F419679

General Info

Members Datasets Scaffolds Average Seq Length
354 181 354 144

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100283000|Ga0070695_1002830001
Length 158
Sequence MCFAGSEADHHIDLKLKMITIESHDLAEMRRHGERDYPFECCGLMLGQFESSGHKTVVETYPISNAREEEAKRNRFLIRPEELMRGEKHAREKGLDVVGFYHSHPDEPAIPSKYDLDHAWPTYSYIVVSVEKGQAVDLRSWEMEPDRSRFSEEEIKAS

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0
Rhizoplane 1.41
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2289966 2162886006 Unclassified 863
2 MBSR1b_contig_1150861 2162886012 Bacteria 1014
3 JGI24030J14995_100111 3300001426 Bacteria 1984
4 JGI24034J14986_100075 3300001432 Bacteria 4166
5 JGI24748J21848_1000073 3300002074 Bacteria 34628
6 JGI24034J26672_10000013 3300002239 Bacteria 144025
7 JGI24742J22300_10016766 3300002244 Bacteria 1237
8 Ga0065715_10007572 3300005293 Bacteria 4472
9 Ga0065707_10083680 3300005295 Bacteria 8481
10 Ga0065707_10157664 3300005295 Bacteria 1593
11 Ga0070690_100009279 3300005330 Bacteria 5695
12 Ga0070690_100101979 3300005330 Bacteria 1904
13 Ga0070677_10322305 3300005333 Unclassified 792
14 Ga0068869_100237409 3300005334 Bacteria 1451
15 Ga0070682_100000104 3300005337 Bacteria 76111
16 Ga0070682_101873019 3300005337 Unclassified 525
17 Ga0068868_100078331 3300005338 Bacteria 2646
18 Ga0068868_100088100 3300005338 Bacteria 2498
19 Ga0068868_100365316 3300005338 Bacteria 1239
20 Ga0068868_100922843 3300005338 Bacteria 795
21 Ga0070689_101152093 3300005340 Bacteria 695
22 Ga0070687_100011785 3300005343 Bacteria 3837
23 Ga0070687_100042023 3300005343 Bacteria 2314
24 Ga0070687_100043028 3300005343 Bacteria 2292
25 Ga0070687_100194761 3300005343 Unclassified 1224
26 Ga0070669_100667977 3300005353 Unclassified 875
27 Ga0070675_101215056 3300005354 Unclassified 694
28 Ga0070671_100120423 3300005355 Unclassified 2208
29 Ga0070674_100276612 3300005356 Bacteria 1329
30 Ga0070674_100742154 3300005356 Bacteria 843
31 Ga0070674_101729684 3300005356 Bacteria 566
32 Ga0070673_100118027 3300005364 Bacteria 2209
33 Ga0070673_101294209 3300005364 Bacteria 684
34 Ga0070688_100866565 3300005365 Bacteria 710
35 Ga0070659_100888659 3300005366 Unclassified 778
36 Ga0070703_10000054 3300005406 Bacteria 56789
37 Ga0070705_100065241 3300005440 Bacteria 2179
38 Ga0070705_100225482 3300005440 Bacteria 1300
39 Ga0070705_100253917 3300005440 Bacteria 1236
40 Ga0070700_100012464 3300005441 Bacteria 4748
41 Ga0070700_100519444 3300005441 Unclassified 919
42 Ga0070694_100002672 3300005444 Bacteria 10561
43 Ga0070694_100077741 3300005444 Bacteria 2300
44 Ga0070694_100352331 3300005444 Unclassified 1141
45 Ga0070694_101164833 3300005444 Unclassified 645
46 Ga0070708_100747969 3300005445 Bacteria 919
47 Ga0070708_101839732 3300005445 Bacteria 562
48 Ga0070662_100133343 3300005457 Bacteria 1918
49 Ga0068867_100057105 3300005459 Bacteria 2890
50 Ga0068867_101696788 3300005459 Bacteria 592
51 Ga0070706_100076859 3300005467 Unclassified 3090
52 Ga0070706_100085015 3300005467 Bacteria 2931
53 Ga0070706_100147510 3300005467 Bacteria 2197
54 Ga0070706_100229513 3300005467 Unclassified 1733
55 Ga0070706_100493045 3300005467 Bacteria 1140
56 Ga0070706_100777351 3300005467 Bacteria 887
57 Ga0070707_100047535 3300005468 Bacteria 4108
58 Ga0070707_100074429 3300005468 Bacteria 3275
59 Ga0070707_100323661 3300005468 Bacteria 1498
60 Ga0070707_100450371 3300005468 Bacteria 1248
61 Ga0070707_100545429 3300005468 Bacteria 1122
62 Ga0070698_100020395 3300005471 Bacteria 6947
63 Ga0070698_100271742 3300005471 Bacteria 1627
64 Ga0070698_100631535 3300005471 Bacteria 1012
65 Ga0070699_100145770 3300005518 Bacteria 2092
66 Ga0070699_100559224 3300005518 Bacteria 1042
67 Ga0070697_100000494 3300005536 Bacteria 29943
68 Ga0070697_100020207 3300005536 Bacteria 5266
69 Ga0070697_100061238 3300005536 Bacteria 3070
70 Ga0070697_100134931 3300005536 Bacteria 2072
71 Ga0070697_100157947 3300005536 Bacteria 1915
72 Ga0070697_100169908 3300005536 Bacteria 1845
73 Ga0070697_100397058 3300005536 Unclassified 1196
74 Ga0070672_100169676 3300005543 Bacteria 1814
75 Ga0070672_100661597 3300005543 Bacteria 913
76 Ga0070686_100040048 3300005544 Bacteria 2922
77 Ga0070686_100126385 3300005544 Bacteria 1762
78 Ga0070686_100136129 3300005544 Unclassified 1705
79 Ga0070695_100045845 3300005545 Bacteria 2788
80 Ga0070695_100283000 3300005545 Bacteria 1219
81 Ga0070695_101294031 3300005545 Bacteria 602
82 Ga0070696_100104292 3300005546 Bacteria 2036
83 Ga0070696_100348750 3300005546 Unclassified 1146
84 Ga0070696_100389956 3300005546 Bacteria 1087
85 Ga0070696_100630387 3300005546 Viruses 867
86 Ga0070693_100137962 3300005547 Unclassified 1532
87 Ga0070704_100017637 3300005549 Bacteria 4545
88 Ga0070704_100051651 3300005549 Bacteria 2896
89 Ga0070704_100606464 3300005549 Bacteria 963
90 Ga0070702_100321805 3300005615 Bacteria 1078
91 Ga0068859_100289333 3300005617 Bacteria 1731
92 Ga0068859_100768924 3300005617 Unclassified 1052
93 Ga0068864_100065689 3300005618 Bacteria 3147
94 Ga0068866_10016916 3300005718 Bacteria 3270
95 Ga0068861_100069198 3300005719 Bacteria 2730
96 Ga0068861_100332181 3300005719 Bacteria 1327
97 Ga0068863_100687175 3300005841 Bacteria 1017
98 Ga0068863_100952154 3300005841 Unclassified 860
99 Ga0068858_100000214 3300005842 Bacteria 62487
100 Ga0068858_100283181 3300005842 Bacteria 1579
101 Ga0068860_100342974 3300005843 Bacteria 1469
102 Ga0068860_100478540 3300005843 Bacteria 1241
103 Ga0068862_100052073 3300005844 Bacteria 3501
104 Ga0081539_10240684 3300005985 Bacteria 810
105 Ga0081539_10366439 3300005985 Unclassified 603
106 Ga0075368_10111752 3300006042 Bacteria 1127
107 Ga0070716_100038626 3300006173 Bacteria 2644
108 Ga0070716_100078139 3300006173 Bacteria 1966
109 Ga0070716_100777026 3300006173 Unclassified 739
110 Ga0070716_100961679 3300006173 Unclassified 673
111 Ga0075367_10016043 3300006178 Bacteria 4084
112 Ga0075370_10157514 3300006353 Bacteria 1332
113 Ga0068871_100215180 3300006358 Unclassified 1663
114 Ga0075428_100004686 3300006844 Bacteria 15136
115 Ga0075428_100060381 3300006844 Unclassified 4151
116 Ga0075428_100190749 3300006844 Bacteria 2216
117 Ga0075428_101144648 3300006844 Bacteria 821
118 Ga0075430_100003376 3300006846 Bacteria 13357
119 Ga0075430_100011611 3300006846 Bacteria 7490
120 Ga0075430_100240254 3300006846 Bacteria 1501
121 Ga0075430_100635345 3300006846 Unclassified 880
122 Ga0075431_100008658 3300006847 Bacteria 10195
123 Ga0075431_100031823 3300006847 Bacteria 5434
124 Ga0075431_100066760 3300006847 Bacteria 3714
125 Ga0075431_100964517 3300006847 Bacteria 820
126 Ga0075433_10101329 3300006852 Bacteria 2550
127 Ga0075433_10208491 3300006852 Bacteria 1737
128 Ga0075433_10799953 3300006852 Unclassified 824
129 Ga0075434_100018074 3300006871 Bacteria 6802
130 Ga0075434_100515126 3300006871 Bacteria 1217
131 Ga0075429_100025619 3300006880 Bacteria 5120
132 Ga0075429_100171220 3300006880 Bacteria 1902
133 Ga0075429_100185314 3300006880 Unclassified 1824
134 Ga0068865_101400994 3300006881 Unclassified 624
135 Ga0075436_100000015 3300006914 Bacteria 174598
136 Ga0097620_100289311 3300006931 Bacteria 1731
137 Ga0097620_100768908 3300006931 Unclassified 1052
138 Ga0075435_100000419 3300007076 Bacteria 26191
139 Ga0075435_100822404 3300007076 Bacteria 809
140 Ga0111539_11956019 3300009094 Unclassified 680
141 Ga0105245_10158497 3300009098 Bacteria 2146
142 Ga0105247_10000015 3300009101 Bacteria 277224
143 Ga0105247_10242749 3300009101 Bacteria 1228
144 Ga0114129_10018252 3300009147 Bacteria 9990
145 Ga0114129_10026489 3300009147 Bacteria 8210
146 Ga0114129_10055147 3300009147 Bacteria 5571
147 Ga0114129_10129054 3300009147 Bacteria 3474
148 Ga0114129_10371255 3300009147 Unclassified 1891
149 Ga0114129_10717142 3300009147 Bacteria 1284
150 Ga0114129_11239802 3300009147 Bacteria 927
151 Ga0105243_10001006 3300009148 Bacteria 26046
152 Ga0105243_10026735 3300009148 Bacteria 4419
153 Ga0105243_11297440 3300009148 Bacteria 745
154 Ga0105243_11449295 3300009148 Bacteria 709
155 Ga0105242_10000163 3300009176 Bacteria 49988
156 Ga0105242_10000820 3300009176 Bacteria 24153
157 Ga0105242_10950030 3300009176 Bacteria 864
158 Ga0105242_12757775 3300009176 Unclassified 541
159 Ga0105248_10216774 3300009177 Bacteria 2156
160 Ga0105248_10456508 3300009177 Bacteria 1440
161 Ga0105248_10697177 3300009177 Unclassified 1146
162 Ga0105248_11566112 3300009177 Unclassified 746
163 Ga0105248_12621047 3300009177 Unclassified 575
164 Ga0105249_10164458 3300009553 Bacteria 2147
165 Ga0105249_13201849 3300009553 Unclassified 526
166 Ga0105239_10615609 3300010375 Bacteria 1239
167 Ga0105239_12684421 3300010375 Bacteria 581
168 Ga0105246_10889134 3300011119 Unclassified 798
169 Ga0157378_10027231 3300013297 Bacteria 5045
170 Ga0157378_10048185 3300013297 Bacteria 3788
171 Ga0157378_10232244 3300013297 Unclassified 1758
172 Ga0157378_10577939 3300013297 Unclassified 1132
173 Ga0157378_10580532 3300013297 Bacteria 1130
174 Ga0157378_10587477 3300013297 Bacteria 1123
175 Ga0157378_11140160 3300013297 Bacteria 818
176 Ga0163162_10097186 3300013306 Unclassified 3033
177 Ga0163162_10167008 3300013306 Bacteria 2324
178 Ga0163162_10260696 3300013306 Bacteria 1865
179 Ga0163162_10306149 3300013306 Unclassified 1721
180 Ga0157375_10233032 3300013308 Bacteria 2000
181 Ga0157380_10106787 3300014326 Bacteria 2343
182 Ga0157380_10327651 3300014326 Bacteria 1423
183 Ga0157380_10455881 3300014326 Bacteria 1229
184 Ga0157380_10843521 3300014326 Unclassified 937
185 Ga0157380_12753862 3300014326 Unclassified 558
186 Ga0157379_10107511 3300014968 Unclassified 2504
187 Ga0163161_10027896 3300017792 Bacteria 4006
188 Ga0163161_10229736 3300017792 Bacteria 1439
189 Ga0163161_10427013 3300017792 Unclassified 1067
190 Ga0213875_10383712 3300021388 Unclassified 669
191 Ga0207672_1000053 3300025223 Bacteria 15134
192 Ga0207697_10150231 3300025315 Unclassified 1013
193 Ga0207653_10000026 3300025885 Bacteria 114420
194 Ga0207710_10000004 3300025900 Bacteria 846540
195 Ga0207710_10646606 3300025900 Bacteria 554
196 Ga0207688_10555080 3300025901 Unclassified 722
197 Ga0207688_10652492 3300025901 Viruses 664
198 Ga0207647_10481246 3300025904 Unclassified 693
199 Ga0207645_10144497 3300025907 Bacteria 1551
200 Ga0207643_11076307 3300025908 Unclassified 519
201 Ga0207684_10064672 3300025910 Bacteria 3105
202 Ga0207684_10102630 3300025910 Bacteria 2445
203 Ga0207684_10248533 3300025910 Bacteria 1535
204 Ga0207684_10289432 3300025910 Bacteria 1413
205 Ga0207684_10597806 3300025910 Bacteria 942
206 Ga0207662_10019786 3300025918 Bacteria 3836
207 Ga0207662_10031911 3300025918 Bacteria 3063
208 Ga0207662_10163592 3300025918 Bacteria 1423
209 Ga0207662_10197959 3300025918 Bacteria 1299
210 Ga0207646_10035815 3300025922 Bacteria 4481
211 Ga0207646_10036553 3300025922 Bacteria 4432
212 Ga0207646_10043858 3300025922 Bacteria 4014
213 Ga0207646_10490455 3300025922 Unclassified 1107
214 Ga0207646_10873269 3300025922 Unclassified 799
215 Ga0207681_10974644 3300025923 Unclassified 711
216 Ga0207659_10724450 3300025926 Bacteria 852
217 Ga0207659_10799153 3300025926 Unclassified 810
218 Ga0207644_10000159 3300025931 Bacteria 49009
219 Ga0207686_10000064 3300025934 Bacteria 95481
220 Ga0207686_10000098 3300025934 Bacteria 71662
221 Ga0207686_10787003 3300025934 Unclassified 762
222 Ga0207709_10000150 3300025935 Bacteria 95086
223 Ga0207709_10419357 3300025935 Bacteria 1028
224 Ga0207670_10192370 3300025936 Bacteria 1544
225 Ga0207669_10163319 3300025937 Bacteria 1576
226 Ga0207665_10106490 3300025939 Bacteria 1965
227 Ga0207665_10201338 3300025939 Bacteria 1451
228 Ga0207691_10597318 3300025940 Bacteria 934
229 Ga0207691_10682297 3300025940 Unclassified 867
230 Ga0207711_10229978 3300025941 Bacteria 1698
231 Ga0207689_10012142 3300025942 Bacteria 7373
232 Ga0207689_10061784 3300025942 Bacteria 3081
233 Ga0207689_10361501 3300025942 Unclassified 1207
234 Ga0207651_10968504 3300025960 Unclassified 759
235 Ga0207651_11143209 3300025960 Bacteria 698
236 Ga0207677_10299967 3300026023 Bacteria 1327
237 Ga0207677_10710444 3300026023 Unclassified 893
238 Ga0207703_10000084 3300026035 Bacteria 109254
239 Ga0207703_10120088 3300026035 Bacteria 2255
240 Ga0207703_10428794 3300026035 Unclassified 1232
241 Ga0207708_10041788 3300026075 Bacteria 3495
242 Ga0207708_10780281 3300026075 Unclassified 822
243 Ga0207641_10900551 3300026088 Unclassified 878
244 Ga0207641_11455233 3300026088 Bacteria 686
245 Ga0207648_10055622 3300026089 Bacteria 3454
246 Ga0207675_101888849 3300026118 Bacteria 616
247 Ga0209813_10036799 3300027866 Bacteria 1472
248 Ga0207428_10007007 3300027907 Bacteria 10323
249 Ga0268265_10251913 3300028380 Bacteria 1564
250 Ga0268264_10041414 3300028381 Bacteria 3810
251 Ga0268264_10118444 3300028381 Bacteria 2330
252 Ga0307513_10679254 3300031456 Bacteria 736
253 Ga0307513_10944123 3300031456 Unclassified 571
254 Ga0307408_100880934 3300031548 Unclassified 818
255 Ga0307406_10016535 3300031901 Bacteria 4290
256 Ga0307409_100667287 3300031995 Unclassified 1035
257 Ga0307416_100055212 3300032002 Bacteria 3197
258 Ga0307416_101384163 3300032002 Unclassified 809
259 Ga0307411_10501309 3300032005 Bacteria 1026
260 Ga0373946_0777134 3300035171 Bacteria 504
261 Ga0395900_0395719 3300037418 Bacteria 1347
262 Ga0436364_0195393 3300037853 Unclassified 631
263 Ga0436364_0925515 3300037853 Bacteria 860
264 Ga0436365_0393919 3300039437 Bacteria 1643
265 Ga0439456_088202 3300042013 Bacteria 696
266 Ga0439464_0279413 3300042439 Bacteria 543
267 Ga0439460_0063643 3300042461 Bacteria 1130
268 Ga0453683_0047176 3300044673 Bacteria 2701
269 Ga0453683_0574640 3300044673 Bacteria 734
270 Ga0495618_0929506 3300046514 Bacteria 501
271 Ga0495663_0000345 3300046525 Bacteria 17258
272 Ga0495640_0074023 3300046533 Bacteria 2279
273 Ga0495598_0000892 3300046537 Bacteria 5760
274 Ga0495621_0000235 3300046539 Bacteria 13014
275 Ga0495656_0383928 3300046615 Bacteria 732
276 Ga0495613_0784134 3300046689 Bacteria 623
277 Ga0495680_0482803 3300047322 Bacteria 844
278 Ga0495684_0140923 3300047471 Bacteria 1808
279 Ga0496102_0178820 3300048905 Bacteria 1998
280 Ga0496106_0773728 3300048909 Bacteria 762
281 Ga0496108_0463164 3300048911 Bacteria 1107
282 Ga0496109_0317835 3300048912 Bacteria 1469
283 Ga0496112_0214994 3300048915 Bacteria 1879
284 Ga0501291_132751 3300049514 Unclassified 550
285 Ga0501031_0258339 3300049568 Bacteria 1132
286 Ga0501036_0185018 3300049572 Bacteria 1753
287 Ga0501037_0328638 3300049573 Bacteria 1058
288 Ga0501038_0182444 3300049574 Bacteria 1693
289 Ga0501038_0570731 3300049574 Bacteria 859
290 Ga0501039_0167023 3300049575 Bacteria 1730
291 Ga0501039_1326276 3300049575 Unclassified 555
292 Ga0501040_0322553 3300049576 Bacteria 1105
293 Ga0501040_0832060 3300049576 Viruses 668
294 Ga0501041_0085981 3300049577 Bacteria 1940
295 Ga0501041_0095198 3300049577 Bacteria 1840
296 Ga0501042_0037092 3300049578 Bacteria 3459
297 Ga0501046_0536816 3300049580 Bacteria 835
298 Ga0501048_0074418 3300049582 Bacteria 2397
299 Ga0501068_0133768 3300049584 Bacteria 1552
300 Ga0501068_0902588 3300049584 Bacteria 581
301 Ga0501071_0006058 3300049587 Bacteria 7834
302 Ga0501071_0082536 3300049587 Bacteria 2354
303 Ga0501071_0382527 3300049587 Bacteria 1073
304 Ga0501072_0054044 3300049588 Bacteria 3164
305 Ga0501072_0094756 3300049588 Bacteria 2372
306 Ga0501073_0160589 3300049589 Bacteria 1557
307 Ga0501075_0030774 3300049591 Bacteria 3978
308 Ga0501075_0096947 3300049591 Bacteria 2238
309 Ga0501076_0023259 3300049592 Bacteria 4775
310 Ga0501076_0032146 3300049592 Bacteria 4095
311 Ga0501076_0065891 3300049592 Bacteria 2890
312 Ga0501077_0191269 3300049593 Bacteria 1300
313 Ga0501077_0405385 3300049593 Unclassified 872
314 Ga0501079_0080361 3300049741 Bacteria 2521
315 Ga0501079_0122469 3300049741 Bacteria 2022
316 Ga0501079_0435587 3300049741 Bacteria 1029
317 Ga0501081_0040142 3300049743 Bacteria 3204
318 Ga0501081_0203811 3300049743 Bacteria 1435
319 Ga0501081_0250891 3300049743 Bacteria 1292
320 Ga0501045_0099845 3300049824 Bacteria 2148
321 Ga0501045_0464183 3300049824 Bacteria 941
322 nmdc:mga0k408_42021_c1 3300050493 Bacteria 2633
323 nmdc:mga06z11_98947_c1 3300050494 Bacteria 1597
324 nmdc:mga04h51_76116_c1 3300050495 Bacteria 1182
325 nmdc:mga07m45_288896_c1 3300050496 Unclassified 954
326 nmdc:mga05p37_20897_c1 3300050507 Bacteria 7923
327 nmdc:mga05p37_231337_c1 3300050507 Bacteria 2227
328 nmdc:mga05p37_6554_c1 3300050507 Bacteria 13721
329 nmdc:mga05p37_711893_c1 3300050507 Unclassified 1113
330 nmdc:mga05p37_91998_c1 3300050507 Bacteria 3737
331 nmdc:mga09592_341592_c1 3300050508 Bacteria 1296
332 nmdc:mga09592_38959_c1 3300050508 Bacteria 3991
333 nmdc:mga09592_61141_c1 3300050508 Bacteria 3185
334 nmdc:mga0qj67_16329_c1 3300050509 Bacteria 5629
335 nmdc:mga0qj67_176129_c1 3300050509 Bacteria 1737
336 nmdc:mga0qj67_265994_c1 3300050509 Unclassified 1391
337 nmdc:mga06r32_1018867_c1 3300050510 Bacteria 780
338 nmdc:mga06r32_14910_c1 3300050510 Bacteria 7054
339 nmdc:mga06r32_646599_c1 3300050510 Unclassified 1026
340 nmdc:mga06r32_69218_c1 3300050510 Bacteria 3410
341 nmdc:mga08y16_1551525_c1 3300050511 Unclassified 621
342 nmdc:mga08y16_410156_c1 3300050511 Bacteria 1386
343 nmdc:mga0n895_19484_c1 3300050512 Bacteria 6307
344 nmdc:mga0rr50_207740_c1 3300050513 Bacteria 1612
345 nmdc:mga0rr50_397_c1 3300050513 Bacteria 23630
346 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
347 nmdc:mga0a205_105883_c1 3300050515 Bacteria 2711
348 Ga0501084_0037513 3300054114 Bacteria 4049
349 Ga0501084_0245159 3300054114 Bacteria 1512
350 Ga0501084_0659020 3300054114 Unclassified 884
351 Ga0501082_0059523 3300060353 Bacteria 3292
352 Ga0501082_0268672 3300060353 Bacteria 1484
353 Ga0530510_0285348 3300061734 Bacteria 1234
354 Ga0530510_0364006 3300061734 Bacteria 1087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886012 MBSR1b_contig_1150861 MBSR1b_0772.00006820 127
2 3300005293 Ga0065715_10007572 Ga0065715_100075723 127
3 3300005330 Ga0070690_100101979 Ga0070690_1001019791 127
4 3300005338 Ga0068868_100088100 Ga0068868_1000881002 127
5 3300005343 Ga0070687_100011785 Ga0070687_1000117852 127
6 3300005356 Ga0070674_100742154 Ga0070674_1007421542 127
7 3300005364 Ga0070673_101294209 Ga0070673_1012942091 127
8 3300005457 Ga0070662_100133343 Ga0070662_1001333431 127
9 3300005459 Ga0068867_100057105 Ga0068867_1000571052 127
10 3300005543 Ga0070672_100661597 Ga0070672_1006615972 127
11 3300005544 Ga0070686_100040048 Ga0070686_1000400482 127
12 3300005549 Ga0070704_100051651 Ga0070704_1000516512 127
13 3300005615 Ga0070702_100321805 Ga0070702_1003218052 127
14 3300005719 Ga0068861_100069198 Ga0068861_1000691982 127
15 3300005843 Ga0068860_100478540 Ga0068860_1004785402 127
16 3300009148 Ga0105243_11297440 Ga0105243_112974402 127
17 3300013297 Ga0157378_10048185 Ga0157378_100481852 127
18 3300013306 Ga0163162_10167008 Ga0163162_101670082 127
19 3300017792 Ga0163161_10229736 Ga0163161_102297362 127
20 3300025901 Ga0207688_10652492 Ga0207688_106524922 127
21 3300025918 Ga0207662_10019786 Ga0207662_100197861 127
22 3300025940 Ga0207691_10597318 Ga0207691_105973182 127
23 3300025942 Ga0207689_10361501 Ga0207689_103615011 127
24 3300025960 Ga0207651_11143209 Ga0207651_111432091 127
25 3300026023 Ga0207677_10299967 Ga0207677_102999672 127
26 3300026089 Ga0207648_10055622 Ga0207648_100556222 127
27 3300006847 Ga0075431_100964517 Ga0075431_1009645171 128
28 3300050510 nmdc:mga06r32_1018867_c1 nmdc:mga06r32_1018867_c1_87_557 128
29 3300005440 Ga0070705_100065241 Ga0070705_1000652412 129
30 3300006173 Ga0070716_100038626 Ga0070716_1000386262 129
31 3300009147 Ga0114129_10129054 Ga0114129_101290541 129
32 3300009147 Ga0114129_11239802 Ga0114129_112398022 129
33 3300025939 Ga0207665_10201338 Ga0207665_102013381 129
34 3300050507 nmdc:mga05p37_231337_c1 nmdc:mga05p37_231337_c1_146_547 129
35 3300006846 Ga0075430_100240254 Ga0075430_1002402542 130
36 3300013297 Ga0157378_10577939 Ga0157378_105779392 132
37 3300042013 Ga0439456_088202 Ga0439456_088202_143_664 132
38 3300006846 Ga0075430_100635345 Ga0075430_1006353451 133
39 3300006847 Ga0075431_100066760 Ga0075431_1000667602 133
40 3300050510 nmdc:mga06r32_646599_c1 nmdc:mga06r32_646599_c1_129_602 133
41 3300006844 Ga0075428_100190749 Ga0075428_1001907492 134
42 3300006880 Ga0075429_100185314 Ga0075429_1001853142 134
43 3300009147 Ga0114129_10018252 Ga0114129_100182523 134
44 3300049575 Ga0501039_1326276 Ga0501039_1326276_96_539 134
45 3300049589 Ga0501073_0160589 Ga0501073_0160589_1032_1475 134
46 3300049592 Ga0501076_0065891 Ga0501076_0065891_1298_1741 134
47 3300049741 Ga0501079_0080361 Ga0501079_0080361_1041_1484 134
48 3300050508 nmdc:mga09592_38959_c1 nmdc:mga09592_38959_c1_335_790 134
49 3300050509 nmdc:mga0qj67_265994_c1 nmdc:mga0qj67_265994_c1_254_709 134
50 3300054114 Ga0501084_0659020 Ga0501084_0659020_234_677 134
51 3300060353 Ga0501082_0059523 Ga0501082_0059523_1873_2316 134
52 3300005333 Ga0070677_10322305 Ga0070677_103223051 135
53 3300005338 Ga0068868_100365316 Ga0068868_1003653162 135
54 3300005354 Ga0070675_101215056 Ga0070675_1012150561 135
55 3300005356 Ga0070674_100276612 Ga0070674_1002766122 135
56 3300005366 Ga0070659_100888659 Ga0070659_1008886591 135
57 3300005543 Ga0070672_100169676 Ga0070672_1001696762 135
58 3300006042 Ga0075368_10111752 Ga0075368_101117522 135
59 3300006178 Ga0075367_10016043 Ga0075367_100160433 135
60 3300006353 Ga0075370_10157514 Ga0075370_101575142 135
61 3300006844 Ga0075428_100004686 Ga0075428_10000468610 135
62 3300006844 Ga0075428_101144648 Ga0075428_1011446482 135
63 3300006846 Ga0075430_100003376 Ga0075430_1000033767 135
64 3300006846 Ga0075430_100011611 Ga0075430_1000116112 135
65 3300006847 Ga0075431_100008658 Ga0075431_1000086583 135
66 3300006847 Ga0075431_100031823 Ga0075431_1000318233 135
67 3300006852 Ga0075433_10101329 Ga0075433_101013293 135
68 3300006852 Ga0075433_10208491 Ga0075433_102084912 135
69 3300006880 Ga0075429_100171220 Ga0075429_1001712203 135
70 3300009094 Ga0111539_11956019 Ga0111539_119560192 135
71 3300009147 Ga0114129_10026489 Ga0114129_100264892 135
72 3300010375 Ga0105239_10615609 Ga0105239_106156092 135
73 3300014326 Ga0157380_10843521 Ga0157380_108435212 135
74 3300025901 Ga0207688_10555080 Ga0207688_105550802 135
75 3300025904 Ga0207647_10481246 Ga0207647_104812461 135
76 3300025926 Ga0207659_10799153 Ga0207659_107991531 135
77 3300025937 Ga0207669_10163319 Ga0207669_101633192 135
78 3300025940 Ga0207691_10682297 Ga0207691_106822972 135
79 3300027866 Ga0209813_10036799 Ga0209813_100367992 135
80 3300031901 Ga0307406_10016535 Ga0307406_100165355 135
81 3300031995 Ga0307409_100667287 Ga0307409_1006672872 135
82 3300032002 Ga0307416_100055212 Ga0307416_1000552123 135
83 3300032005 Ga0307411_10501309 Ga0307411_105013092 135
84 3300042439 Ga0439464_0279413 Ga0439464_0279413_73_522 135
85 3300042461 Ga0439460_0063643 Ga0439460_0063643_386_847 135
86 3300048905 Ga0496102_0178820 Ga0496102_0178820_414_851 135
87 3300048909 Ga0496106_0773728 Ga0496106_0773728_186_623 135
88 3300048911 Ga0496108_0463164 Ga0496108_0463164_643_1080 135
89 3300048912 Ga0496109_0317835 Ga0496109_0317835_532_969 135
90 3300048915 Ga0496112_0214994 Ga0496112_0214994_1411_1848 135
91 3300049568 Ga0501031_0258339 Ga0501031_0258339_143_589 135
92 3300049572 Ga0501036_0185018 Ga0501036_0185018_971_1417 135
93 3300049573 Ga0501037_0328638 Ga0501037_0328638_569_1015 135
94 3300049574 Ga0501038_0182444 Ga0501038_0182444_22_474 135
95 3300049574 Ga0501038_0570731 Ga0501038_0570731_10_480 135
96 3300049575 Ga0501039_0167023 Ga0501039_0167023_231_677 135
97 3300049576 Ga0501040_0322553 Ga0501040_0322553_365_811 135
98 3300049576 Ga0501040_0832060 Ga0501040_0832060_55_507 135
99 3300049577 Ga0501041_0085981 Ga0501041_0085981_453_902 135
100 3300049577 Ga0501041_0095198 Ga0501041_0095198_1050_1496 135
101 3300049578 Ga0501042_0037092 Ga0501042_0037092_88_540 135
102 3300049580 Ga0501046_0536816 Ga0501046_0536816_166_618 135
103 3300049582 Ga0501048_0074418 Ga0501048_0074418_805_1254 135
104 3300049584 Ga0501068_0133768 Ga0501068_0133768_454_906 135
105 3300049584 Ga0501068_0902588 Ga0501068_0902588_18_464 135
106 3300049587 Ga0501071_0006058 Ga0501071_0006058_2987_3439 135
107 3300049587 Ga0501071_0082536 Ga0501071_0082536_747_1196 135
108 3300049587 Ga0501071_0382527 Ga0501071_0382527_73_522 135
109 3300049588 Ga0501072_0054044 Ga0501072_0054044_1612_2064 135
110 3300049588 Ga0501072_0094756 Ga0501072_0094756_420_866 135
111 3300049591 Ga0501075_0030774 Ga0501075_0030774_328_774 135
112 3300049591 Ga0501075_0096947 Ga0501075_0096947_358_807 135
113 3300049592 Ga0501076_0023259 Ga0501076_0023259_552_998 135
114 3300049592 Ga0501076_0032146 Ga0501076_0032146_38_490 135
115 3300049593 Ga0501077_0191269 Ga0501077_0191269_823_1287 135
116 3300049593 Ga0501077_0405385 Ga0501077_0405385_222_674 135
117 3300049741 Ga0501079_0122469 Ga0501079_0122469_1060_1512 135
118 3300049741 Ga0501079_0435587 Ga0501079_0435587_296_745 135
119 3300049743 Ga0501081_0040142 Ga0501081_0040142_1251_1697 135
120 3300049743 Ga0501081_0203811 Ga0501081_0203811_506_955 135
121 3300049824 Ga0501045_0099845 Ga0501045_0099845_285_734 135
122 3300049824 Ga0501045_0464183 Ga0501045_0464183_388_834 135
123 3300050493 nmdc:mga0k408_42021_c1 nmdc:mga0k408_42021_c1_232_687 135
124 3300050494 nmdc:mga06z11_98947_c1 nmdc:mga06z11_98947_c1_63_518 135
125 3300050495 nmdc:mga04h51_76116_c1 nmdc:mga04h51_76116_c1_598_1053 135
126 3300050496 nmdc:mga07m45_288896_c1 nmdc:mga07m45_288896_c1_62_517 135
127 3300050507 nmdc:mga05p37_6554_c1 nmdc:mga05p37_6554_c1_9010_9492 135
128 3300050508 nmdc:mga09592_341592_c1 nmdc:mga09592_341592_c1_783_1265 135
129 3300050509 nmdc:mga0qj67_16329_c1 nmdc:mga0qj67_16329_c1_2129_2611 135
130 3300050509 nmdc:mga0qj67_176129_c1 nmdc:mga0qj67_176129_c1_1057_1539 135
131 3300050510 nmdc:mga06r32_14910_c1 nmdc:mga06r32_14910_c1_4511_4993 135
132 3300050510 nmdc:mga06r32_69218_c1 nmdc:mga06r32_69218_c1_785_1237 135
133 3300050511 nmdc:mga08y16_1551525_c1 nmdc:mga08y16_1551525_c1_63_542 135
134 3300050515 nmdc:mga0a205_105883_c1 nmdc:mga0a205_105883_c1_525_968 135
135 3300054114 Ga0501084_0037513 Ga0501084_0037513_2155_2607 135
136 3300054114 Ga0501084_0245159 Ga0501084_0245159_561_1010 135
137 3300061734 Ga0530510_0285348 Ga0530510_0285348_513_959 135
138 3300013306 Ga0163162_10260696 Ga0163162_102606961 137
139 3300005365 Ga0070688_100866565 Ga0070688_1008665651 138
140 3300005518 Ga0070699_100145770 Ga0070699_1001457702 138
141 3300005841 Ga0068863_100952154 Ga0068863_1009521542 138
142 3300009177 Ga0105248_11566112 Ga0105248_115661121 138
143 3300026088 Ga0207641_10900551 Ga0207641_109005512 138
144 3300046525 Ga0495663_0000345 Ga0495663_0000345_6721_7140 138
145 3300046537 Ga0495598_0000892 Ga0495598_0000892_3370_3789 138
146 3300046539 Ga0495621_0000235 Ga0495621_0000235_1393_1812 138
147 3300005445 Ga0070708_100747969 Ga0070708_1007479692 139
148 3300005467 Ga0070706_100085015 Ga0070706_1000850152 139
149 3300005467 Ga0070706_100147510 Ga0070706_1001475102 139
150 3300005468 Ga0070707_100047535 Ga0070707_1000475353 139
151 3300005471 Ga0070698_100020395 Ga0070698_1000203953 139
152 3300005536 Ga0070697_100020207 Ga0070697_1000202072 139
153 3300005536 Ga0070697_100134931 Ga0070697_1001349312 139
154 3300005545 Ga0070695_100045845 Ga0070695_1000458452 139
155 3300005549 Ga0070704_100606464 Ga0070704_1006064642 139
156 3300025910 Ga0207684_10064672 Ga0207684_100646724 139
157 3300025910 Ga0207684_10102630 Ga0207684_101026302 139
158 3300025910 Ga0207684_10597806 Ga0207684_105978061 139
159 3300025922 Ga0207646_10036553 Ga0207646_100365533 139
160 3300031456 Ga0307513_10679254 Ga0307513_106792542 139
161 2162886006 SwRhRL3b_contig_2289966 SwRhRL3b_0169.00000680 140
162 3300001426 JGI24030J14995_100111 JGI24030J14995_1001112 140
163 3300001432 JGI24034J14986_100075 JGI24034J14986_1000754 140
164 3300002074 JGI24748J21848_1000073 JGI24748J21848_100007316 140
165 3300002239 JGI24034J26672_10000013 JGI24034J26672_10000013114 140
166 3300002244 JGI24742J22300_10016766 JGI24742J22300_100167662 140
167 3300005295 Ga0065707_10083680 Ga0065707_100836805 140
168 3300005295 Ga0065707_10157664 Ga0065707_101576642 140
169 3300005330 Ga0070690_100009279 Ga0070690_1000092792 140
170 3300005334 Ga0068869_100237409 Ga0068869_1002374091 140
171 3300005337 Ga0070682_100000104 Ga0070682_10000010422 140
172 3300005337 Ga0070682_101873019 Ga0070682_1018730191 140
173 3300005338 Ga0068868_100078331 Ga0068868_1000783313 140
174 3300005338 Ga0068868_100922843 Ga0068868_1009228432 140
175 3300005340 Ga0070689_101152093 Ga0070689_1011520931 140
176 3300005343 Ga0070687_100042023 Ga0070687_1000420232 140
177 3300005343 Ga0070687_100043028 Ga0070687_1000430281 140
178 3300005343 Ga0070687_100194761 Ga0070687_1001947612 140
179 3300005353 Ga0070669_100667977 Ga0070669_1006679771 140
180 3300005355 Ga0070671_100120423 Ga0070671_1001204232 140
181 3300005356 Ga0070674_101729684 Ga0070674_1017296841 140
182 3300005364 Ga0070673_100118027 Ga0070673_1001180271 140
183 3300005406 Ga0070703_10000054 Ga0070703_1000005440 140
184 3300005440 Ga0070705_100225482 Ga0070705_1002254822 140
185 3300005440 Ga0070705_100253917 Ga0070705_1002539172 140
186 3300005441 Ga0070700_100012464 Ga0070700_1000124644 140
187 3300005441 Ga0070700_100519444 Ga0070700_1005194441 140
188 3300005444 Ga0070694_100002672 Ga0070694_1000026728 140
189 3300005444 Ga0070694_100077741 Ga0070694_1000777412 140
190 3300005444 Ga0070694_100352331 Ga0070694_1003523312 140
191 3300005444 Ga0070694_101164833 Ga0070694_1011648331 140
192 3300005445 Ga0070708_101839732 Ga0070708_1018397321 140
193 3300005459 Ga0068867_101696788 Ga0068867_1016967881 140
194 3300005467 Ga0070706_100076859 Ga0070706_1000768593 140
195 3300005467 Ga0070706_100229513 Ga0070706_1002295133 140
196 3300005467 Ga0070706_100493045 Ga0070706_1004930452 140
197 3300005467 Ga0070706_100777351 Ga0070706_1007773512 140
198 3300005468 Ga0070707_100074429 Ga0070707_1000744291 140
199 3300005468 Ga0070707_100323661 Ga0070707_1003236612 140
200 3300005468 Ga0070707_100450371 Ga0070707_1004503711 140
201 3300005468 Ga0070707_100545429 Ga0070707_1005454292 140
202 3300005471 Ga0070698_100271742 Ga0070698_1002717422 140
203 3300005471 Ga0070698_100631535 Ga0070698_1006315352 140
204 3300005518 Ga0070699_100559224 Ga0070699_1005592242 140
205 3300005536 Ga0070697_100000494 Ga0070697_10000049414 140
206 3300005536 Ga0070697_100061238 Ga0070697_1000612382 140
207 3300005536 Ga0070697_100157947 Ga0070697_1001579472 140
208 3300005536 Ga0070697_100169908 Ga0070697_1001699082 140
209 3300005536 Ga0070697_100397058 Ga0070697_1003970582 140
210 3300005544 Ga0070686_100126385 Ga0070686_1001263852 140
211 3300005544 Ga0070686_100136129 Ga0070686_1001361291 140
212 3300005545 Ga0070695_100283000 Ga0070695_1002830001 140
213 3300005545 Ga0070695_101294031 Ga0070695_1012940311 140
214 3300005546 Ga0070696_100104292 Ga0070696_1001042922 140
215 3300005546 Ga0070696_100348750 Ga0070696_1003487502 140
216 3300005546 Ga0070696_100389956 Ga0070696_1003899562 140
217 3300005546 Ga0070696_100630387 Ga0070696_1006303872 140
218 3300005547 Ga0070693_100137962 Ga0070693_1001379621 140
219 3300005549 Ga0070704_100017637 Ga0070704_1000176374 140
220 3300005617 Ga0068859_100289333 Ga0068859_1002893332 140
221 3300005617 Ga0068859_100768924 Ga0068859_1007689242 140
222 3300005618 Ga0068864_100065689 Ga0068864_1000656892 140
223 3300005718 Ga0068866_10016916 Ga0068866_100169163 140
224 3300005719 Ga0068861_100332181 Ga0068861_1003321812 140
225 3300005841 Ga0068863_100687175 Ga0068863_1006871752 140
226 3300005842 Ga0068858_100000214 Ga0068858_10000021418 140
227 3300005842 Ga0068858_100283181 Ga0068858_1002831812 140
228 3300005843 Ga0068860_100342974 Ga0068860_1003429742 140
229 3300005844 Ga0068862_100052073 Ga0068862_1000520735 140
230 3300005985 Ga0081539_10240684 Ga0081539_102406842 140
231 3300005985 Ga0081539_10366439 Ga0081539_103664392 140
232 3300006173 Ga0070716_100078139 Ga0070716_1000781391 140
233 3300006173 Ga0070716_100777026 Ga0070716_1007770262 140
234 3300006173 Ga0070716_100961679 Ga0070716_1009616791 140
235 3300006358 Ga0068871_100215180 Ga0068871_1002151802 140
236 3300006844 Ga0075428_100060381 Ga0075428_1000603816 140
237 3300006852 Ga0075433_10799953 Ga0075433_107999532 140
238 3300006871 Ga0075434_100018074 Ga0075434_1000180742 140
239 3300006871 Ga0075434_100515126 Ga0075434_1005151262 140
240 3300006880 Ga0075429_100025619 Ga0075429_1000256196 140
241 3300006881 Ga0068865_101400994 Ga0068865_1014009941 140
242 3300006914 Ga0075436_100000015 Ga0075436_10000001572 140
243 3300006931 Ga0097620_100289311 Ga0097620_1002893112 140
244 3300006931 Ga0097620_100768908 Ga0097620_1007689082 140
245 3300007076 Ga0075435_100000419 Ga0075435_10000041916 140
246 3300007076 Ga0075435_100822404 Ga0075435_1008224042 140
247 3300009098 Ga0105245_10158497 Ga0105245_101584972 140
248 3300009101 Ga0105247_10000015 Ga0105247_1000001516 140
249 3300009101 Ga0105247_10242749 Ga0105247_102427492 140
250 3300009147 Ga0114129_10055147 Ga0114129_100551473 140
251 3300009147 Ga0114129_10371255 Ga0114129_103712552 140
252 3300009147 Ga0114129_10717142 Ga0114129_107171422 140
253 3300009148 Ga0105243_10001006 Ga0105243_100010064 140
254 3300009148 Ga0105243_10026735 Ga0105243_100267354 140
255 3300009148 Ga0105243_11449295 Ga0105243_114492952 140
256 3300009176 Ga0105242_10000163 Ga0105242_100001636 140
257 3300009176 Ga0105242_10000820 Ga0105242_100008209 140
258 3300009176 Ga0105242_10950030 Ga0105242_109500302 140
259 3300009176 Ga0105242_12757775 Ga0105242_127577751 140
260 3300009177 Ga0105248_10216774 Ga0105248_102167742 140
261 3300009177 Ga0105248_10456508 Ga0105248_104565082 140
262 3300009177 Ga0105248_10697177 Ga0105248_106971772 140
263 3300009177 Ga0105248_12621047 Ga0105248_126210472 140
264 3300009553 Ga0105249_10164458 Ga0105249_101644583 140
265 3300009553 Ga0105249_13201849 Ga0105249_132018491 140
266 3300010375 Ga0105239_12684421 Ga0105239_126844211 140
267 3300011119 Ga0105246_10889134 Ga0105246_108891342 140
268 3300013297 Ga0157378_10027231 Ga0157378_100272312 140
269 3300013297 Ga0157378_10232244 Ga0157378_102322442 140
270 3300013297 Ga0157378_10580532 Ga0157378_105805322 140
271 3300013297 Ga0157378_10587477 Ga0157378_105874772 140
272 3300013297 Ga0157378_11140160 Ga0157378_111401602 140
273 3300013306 Ga0163162_10097186 Ga0163162_100971862 140
274 3300013306 Ga0163162_10306149 Ga0163162_103061492 140
275 3300013308 Ga0157375_10233032 Ga0157375_102330322 140
276 3300014326 Ga0157380_10106787 Ga0157380_101067872 140
277 3300014326 Ga0157380_10327651 Ga0157380_103276512 140
278 3300014326 Ga0157380_10455881 Ga0157380_104558812 140
279 3300014326 Ga0157380_12753862 Ga0157380_127538621 140
280 3300014968 Ga0157379_10107511 Ga0157379_101075113 140
281 3300017792 Ga0163161_10027896 Ga0163161_100278962 140
282 3300017792 Ga0163161_10427013 Ga0163161_104270132 140
283 3300021388 Ga0213875_10383712 Ga0213875_103837121 140
284 3300025223 Ga0207672_1000053 Ga0207672_100005311 140
285 3300025315 Ga0207697_10150231 Ga0207697_101502312 140
286 3300025885 Ga0207653_10000026 Ga0207653_1000002637 140
287 3300025900 Ga0207710_10000004 Ga0207710_10000004731 140
288 3300025900 Ga0207710_10646606 Ga0207710_106466061 140
289 3300025907 Ga0207645_10144497 Ga0207645_101444972 140
290 3300025908 Ga0207643_11076307 Ga0207643_110763071 140
291 3300025910 Ga0207684_10248533 Ga0207684_102485332 140
292 3300025910 Ga0207684_10289432 Ga0207684_102894322 140
293 3300025918 Ga0207662_10031911 Ga0207662_100319114 140
294 3300025918 Ga0207662_10163592 Ga0207662_101635922 140
295 3300025918 Ga0207662_10197959 Ga0207662_101979592 140
296 3300025922 Ga0207646_10035815 Ga0207646_100358154 140
297 3300025922 Ga0207646_10043858 Ga0207646_100438585 140
298 3300025922 Ga0207646_10490455 Ga0207646_104904552 140
299 3300025922 Ga0207646_10873269 Ga0207646_108732692 140
300 3300025923 Ga0207681_10974644 Ga0207681_109746442 140
301 3300025926 Ga0207659_10724450 Ga0207659_107244502 140
302 3300025931 Ga0207644_10000159 Ga0207644_1000015933 140
303 3300025934 Ga0207686_10000064 Ga0207686_1000006413 140
304 3300025934 Ga0207686_10000098 Ga0207686_1000009818 140
305 3300025934 Ga0207686_10787003 Ga0207686_107870032 140
306 3300025935 Ga0207709_10000150 Ga0207709_1000015013 140
307 3300025935 Ga0207709_10419357 Ga0207709_104193572 140
308 3300025936 Ga0207670_10192370 Ga0207670_101923702 140
309 3300025939 Ga0207665_10106490 Ga0207665_101064902 140
310 3300025941 Ga0207711_10229978 Ga0207711_102299782 140
311 3300025942 Ga0207689_10012142 Ga0207689_100121424 140
312 3300025942 Ga0207689_10061784 Ga0207689_100617843 140
313 3300025960 Ga0207651_10968504 Ga0207651_109685041 140
314 3300026023 Ga0207677_10710444 Ga0207677_107104442 140
315 3300026035 Ga0207703_10000084 Ga0207703_1000008416 140
316 3300026035 Ga0207703_10120088 Ga0207703_101200882 140
317 3300026035 Ga0207703_10428794 Ga0207703_104287942 140
318 3300026075 Ga0207708_10041788 Ga0207708_100417882 140
319 3300026075 Ga0207708_10780281 Ga0207708_107802812 140
320 3300026088 Ga0207641_11455233 Ga0207641_114552331 140
321 3300026118 Ga0207675_101888849 Ga0207675_1018888492 140
322 3300027907 Ga0207428_10007007 Ga0207428_100070077 140
323 3300028380 Ga0268265_10251913 Ga0268265_102519132 140
324 3300028381 Ga0268264_10041414 Ga0268264_100414142 140
325 3300028381 Ga0268264_10118444 Ga0268264_101184442 140
326 3300031456 Ga0307513_10944123 Ga0307513_109441231 140
327 3300031548 Ga0307408_100880934 Ga0307408_1008809342 140
328 3300032002 Ga0307416_101384163 Ga0307416_1013841632 140
329 3300035171 Ga0373946_0777134 Ga0373946_0777134_29_475 140
330 3300037418 Ga0395900_0395719 Ga0395900_0395719_261_689 140
331 3300037853 Ga0436364_0195393 Ga0436364_0195393_39_473 140
332 3300037853 Ga0436364_0925515 Ga0436364_0925515_371_805 140
333 3300039437 Ga0436365_0393919 Ga0436365_0393919_844_1278 140
334 3300044673 Ga0453683_0047176 Ga0453683_0047176_727_1167 140
335 3300044673 Ga0453683_0574640 Ga0453683_0574640_199_642 140
336 3300046514 Ga0495618_0929506 Ga0495618_0929506_18_464 140
337 3300046533 Ga0495640_0074023 Ga0495640_0074023_220_666 140
338 3300046615 Ga0495656_0383928 Ga0495656_0383928_143_586 140
339 3300046689 Ga0495613_0784134 Ga0495613_0784134_19_465 140
340 3300047322 Ga0495680_0482803 Ga0495680_0482803_390_833 140
341 3300047471 Ga0495684_0140923 Ga0495684_0140923_1124_1567 140
342 3300049514 Ga0501291_132751 Ga0501291_132751_83_526 140
343 3300049743 Ga0501081_0250891 Ga0501081_0250891_289_717 140
344 3300050507 nmdc:mga05p37_20897_c1 nmdc:mga05p37_20897_c1_4897_5322 140
345 3300050507 nmdc:mga05p37_711893_c1 nmdc:mga05p37_711893_c1_21_449 140
346 3300050507 nmdc:mga05p37_91998_c1 nmdc:mga05p37_91998_c1_3092_3541 140
347 3300050508 nmdc:mga09592_61141_c1 nmdc:mga09592_61141_c1_85_507 140
348 3300050511 nmdc:mga08y16_410156_c1 nmdc:mga08y16_410156_c1_786_1208 140
349 3300050512 nmdc:mga0n895_19484_c1 nmdc:mga0n895_19484_c1_4946_5389 140
350 3300050513 nmdc:mga0rr50_207740_c1 nmdc:mga0rr50_207740_c1_216_659 140
351 3300050513 nmdc:mga0rr50_397_c1 nmdc:mga0rr50_397_c1_9176_9607 140
352 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_70058_70489 140
353 3300060353 Ga0501082_0268672 Ga0501082_0268672_245_673 140
354 3300061734 Ga0530510_0364006 Ga0530510_0364006_352_780 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01398

JAB

JAB1/Mov34/MPN/PAD-1 ubiquitin protease

14

120

0.85

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

22

144

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vd8-assembly1.cif.gz_B the crystal structure of alanine racemase from bacillus anthracis (ba0252) 0.9744 107 120
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8699 1 140
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8417 1 140
6fnn-assembly2.cif.gz_B caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex 0.8105 2 138
6fno-assembly1.cif.gz_A caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex, zinc soak 0.81 2 138
ID Description Score Start End Superfamily
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8699 1 140 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8562 1 140 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8417 1 140 3.40.140.10
af_Q09406_218_377_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8391 120 136 2.130.10.10
af_P9WF13_12_52_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8338 108 120 3.40.1620.10
ID Description Score Start End GO Terms
AF-A0A7V4MPE0-F1-model_v4 JAB domain-containing protein 0.9919 80 140 GO:0006508
GO:0008235
GO:0008270
AF-A0A7H4NKM8-F1-model_v4 deleted 0.9901 79 140
AF-A0A7V9CNM7-F1-model_v4 Mov34/MPN/PAD-1 family protein 0.9861 66 140 GO:0006508
GO:0008235
GO:0008270
AF-A0A3D4JCX9-F1-model_v4 JAB domain-containing protein 0.9861 83 140 GO:0006508
GO:0008235
GO:0008270
AF-A0A7X3QEM3-F1-model_v4 JAB domain-containing protein 0.9788 71 140 GO:0006508
GO:0008235
GO:0008270

Feature Viewer

pLDDT pTM Quality
89.3 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map