 Ga0466959_0037601
585 Ga0466958_0000822
586 Ga0466958_0106736
587 Ga0466967_0045826
588 Ga0466967_0070238
589 Ga0466967_0113955
590 Ga0466967_0130436
591 Ga0466967_0155412
592 Ga0495629_0019264
593 Ga0495641_0002293
594 Ga0495653_0040139
595 Ga0495582_0000466
596 Ga0495639_0046144
597 Ga0495662_0005245
598 Ga0495584_0065756
599 Ga0495584_0114824
600 Ga0495584_0120467
601 Ga0495608_0130518
602 Ga0495630_0040309
603 Ga0495666_0032919
604 Ga0495642_0054860
605 Ga0495665_0003184
606 Ga0495640_0035774
607 Ga0495667_0025242
608 Ga0495667_0038818
609 Ga0495656_0136083
610 Ga0495634_0065312
611 Ga0495635_0153125
612 Ga0495588_0031898
613 Ga0495647_0012781
614 Ga0495658_0001410
615 Ga0495613_0003414
616 Ga0495624_0044117
617 Ga0495589_0037507
618 Ga0495600_0051688
619 Ga0495581_0002504
620 Ga0495581_0010100
621 Ga0495674_0002089
622 Ga0495674_0261635
623 Ga0495676_0000951
624 Ga0495676_0150597
625 Ga0495684_0027244
626 Ga0495593_0012137
627 Ga0496100_0008034
628 Ga0496100_0009189
629 Ga0496100_0041440
630 Ga0496100_0082148
631 Ga0496101_0002731
632 Ga0496101_0026322
633 Ga0496101_0034076
634 Ga0496101_0054996
635 Ga0496101_0134053
636 Ga0496101_0260247
637 Ga0496102_0067238
638 Ga0496102_0069230
639 Ga0496102_0094478
640 Ga0496102_0121530
641 Ga0496102_0157302
642 Ga0496104_0018371
643 Ga0496104_0019846
644 Ga0496104_0055421
645 Ga0496104_0180613
646 Ga0496105_0011295
647 Ga0496106_0005774
648 Ga0496106_0009632
649 Ga0496106_0094492
650 Ga0496106_0111934
651 Ga0496106_0150533
652 Ga0496107_0005567
653 Ga0496107_0007519
654 Ga0496107_0047148
655 Ga0496107_0058689
656 Ga0496107_0067471
657 Ga0496108_0001860
658 Ga0496108_0028865
659 Ga0496108_0251015
660 Ga0496109_0000482
661 Ga0496109_0003222
662 Ga0496109_0023102
663 Ga0496109_0027976
664 Ga0496109_0119853
665 Ga0496109_0149916
666 Ga0496110_0009157
667 Ga0496110_0009710
668 Ga0496110_0010174
669 Ga0496110_0085452
670 Ga0496110_0122540
671 Ga0496111_0001335
672 Ga0496111_0019450
673 Ga0496111_0028165
674 Ga0496111_0195540
675 Ga0496112_0007729
676 Ga0496112_0023074
677 Ga0496112_0025359
678 Ga0496112_0131452
679 Ga0496112_0191892
680 Ga0496114_0004670
681 Ga0496114_0010712
682 Ga0496114_0032594
683 Ga0496115_0004556
684 Ga0496115_0007390
685 Ga0496115_0025041
686 Ga0496115_0046300
687 Ga0501067_0002140
688 Ga0501069_0024801
689 Ga0501070_0000124
690 Ga0501070_0069389
691 Ga0501070_0090185
692 Ga0501079_0155155
693 Ga0501080_0300584
694 nmdc:mga05p37_16229_c1
695 nmdc:mga05p37_190836_c1
696 nmdc:mga05p37_208858_c1
697 nmdc:mga05p37_75534_c1
698 nmdc:mga09592_490_c1
699 nmdc:mga0qj67_19965_c1
700 nmdc:mga06r32_42551_c1
701 nmdc:mga0n895_62197_c1
702 nmdc:mga08x19_12682_c1
703 nmdc:mga08x19_22667_c1
704 nmdc:mga08x19_73836_c1
705 Ga0495619_0005041
706 Ga0495619_0027433
707 Ga0466962_0000960
708 Ga0530510_0041400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

16

230

0.84

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

17

225

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ejj-assembly1.cif.gz_A structure of a glycosyltransferase / state 2 0.7805 2 410
5d01-assembly1.cif.gz_A crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate 0.7666 2 408
6ejj-assembly1.cif.gz_A structure of a glycosyltransferase / state 2 0.7611 2 410
2gek-assembly1.cif.gz_A crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp 0.7578 2 410
5d00-assembly1.cif.gz_A crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump 0.7569 2 410
ID Description Score Start End Superfamily
af_Q2G1J7_226_391_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7971 231 378 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7929 224 393 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7886 224 393 3.40.50.2000
af_Q9VZU8_216_412_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.788 225 408 3.40.50.2000
af_P32057_215_394_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7695 225 404 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A537ZN61-F1-model_v4 Glycosyltransferase family 4 protein 0.9621 165 410 GO:0016740
AF-A0A537ZN61-F1-model_v4 Glycosyltransferase family 4 protein 0.9398 165 410 GO:0016740
AF-A0A538I0S7-F1-model_v4 Glycosyltransferase family 4 protein 0.9226 3 408 GO:0016758
AF-A0A538I0S7-F1-model_v4 Glycosyltransferase family 4 protein 0.9118 3 408 GO:0016758
AF-A0A538MMD3-F1-model_v4 Glycosyltransferase family 4 protein 0.9097 3 408 GO:0016757

Map