F419674

General Info

Members Datasets Scaffolds Average Seq Length
354 218 708 235

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000170|Ga0070699_10000017039
Length 270
Sequence MLTIQDVHTYYGDSHVLQGVTMHVDRGTVAAVLGRNGVGKTTLCRSIVGFTPARSGXXXXNDVETTRLPPHRISALRIGLVPQGRRIFSSLTVDENLAIAARPPAAGRPGRPGPFLSPGLSDEAQRAKSEAPGAKVDGPGDSWNLDKAFAVFPRLAERRRNRGNQLSGGEQQMLAIARALVANPLLLVMDEPTEGLSPQMVADVAALIRRLKTEGTAVLLAEQNAAFAVTVADVVHVMSKGTIVYSSDPAALWANEEVKAQYLGVPKGSS

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
217 2643221658 Variovorax sp. Root411 Isolate Unclassified
218 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.28
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.28
Rhizoplane 3.95
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100000170 3300005518 Bacteria 62944
2 Ga0065715_10008932 3300005293 Bacteria 4176
3 Ga0070676_10013799 3300005328 Bacteria 4431
4 Ga0070690_100004954 3300005330 Bacteria 7448
5 Ga0070690_100453831 3300005330 Bacteria 951
6 Ga0070677_10016146 3300005333 Bacteria 2655
7 Ga0068869_100046138 3300005334 Bacteria 3141
8 Ga0070666_10025125 3300005335 Bacteria 3882
9 Ga0070666_10229880 3300005335 Bacteria 1310
10 Ga0070666_10488129 3300005335 Bacteria 892
11 Ga0070689_100019837 3300005340 Bacteria 4977
12 Ga0070687_100004712 3300005343 Bacteria 5459
13 Ga0070661_100035744 3300005344 Bacteria 3610
14 Ga0070692_10423564 3300005345 Bacteria 846
15 Ga0070668_100093133 3300005347 Bacteria 2377
16 Ga0070669_100016105 3300005353 Bacteria 5332
17 Ga0070675_100144177 3300005354 Bacteria 2038
18 Ga0070671_100076904 3300005355 Bacteria 2789
19 Ga0070674_100131321 3300005356 Bacteria 1867
20 Ga0070673_100042919 3300005364 Bacteria 3490
21 Ga0070673_100721016 3300005364 Bacteria 917
22 Ga0070688_100065689 3300005365 Bacteria 2306
23 Ga0070659_100247472 3300005366 Bacteria 1477
24 Ga0070667_100027618 3300005367 Bacteria 4722
25 Ga0070667_100366464 3300005367 Bacteria 1307
26 Ga0070714_100075868 3300005435 Bacteria 2917
27 Ga0070714_100246730 3300005435 Bacteria 1650
28 Ga0070714_100542455 3300005435 Bacteria 1112
29 Ga0070705_100345470 3300005440 Bacteria 1083
30 Ga0070700_100009118 3300005441 Bacteria 5437
31 Ga0070694_100012049 3300005444 Bacteria 5370
32 Ga0070694_100014789 3300005444 Bacteria 4889
33 Ga0070708_100026797 3300005445 Bacteria 4938
34 Ga0070708_100043787 3300005445 Bacteria 3934
35 Ga0070663_100082556 3300005455 Bacteria 2364
36 Ga0070678_100127510 3300005456 Bacteria 2017
37 Ga0070662_100028708 3300005457 Bacteria 3874
38 Ga0070681_10127865 3300005458 Bacteria 2474
39 Ga0068867_100073037 3300005459 Bacteria 2569
40 Ga0068867_100094543 3300005459 Bacteria 2273
41 Ga0070685_10017346 3300005466 Bacteria 3852
42 Ga0070706_100372347 3300005467 Bacteria 1331
43 Ga0070707_100009956 3300005468 Bacteria 8847
44 Ga0070707_100084566 3300005468 Bacteria 3066
45 Ga0070707_100402908 3300005468 Bacteria 1328
46 Ga0070707_100509842 3300005468 Bacteria 1165
47 Ga0070698_100000701 3300005471 Bacteria 35833
48 Ga0070698_100022751 3300005471 Bacteria 6554
49 Ga0070698_100532376 3300005471 Bacteria 1113
50 Ga0070698_100730240 3300005471 Bacteria 933
51 Ga0070698_100838385 3300005471 Bacteria 864
52 Ga0070699_100128616 3300005518 Bacteria 2232
53 Ga0070699_100375005 3300005518 Bacteria 1284
54 Ga0070679_100064695 3300005530 Bacteria 3645
55 Ga0070679_100088202 3300005530 Bacteria 3089
56 Ga0070697_100125884 3300005536 Bacteria 2146
57 Ga0070697_100200331 3300005536 Bacteria 1697
58 Ga0070697_100223560 3300005536 Bacteria 1605
59 Ga0070697_100348952 3300005536 Bacteria 1278
60 Ga0070686_100002924 3300005544 Bacteria 9379
61 Ga0070695_100110698 3300005545 Bacteria 1863
62 Ga0070696_100387893 3300005546 Bacteria 1090
63 Ga0070665_100003364 3300005548 Bacteria 17099
64 Ga0070665_100047182 3300005548 Bacteria 4324
65 Ga0070665_100186151 3300005548 Bacteria 2077
66 Ga0070704_100019132 3300005549 Bacteria 4396
67 Ga0070704_100025972 3300005549 Bacteria 3863
68 Ga0070704_100140518 3300005549 Bacteria 1885
69 Ga0070664_100002017 3300005564 Bacteria 16283
70 Ga0068857_100065572 3300005577 Bacteria 3230
71 Ga0068852_100061436 3300005616 Bacteria 3265
72 Ga0068859_100033774 3300005617 Bacteria 5136
73 Ga0068864_100024940 3300005618 Bacteria 5031
74 Ga0068864_100025136 3300005618 Bacteria 5014
75 Ga0068861_100099634 3300005719 Bacteria 2308
76 Ga0068870_10005414 3300005840 Bacteria 5573
77 Ga0068863_100010753 3300005841 Bacteria 8879
78 Ga0068863_100155868 3300005841 Bacteria 2187
79 Ga0068858_100017006 3300005842 Bacteria 6828
80 Ga0068858_100022924 3300005842 Bacteria 5823
81 Ga0068860_100061374 3300005843 Bacteria 3572
82 Ga0068860_100100707 3300005843 Bacteria 2756
83 Ga0068862_100026970 3300005844 Bacteria 4831
84 Ga0068862_100112513 3300005844 Bacteria 2391
85 Ga0097621_100009216 3300006237 Bacteria 7158
86 Ga0097621_100396968 3300006237 Bacteria 1234
87 Ga0068871_100002011 3300006358 Bacteria 13758
88 Ga0068871_100008266 3300006358 Bacteria 7481
89 Ga0075428_100005253 3300006844 Bacteria 14399
90 Ga0075428_100060648 3300006844 Bacteria 4142
91 Ga0075430_100000582 3300006846 Bacteria 27770
92 Ga0075430_100061221 3300006846 Bacteria 3163
93 Ga0075431_100001060 3300006847 Bacteria 24615
94 Ga0075431_100007668 3300006847 Bacteria 10747
95 Ga0075431_100024628 3300006847 Bacteria 6170
96 Ga0075433_10011271 3300006852 Bacteria 7195
97 Ga0075434_100047619 3300006871 Bacteria 4255
98 Ga0075434_100212111 3300006871 Bacteria 1956
99 Ga0075429_100002092 3300006880 Bacteria 16659
100 Ga0075429_100047008 3300006880 Bacteria 3755
101 Ga0075429_100059031 3300006880 Bacteria 3341
102 Ga0075429_100143270 3300006880 Bacteria 2092
103 Ga0068865_100010433 3300006881 Bacteria 5782
104 Ga0068865_100022590 3300006881 Bacteria 4106
105 Ga0097620_100033775 3300006931 Bacteria 5136
106 Ga0099795_10009417 3300007788 Bacteria 2835
107 Ga0105240_10800674 3300009093 Bacteria 1021
108 Ga0111539_10049179 3300009094 Bacteria 5030
109 Ga0111539_10095828 3300009094 Bacteria 3485
110 Ga0105245_10028669 3300009098 Bacteria 4913
111 Ga0105245_10466501 3300009098 Bacteria 1274
112 Ga0105245_10477396 3300009098 Bacteria 1259
113 Ga0105245_10661435 3300009098 Bacteria 1075
114 Ga0105247_10002100 3300009101 Bacteria 13772
115 Ga0105247_10016608 3300009101 Bacteria 4413
116 Ga0105247_10449817 3300009101 Bacteria 928
117 Ga0114129_10007683 3300009147 Bacteria 15344
118 Ga0114129_10391585 3300009147 Bacteria 1833
119 Ga0114129_10415013 3300009147 Bacteria 1772
120 Ga0105243_10640396 3300009148 Bacteria 1029
121 Ga0105243_10738467 3300009148 Bacteria 964
122 Ga0105242_10100075 3300009176 Bacteria 2454
123 Ga0105242_10131668 3300009176 Bacteria 2160
124 Ga0105248_10051379 3300009177 Bacteria 4625
125 Ga0105248_10072423 3300009177 Bacteria 3873
126 Ga0105248_10073980 3300009177 Bacteria 3830
127 Ga0105248_10392291 3300009177 Bacteria 1563
128 Ga0105248_10792664 3300009177 Bacteria 1069
129 Ga0105237_10243010 3300009545 Bacteria 1802
130 Ga0105237_11072156 3300009545 Bacteria 812
131 Ga0105249_10002139 3300009553 Bacteria 17118
132 Ga0099796_10041472 3300010159 Bacteria 1559
133 Ga0105246_10362792 3300011119 Bacteria 1191
134 Ga0157325_1000541 3300012485 Bacteria 1538
135 Ga0157370_10076713 3300013104 Bacteria 3148
136 Ga0157370_10462996 3300013104 Bacteria 1165
137 Ga0163162_10015033 3300013306 Bacteria 7561
138 Ga0163162_10390844 3300013306 Bacteria 1524
139 Ga0157375_10070875 3300013308 Bacteria 3497
140 Ga0163163_10092117 3300014325 Bacteria 3046
141 Ga0163163_10353283 3300014325 Bacteria 1526
142 Ga0157380_10014018 3300014326 Bacteria 5856
143 Ga0157380_10128006 3300014326 Bacteria 2162
144 Ga0157377_10006239 3300014745 Bacteria 5674
145 Ga0157379_10014830 3300014968 Bacteria 6835
146 Ga0157379_10048909 3300014968 Bacteria 3775
147 Ga0157379_10073361 3300014968 Bacteria 3063
148 Ga0157379_10165289 3300014968 Bacteria 1997
149 Ga0157376_10003274 3300014969 Bacteria 11142
150 Ga0157376_10103119 3300014969 Bacteria 2497
151 Ga0213876_10011849 3300021384 Bacteria 4649
152 Ga0207697_10002429 3300025315 Bacteria 9654
153 Ga0207653_10018989 3300025885 Bacteria 2166
154 Ga0207682_10002055 3300025893 Bacteria 9109
155 Ga0207710_10053563 3300025900 Bacteria 1815
156 Ga0207688_10004006 3300025901 Bacteria 8024
157 Ga0207680_10052854 3300025903 Bacteria 2436
158 Ga0207680_10076188 3300025903 Bacteria 2094
159 Ga0207680_10232381 3300025903 Bacteria 1268
160 Ga0207680_10316031 3300025903 Bacteria 1091
161 Ga0207647_10179799 3300025904 Bacteria 1229
162 Ga0207645_10004635 3300025907 Bacteria 10124
163 Ga0207643_10004233 3300025908 Bacteria 7729
164 Ga0207684_10009284 3300025910 Bacteria 8688
165 Ga0207695_10266235 3300025913 Bacteria 1610
166 Ga0207671_10429394 3300025914 Bacteria 1051
167 Ga0207662_10001656 3300025918 Bacteria 10888
168 Ga0207649_10038199 3300025920 Bacteria 2905
169 Ga0207652_10047200 3300025921 Bacteria 3678
170 Ga0207652_10060977 3300025921 Bacteria 3256
171 Ga0207646_10033844 3300025922 Bacteria 4619
172 Ga0207646_10216795 3300025922 Bacteria 1729
173 Ga0207646_10659917 3300025922 Bacteria 937
174 Ga0207681_10459474 3300025923 Bacteria 1037
175 Ga0207659_10009973 3300025926 Bacteria 5950
176 Ga0207659_10135620 3300025926 Bacteria 1905
177 Ga0207687_10017723 3300025927 Bacteria 4694
178 Ga0207700_10029967 3300025928 Bacteria 3847
179 Ga0207664_10194676 3300025929 Bacteria 1747
180 Ga0207690_10061518 3300025932 Bacteria 2553
181 Ga0207706_10009679 3300025933 Bacteria 8846
182 Ga0207686_10004219 3300025934 Bacteria 7708
183 Ga0207670_10023952 3300025936 Bacteria 3808
184 Ga0207669_10034185 3300025937 Bacteria 2878
185 Ga0207669_10101249 3300025937 Bacteria 1905
186 Ga0207704_10045043 3300025938 Bacteria 2618
187 Ga0207704_10049257 3300025938 Bacteria 2533
188 Ga0207691_10011618 3300025940 Bacteria 8452
189 Ga0207711_10047724 3300025941 Bacteria 3663
190 Ga0207711_10048454 3300025941 Bacteria 3635
191 Ga0207711_10538983 3300025941 Bacteria 1088
192 Ga0207711_10731856 3300025941 Bacteria 922
193 Ga0207689_10002645 3300025942 Bacteria 16574
194 Ga0207679_10051882 3300025945 Bacteria 3005
195 Ga0207679_10727973 3300025945 Bacteria 901
196 Ga0207651_10038841 3300025960 Bacteria 3132
197 Ga0207651_10042484 3300025960 Bacteria 3026
198 Ga0207712_10014268 3300025961 Bacteria 5106
199 Ga0207668_10022705 3300025972 Bacteria 4022
200 Ga0207668_10318900 3300025972 Bacteria 1289
201 Ga0207658_10023501 3300025986 Bacteria 4303
202 Ga0207677_10079815 3300026023 Bacteria 2341
203 Ga0207677_10266006 3300026023 Bacteria 1400
204 Ga0207703_10453803 3300026035 Bacteria 1198
205 Ga0207678_10066546 3300026067 Bacteria 3094
206 Ga0207708_10009553 3300026075 Bacteria 7191
207 Ga0207641_10018550 3300026088 Bacteria 5704
208 Ga0207641_10108036 3300026088 Bacteria 2462
209 Ga0207648_10166249 3300026089 Bacteria 1949
210 Ga0207674_10021693 3300026116 Bacteria 6913
211 Ga0207675_100016250 3300026118 Bacteria 6947
212 Ga0207683_10020902 3300026121 Bacteria 5601
213 Ga0207683_10177210 3300026121 Bacteria 1932
214 Ga0209974_10073645 3300027876 Bacteria 1168
215 Ga0207428_10002825 3300027907 Bacteria 17234
216 Ga0268266_10102597 3300028379 Bacteria 2523
217 Ga0268266_10311299 3300028379 Bacteria 1471
218 Ga0268265_10046258 3300028380 Bacteria 3252
219 Ga0268265_10235568 3300028380 Bacteria 1612
220 Ga0268264_10042605 3300028381 Bacteria 3758
221 Ga0268264_10113478 3300028381 Bacteria 2377
222 Ga0268264_10674375 3300028381 Bacteria 1025
223 Ga0265338_10005038 3300028800 Bacteria 17442
224 Ga0265330_10012983 3300031235 Bacteria 3888
225 Ga0265340_10019072 3300031247 Bacteria 3532
226 Ga0316579_10005280 3300031691 Bacteria 5203
227 Ga0316579_10038689 3300031691 Bacteria 2206
228 Ga0265342_10004294 3300031712 Bacteria 11287
229 Ga0316576_10014906 3300031727 Bacteria 5200
230 Ga0316576_10015666 3300031727 Bacteria 5094
231 Ga0316576_10072487 3300031727 Unclassified 2542
232 Ga0316578_10127145 3300031728 Bacteria 1533
233 Ga0316578_10303792 3300031728 Bacteria 954
234 Ga0307405_10115543 3300031731 Bacteria 1826
235 Ga0316577_10046518 3300031733 Bacteria 2423
236 Ga0316577_10204697 3300031733 Bacteria 1115
237 Ga0307416_100065127 3300032002 Bacteria 2993
238 Ga0307416_100680985 3300032002 Bacteria 1116
239 Ga0307411_10218777 3300032005 Bacteria 1476
240 Ga0307411_10568494 3300032005 Bacteria 970
241 Ga0316583_10015951 3300032133 Bacteria 2705
242 Ga0316580_10005790 3300032139 Bacteria 3626
243 Ga0316588_1010279 3300033528 Bacteria 1969
244 Ga0373938_0011601 3300034957 Bacteria 1641
245 Ga0373953_0079043 3300035117 Bacteria 1365
246 Ga0373954_0278370 3300035118 Bacteria 825
247 Ga0373956_0143764 3300035119 Bacteria 1121
248 Ga0373957_0054971 3300035120 Bacteria 1530
249 Ga0316574_0057523 3300035398 Bacteria 2434
250 Ga0316574_0067925 3300035398 Bacteria 2247
251 Ga0373935_0115128 3300035692 Bacteria 1790
252 Ga0373927_0203508 3300035695 Bacteria 1300
253 Ga0373937_0229597 3300036401 Bacteria 1748
254 Ga0373937_0480695 3300036401 Bacteria 1180
255 Ga0316582_0004031 3300036647 Bacteria 7340
256 Ga0316582_0009235 3300036647 Bacteria 5341
257 Ga0316584_0111537 3300036712 Unclassified 2046
258 Ga0316584_0135458 3300036712 Bacteria 1838
259 Ga0373925_0118589 3300037068 Bacteria 2052
260 Ga0373925_0184235 3300037068 Bacteria 1654
261 Ga0436364_0512108 3300037853 Bacteria 6534
262 Ga0436364_0925453 3300037853 Bacteria 1996
263 Ga0436364_1448617 3300037853 Bacteria 10008
264 Ga0436365_0615103 3300039437 Bacteria 1615
265 Ga0436365_1840370 3300039437 Bacteria 32113
266 Ga0436360_0010248 3300039438 Bacteria 7657
267 Ga0436360_0331851 3300039438 Bacteria 1550
268 Ga0436363_1446605 3300039450 Bacteria 1632
269 Ga0439441_053016 3300042001 Bacteria 840
270 Ga0439450_001903 3300042008 Bacteria 3168
271 Ga0439435_0052678 3300042436 Bacteria 1168
272 Ga0495639_0064633 3300046475 Bacteria 1682
273 Ga0495586_0277577 3300046535 Bacteria 958
274 Ga0495634_0032861 3300046642 Bacteria 3566
275 Ga0495670_0295823 3300046691 Bacteria 867
276 Ga0495636_0180120 3300047318 Bacteria 959
277 Ga0495674_0216481 3300047319 Bacteria 1585
278 Ga0495674_0497978 3300047319 Bacteria 975
279 Ga0496100_0004790 3300048903 Bacteria 7226
280 Ga0496101_0000139 3300048904 Bacteria 63989
281 Ga0496102_0051179 3300048905 Bacteria 3763
282 Ga0496104_0025838 3300048907 Bacteria 5416
283 Ga0496104_0072426 3300048907 Bacteria 3277
284 Ga0496104_0403388 3300048907 Bacteria 1279
285 Ga0496105_0240783 3300048908 Bacteria 1468
286 Ga0496107_0022816 3300048910 Bacteria 4425
287 Ga0496112_0356923 3300048915 Bacteria 1404
288 Ga0496112_0445641 3300048915 Bacteria 1233
289 Ga0496114_0000302 3300048917 Bacteria 36280
290 Ga0496114_0267289 3300048917 Bacteria 1507
291 Ga0496114_0531463 3300048917 Bacteria 1040
292 Ga0496115_0232321 3300048918 Bacteria 1521
293 Ga0501036_0013239 3300049572 Bacteria 6848
294 Ga0501036_0390880 3300049572 Bacteria 1160
295 Ga0501036_0652423 3300049572 Bacteria 871
296 Ga0501038_0083223 3300049574 Bacteria 2694
297 Ga0501039_0349680 3300049575 Bacteria 1161
298 Ga0501040_0040325 3300049576 Bacteria 3177
299 Ga0501040_0073704 3300049576 Bacteria 2359
300 Ga0501040_0076310 3300049576 Bacteria 2317
301 Ga0501041_0003286 3300049577 Bacteria 9298
302 Ga0501042_0006967 3300049578 Bacteria 7376
303 Ga0501042_0151629 3300049578 Bacteria 1671
304 Ga0501043_0116468 3300049579 Bacteria 2097
305 Ga0501046_0027879 3300049580 Bacteria 4604
306 Ga0501048_0260211 3300049582 Bacteria 1233
307 Ga0501071_0020459 3300049587 Bacteria 4599
308 Ga0501071_0454815 3300049587 Bacteria 980
309 Ga0501072_0029309 3300049588 Bacteria 4299
310 Ga0501072_0189113 3300049588 Bacteria 1642
311 Ga0501074_0048328 3300049590 Bacteria 3074
312 Ga0501075_0000528 3300049591 Bacteria 23105
313 Ga0501075_0051558 3300049591 Bacteria 3094
314 Ga0501075_0476249 3300049591 Bacteria 952
315 Ga0501076_0000391 3300049592 Bacteria 27401
316 Ga0501076_0408096 3300049592 Bacteria 1117
317 Ga0501077_0114057 3300049593 Bacteria 1713
318 Ga0501079_0006770 3300049741 Bacteria 8622
319 Ga0501079_0051795 3300049741 Bacteria 3170
320 Ga0501079_0505650 3300049741 Bacteria 950
321 Ga0501080_0162569 3300049742 Bacteria 2061
322 Ga0501081_0001914 3300049743 Bacteria 12917
323 Ga0501283_010849 3300049779 Bacteria 1346
324 Ga0501035_0426360 3300049822 Bacteria 1101
325 Ga0501045_0024817 3300049824 Bacteria 4306
326 Ga0501045_0084257 3300049824 Bacteria 2345
327 Ga0501045_0180539 3300049824 Bacteria 1573
328 nmdc:mga05p37_36259_c1 3300050507 Bacteria 6052
329 nmdc:mga05p37_51224_c1 3300050507 Bacteria 5078
330 nmdc:mga05p37_728322_c1 3300050507 Bacteria 1097
331 nmdc:mga05p37_9572_c1 3300050507 Bacteria 11475
332 nmdc:mga09592_12156_c1 3300050508 Bacteria 7005
333 nmdc:mga09592_14194_c1 3300050508 Bacteria 6500
334 nmdc:mga09592_16225_c1 3300050508 Bacteria 6088
335 nmdc:mga0qj67_20777_c1 3300050509 Bacteria 5028
336 nmdc:mga0qj67_800_c1 3300050509 Bacteria 18117
337 nmdc:mga06r32_3398_c1 3300050510 Bacteria 14236
338 nmdc:mga06r32_4226_c1 3300050510 Bacteria 12870
339 nmdc:mga06r32_660057_c1 3300050510 Bacteria 1013
340 nmdc:mga08y16_50763_c1 3300050511 Bacteria 4341
341 nmdc:mga0n895_39177_c1 3300050512 Bacteria 4596
342 nmdc:mga0n895_57786_c1 3300050512 Bacteria 3824
343 nmdc:mga0rr50_439414_c1 3300050513 Bacteria 1105
344 nmdc:mga0a205_254_c1 3300050515 Bacteria 38196
345 Ga0495619_0428096 3300053085 Bacteria 913
346 Ga0501084_0031179 3300054114 Bacteria 4458
347 Ga0501084_0065884 3300054114 Bacteria 3031
348 Ga0501082_0001012 3300060353 Bacteria 24853
349 Ga0501082_0547426 3300060353 Bacteria 1012
350 Ga0530510_0001725 3300061734 Bacteria 14858
351 2524469010 2524023210 Bacteria 9029266
352 2644325837 2643221658 Bacteria 6064537
353 2980126974 2980125574 Bacteria 5567337
354 2980130056 2980125574 Bacteria 5567337
355 Ga0070699_100000170
356 Ga0065715_10008932
357 Ga0070676_10013799
358 Ga0070690_100004954
359 Ga0070690_100453831
360 Ga0070677_10016146
361 Ga0068869_100046138
362 Ga0070666_10025125
363 Ga0070666_10229880
364 Ga0070666_10488129
365 Ga0070689_100019837
366 Ga0070687_100004712
367 Ga0070661_100035744
368 Ga0070692_10423564
369 Ga0070668_100093133
370 Ga0070669_100016105
371 Ga0070675_100144177
372 Ga0070671_100076904
373 Ga0070674_100131321
374 Ga0070673_100042919
375 Ga0070673_100721016
376 Ga0070688_100065689
377 Ga0070659_100247472
378 Ga0070667_100027618
379 Ga0070667_100366464
380 Ga0070714_100075868
381 Ga0070714_100246730
382 Ga0070714_100542455
383 Ga0070705_100345470
384 Ga0070700_100009118
385 Ga0070694_100012049
386 Ga0070694_100014789
387 Ga0070708_100026797
388 Ga0070708_100043787
389 Ga0070663_100082556
390 Ga0070678_100127510
391 Ga0070662_100028708
392 Ga0070681_10127865
393 Ga0068867_100073037
394 Ga0068867_100094543
395 Ga0070685_10017346
396 Ga0070706_100372347
397 Ga0070707_100009956
398 Ga0070707_100084566
399 Ga0070707_100402908
400 Ga0070707_100509842
401 Ga0070698_100000701
402 Ga0070698_100022751
403 Ga0070698_100532376
404 Ga0070698_100730240
405 Ga0070698_100838385
406 Ga0070699_100128616
407 Ga0070699_100375005
408 Ga0070679_100064695
409 Ga0070679_100088202
410 Ga0070697_100125884
411 Ga0070697_100200331
412 Ga0070697_100223560
413 Ga0070697_100348952
414 Ga0070686_100002924
415 Ga0070695_100110698
416 Ga0070696_100387893
417 Ga0070665_100003364
418 Ga0070665_100047182
419 Ga0070665_100186151
420 Ga0070704_100019132
421 Ga0070704_100025972
422 Ga0070704_100140518
423 Ga0070664_100002017
424 Ga0068857_100065572
425 Ga0068852_100061436
426 Ga0068859_100033774
427 Ga0068864_100024940
428 Ga0068864_100025136
429 Ga0068861_100099634
430 Ga0068870_10005414
431 Ga0068863_100010753
432 Ga0068863_100155868
433 Ga0068858_100017006
434 Ga0068858_100022924
435 Ga0068860_100061374
436 Ga0068860_100100707
437 Ga0068862_100026970
438 Ga0068862_100112513
439 Ga0097621_100009216
440 Ga0097621_100396968
441 Ga0068871_100002011
442 Ga0068871_100008266
443 Ga0075428_100005253
444 Ga0075428_100060648
445 Ga0075430_100000582
446 Ga0075430_100061221
447 Ga0075431_100001060
448 Ga0075431_100007668
449 Ga0075431_100024628
450 Ga0075433_10011271
451 Ga0075434_100047619
452 Ga0075434_100212111
453 Ga0075429_100002092
454 Ga0075429_100047008
455 Ga0075429_100059031
456 Ga0075429_100143270
457 Ga0068865_100010433
458 Ga0068865_100022590
459 Ga0097620_100033775
460 Ga0099795_10009417
461 Ga0105240_10800674
462 Ga0111539_10049179
463 Ga0111539_10095828
464 Ga0105245_10028669
465 Ga0105245_10466501
466 Ga0105245_10477396
467 Ga0105245_10661435
468 Ga0105247_10002100
469 Ga0105247_10016608
470 Ga0105247_10449817
471 Ga0114129_10007683
472 Ga0114129_10391585
473 Ga0114129_10415013
474 Ga0105243_10640396
475 Ga0105243_10738467
476 Ga0105242_10100075
477 Ga0105242_10131668
478 Ga0105248_10051379
479 Ga0105248_10072423
480 Ga0105248_10073980
481 Ga0105248_10392291
482 Ga0105248_10792664
483 Ga0105237_10243010
484 Ga0105237_11072156
485 Ga0105249_10002139
486 Ga0099796_10041472
487 Ga0105246_10362792
488 Ga0157325_1000541
489 Ga0157370_10076713
490 Ga0157370_10462996
491 Ga0163162_10015033
492 Ga0163162_10390844
493 Ga0157375_10070875
494 Ga0163163_10092117
495 Ga0163163_10353283
496 Ga0157380_10014018
497 Ga0157380_10128006
498 Ga0157377_10006239
499 Ga0157379_10014830
500 Ga0157379_10048909
501 Ga0157379_10073361
502 Ga0157379_10165289
503 Ga0157376_10003274
504 Ga0157376_10103119
505 Ga0213876_10011849
506 Ga0207697_10002429
507 Ga0207653_10018989
508 Ga0207682_10002055
509 Ga0207710_10053563
510 Ga0207688_10004006
511 Ga0207680_10052854
512 Ga0207680_10076188
513 Ga0207680_10232381
514 Ga0207680_10316031
515 Ga0207647_10179799
516 Ga0207645_10004635
517 Ga0207643_10004233
518 Ga0207684_10009284
519 Ga0207695_10266235
520 Ga0207671_10429394
521 Ga0207662_10001656
522 Ga0207649_10038199
523 Ga0207652_10047200
524 Ga0207652_10060977
525 Ga0207646_10033844
526 Ga0207646_10216795
527 Ga0207646_10659917
528 Ga0207681_10459474
529 Ga0207659_10009973
530 Ga0207659_10135620
531 Ga0207687_10017723
532 Ga0207700_10029967
533 Ga0207664_10194676
534 Ga0207690_10061518
535 Ga0207706_10009679
536 Ga0207686_10004219
537 Ga0207670_10023952
538 Ga0207669_10034185
539 Ga0207669_10101249
540 Ga0207704_10045043
541 Ga0207704_10049257
542 Ga0207691_10011618
543 Ga0207711_10047724
544 Ga0207711_10048454
545 Ga0207711_10538983
546 Ga0207711_10731856
547 Ga0207689_10002645
548 Ga0207679_10051882
549 Ga0207679_10727973
550 Ga0207651_10038841
551 Ga0207651_10042484
552 Ga0207712_10014268
553 Ga0207668_10022705
554 Ga0207668_10318900
555 Ga0207658_10023501
556 Ga0207677_10079815
557 Ga0207677_10266006
558 Ga0207703_10453803
559 Ga0207678_10066546
560 Ga0207708_10009553
561 Ga0207641_10018550
562 Ga0207641_10108036
563 Ga0207648_10166249
564 Ga0207674_10021693
565 Ga0207675_100016250
566 Ga0207683_10020902
567 Ga0207683_10177210
568 Ga0209974_10073645
569 Ga0207428_10002825
570 Ga0268266_10102597
571 Ga0268266_10311299
572 Ga0268265_10046258
573 Ga0268265_10235568
574 Ga0268264_10042605
575 Ga0268264_10113478
576 Ga0268264_10674375
577 Ga0265338_10005038
578 Ga0265330_10012983
579 Ga0265340_10019072
580 Ga0316579_10005280
581 Ga0316579_10038689
582 Ga0265342_10004294
583 Ga0316576_10014906
584 Ga0316576_10015666
585 Ga0316576_10072487
586 Ga0316578_10127145
587 Ga0316578_10303792
588 Ga0307405_10115543
589 Ga0316577_10046518
590 Ga0316577_10204697
591 Ga0307416_100065127
592 Ga0307416_100680985
593 Ga0307411_10218777
594 Ga0307411_10568494
595 Ga0316583_10015951
596 Ga0316580_10005790
597 Ga0316588_1010279
598 Ga0373938_0011601
599 Ga0373953_0079043
600 Ga0373954_0278370
601 Ga0373956_0143764
602 Ga0373957_0054971
603 Ga0316574_0057523
604 Ga0316574_0067925
605 Ga0373935_0115128
606 Ga0373927_0203508
607 Ga0373937_0229597
608 Ga0373937_0480695
609 Ga0316582_0004031
610 Ga0316582_0009235
611 Ga0316584_0111537
612 Ga0316584_0135458
613 Ga0373925_0118589
614 Ga0373925_0184235
615 Ga0436364_0512108
616 Ga0436364_0925453
617 Ga0436364_1448617
618 Ga0436365_0615103
619 Ga0436365_1840370
620 Ga0436360_0010248
621 Ga0436360_0331851
622 Ga0436363_1446605
623 Ga0439441_053016
624 Ga0439450_001903
625 Ga0439435_0052678
626 Ga0495639_0064633
627 Ga0495586_0277577
628 Ga0495634_0032861
629 Ga0495670_0295823
630 Ga0495636_0180120
631 Ga0495674_0216481
632 Ga0495674_0497978
633 Ga0496100_0004790
634 Ga0496101_0000139
635 Ga0496102_0051179
636 Ga0496104_0025838
637 Ga0496104_0072426
638 Ga0496104_0403388
639 Ga0496105_0240783
640 Ga0496107_0022816
641 Ga0496112_0356923
642 Ga0496112_0445641
643 Ga0496114_0000302
644 Ga0496114_0267289
645 Ga0496114_0531463
646 Ga0496115_0232321
647 Ga0501036_0013239
648 Ga0501036_0390880
649 Ga0501036_0652423
650 Ga0501038_0083223
651 Ga0501039_0349680
652 Ga0501040_0040325
653 Ga0501040_0073704
654 Ga0501040_0076310
655 Ga0501041_0003286
656 Ga0501042_0006967
657 Ga0501042_0151629
658 Ga0501043_0116468
659 Ga0501046_0027879
660 Ga0501048_0260211
661 Ga0501071_0020459
662 Ga0501071_0454815
663 Ga0501072_0029309
664 Ga0501072_0189113
665 Ga0501074_0048328
666 Ga0501075_0000528
667 Ga0501075_0051558
668 Ga0501075_0476249
669 Ga0501076_0000391
670 Ga0501076_0408096
671 Ga0501077_0114057
672 Ga0501079_0006770
673 Ga0501079_0051795
674 Ga0501079_0505650
675 Ga0501080_0162569
676 Ga0501081_0001914
677 Ga0501283_010849
678 Ga0501035_0426360
679 Ga0501045_0024817
680 Ga0501045_0084257
681 Ga0501045_0180539
682 nmdc:mga05p37_36259_c1
683 nmdc:mga05p37_51224_c1
684 nmdc:mga05p37_728322_c1
685 nmdc:mga05p37_9572_c1
686 nmdc:mga09592_12156_c1
687 nmdc:mga09592_14194_c1
688 nmdc:mga09592_16225_c1
689 nmdc:mga0qj67_20777_c1
690 nmdc:mga0qj67_800_c1
691 nmdc:mga06r32_3398_c1
692 nmdc:mga06r32_4226_c1
693 nmdc:mga06r32_660057_c1
694 nmdc:mga08y16_50763_c1
695 nmdc:mga0n895_39177_c1
696 nmdc:mga0n895_57786_c1
697 nmdc:mga0rr50_439414_c1
698 nmdc:mga0a205_254_c1
699 Ga0495619_0428096
700 Ga0501084_0031179
701 Ga0501084_0065884
702 Ga0501082_0001012
703 Ga0501082_0547426
704 Ga0530510_0001725
705 2524469010
706 2644325837
707 2980126974
708 2980130056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

194

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9303 1 227
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9171 1 214
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.911 1 227
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9014 1 214
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8916 1 222
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9255 2 65 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.921 1 227 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9154 1 209 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9093 1 209 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9091 3 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A535SCL6-F1-model_v4 ABC transporter ATP-binding protein 0.9526 3 227 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A536I459-F1-model_v4 ABC transporter ATP-binding protein 0.9517 3 227 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A177R0E4-F1-model_v4 ABC transporter ATP-binding protein 0.9481 3 227 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A535SCL6-F1-model_v4 ABC transporter ATP-binding protein 0.9402 3 227 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1M3AP84-F1-model_v4 deleted 0.935 3 191

Map