F419573

General Info

Members Datasets Scaffolds Average Seq Length
353 255 706 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2811994878|2812352577
Length 168
Sequence ANRVVRPLSPRRSSIAVPTPDVVLADLGLPVREVMPPAVAHVPVVRAGAFVFTSGQLPIRQGELLATGRVGDALGVADGQACAQWCALNALAAIRSEIGDLGQVKRVVKVVVYVASGALFTDQALVANGASELLGRVFGDAGRHARSAVGVSALPLDAPVELELVVEI

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
66 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
86 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
92 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
93 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
94 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
95 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
96 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
97 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
100 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
180 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
181 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
182 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
183 2643221548 Streptomyces sp. Root55 Isolate Unclassified
184 2643221578 Streptomyces sp. Root63 Isolate Unclassified
185 2643221617 Nocardioides sp. Root79 Isolate Unclassified
186 2643221620 Nocardioides sp. Root240 Isolate Unclassified
187 2643221647 Streptomyces sp. Root369 Isolate Unclassified
188 2643221670 Streptomyces sp. Root431 Isolate Unclassified
189 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
190 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
191 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
192 2643221714 Streptomyces sp. Root264 Isolate Unclassified
193 2738541305 Nocardioides sp. CF167 Isolate Unclassified
194 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
195 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
196 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
197 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
198 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
199 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
200 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
201 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
202 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
203 2808606448 Streptomyces sp. 193411 Isolate Unclassified
204 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
205 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
206 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
207 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
208 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
209 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
210 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
211 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
212 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
213 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
214 2862574272 Streptomyces sp. AcE210 Isolate Nodule
215 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
216 2867428634 Streptomyces sp. RP5T Isolate Unclassified
217 2867475112 Streptomyces sp. TM32 Isolate Unclassified
218 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
219 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
220 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
221 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
222 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
223 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
224 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
225 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
226 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
227 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
228 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
229 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
230 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
231 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
232 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
233 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
234 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
235 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
236 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
237 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
238 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
239 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
240 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
241 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
242 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
243 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
244 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
245 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
246 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
247 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
248 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
249 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
250 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
251 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
252 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
253 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
254 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
255 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.77
Metatranscriptomes 0.57
Isolates 22.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0.85
Rhizoplane 2.27
Rhizosphere 80.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011054 3300001989 Bacteria 3339
2 JGI24737J22298_10020531 3300001990 Bacteria 2109
3 rootH2_10094948 3300003320 Bacteria 1582
4 Ga0070683_100046824 3300005329 Bacteria 3996
5 Ga0070680_100001364 3300005336 Bacteria 17666
6 Ga0070688_100230778 3300005365 Bacteria 1309
7 Ga0070678_101403960 3300005456 Bacteria 652
8 Ga0070678_101695415 3300005456 Bacteria 595
9 Ga0070681_10000699 3300005458 Bacteria 27854
10 Ga0070685_10438638 3300005466 Bacteria 912
11 Ga0070698_100458078 3300005471 Bacteria 1211
12 Ga0070679_100000016 3300005530 Bacteria 139454
13 Ga0070679_100107453 3300005530 Bacteria 2776
14 Ga0070684_100321150 3300005535 Bacteria 1422
15 Ga0068853_100095152 3300005539 Bacteria 2626
16 Ga0068853_100864097 3300005539 Bacteria 868
17 Ga0070665_100024533 3300005548 Bacteria 6076
18 Ga0070665_100091735 3300005548 Bacteria 3043
19 Ga0068855_100000171 3300005563 Bacteria 82971
20 Ga0068854_100055629 3300005578 Bacteria 2849
21 Ga0068856_100098078 3300005614 Bacteria 2921
22 Ga0068852_100011543 3300005616 Bacteria 6657
23 Ga0068851_10223819 3300005834 Bacteria 1058
24 Ga0075365_10091174 3300006038 Bacteria 2076
25 Ga0075365_10271509 3300006038 Bacteria 1193
26 Ga0075363_100605210 3300006048 Bacteria 657
27 Ga0075428_100549203 3300006844 Bacteria 1235
28 Ga0075430_100481416 3300006846 Bacteria 1024
29 Ga0075431_100125396 3300006847 Bacteria 2650
30 Ga0105240_10020143 3300009093 Bacteria 8903
31 Ga0114129_10461351 3300009147 Bacteria 1665
32 Ga0105243_10187456 3300009148 Bacteria 1804
33 Ga0105243_10538010 3300009148 Bacteria 1114
34 Ga0105243_10832395 3300009148 Bacteria 912
35 Ga0105243_11540902 3300009148 Bacteria 689
36 Ga0105241_10001812 3300009174 Bacteria 16220
37 Ga0105237_10086743 3300009545 Bacteria 3120
38 Ga0105237_10728886 3300009545 Bacteria 998
39 Ga0105238_10003143 3300009551 Bacteria 16478
40 Ga0105238_11150841 3300009551 Bacteria 799
41 Ga0105239_10257907 3300010375 Bacteria 1959
42 Ga0105239_11017261 3300010375 Bacteria 953
43 Ga0105246_10003160 3300011119 Bacteria 10008
44 Ga0157369_10358707 3300013105 Bacteria 1514
45 Ga0157369_11428630 3300013105 Bacteria 704
46 Ga0157374_11557189 3300013296 Bacteria 685
47 Ga0163162_10966888 3300013306 Bacteria 962
48 Ga0157372_10381027 3300013307 Bacteria 1643
49 Ga0157372_11453994 3300013307 Bacteria 790
50 Ga0157372_11678735 3300013307 Bacteria 731
51 Ga0157375_10460295 3300013308 Bacteria 1437
52 Ga0163163_10105441 3300014325 Bacteria 2844
53 Ga0163163_12138776 3300014325 Bacteria 619
54 Ga0157380_10514562 3300014326 Bacteria 1166
55 Ga0157380_10934871 3300014326 Bacteria 896
56 Ga0182008_10002106 3300014497 Bacteria 12693
57 Ga0182007_10001097 3300015262 Bacteria 14711
58 Ga0206353_10003944 3300020082 Bacteria 1134
59 Ga0206353_10352872 3300020082 Bacteria 968
60 Ga0209758_1010962 3300025297 Bacteria 5327
61 Ga0207647_10001791 3300025904 Bacteria 16449
62 Ga0207647_10042734 3300025904 Bacteria 2841
63 Ga0207654_10010818 3300025911 Bacteria 4645
64 Ga0207707_10000185 3300025912 Bacteria 65663
65 Ga0207695_10002801 3300025913 Bacteria 25358
66 Ga0207671_10000719 3300025914 Bacteria 42231
67 Ga0207671_10220805 3300025914 Bacteria 1484
68 Ga0207660_10002789 3300025917 Bacteria 11447
69 Ga0207652_10001048 3300025921 Bacteria 25276
70 Ga0207694_10001609 3300025924 Bacteria 19042
71 Ga0207687_10058738 3300025927 Bacteria 2707
72 Ga0207690_10089436 3300025932 Bacteria 2171
73 Ga0207709_10134902 3300025935 Bacteria 1688
74 Ga0207661_10565184 3300025944 Bacteria 1042
75 Ga0207661_10996676 3300025944 Bacteria 772
76 Ga0207667_10020232 3300025949 Bacteria 7406
77 Ga0207640_10006857 3300025981 Bacteria 6263
78 Ga0207640_11264376 3300025981 Bacteria 658
79 Ga0207677_10973868 3300026023 Bacteria 768
80 Ga0207639_10516783 3300026041 Bacteria 1093
81 Ga0207639_10767342 3300026041 Bacteria 897
82 Ga0207678_10639953 3300026067 Bacteria 934
83 Ga0207648_10531917 3300026089 Bacteria 1078
84 Ga0209371_1085708 3300027312 Bacteria 537
85 Ga0268265_12091143 3300028380 Bacteria 573
86 Ga0307517_10045071 3300028786 Bacteria 4644
87 Ga0268256_1040292 3300030500 Bacteria 1050
88 Ga0268256_1094871 3300030500 Bacteria 537
89 Ga0307512_10000978 3300030522 Bacteria 42035
90 Ga0316181_1213166 3300030744 Bacteria 1185
91 Ga0307408_100555394 3300031548 Bacteria 1014
92 Ga0307508_10017780 3300031616 Bacteria 6467
93 Ga0307514_10178006 3300031649 Bacteria 1376
94 Ga0307405_10653683 3300031731 Bacteria 865
95 Ga0307413_10117148 3300031824 Bacteria 1796
96 Ga0307410_11867242 3300031852 Bacteria 534
97 Ga0307406_10379274 3300031901 Bacteria 1114
98 Ga0307409_100424532 3300031995 Bacteria 1276
99 Ga0307409_100763200 3300031995 Bacteria 972
100 Ga0307416_100120469 3300032002 Bacteria 2337
101 Ga0307416_100708623 3300032002 Bacteria 1096
102 Ga0307414_11522174 3300032004 Bacteria 623
103 Ga0307411_10499564 3300032005 Bacteria 1028
104 Ga0307415_101182320 3300032126 Bacteria 720
105 Ga0316582_0063467 3300036647 Bacteria 2374
106 Ga0395900_0528276 3300037418 Bacteria 1127
107 Ga0436364_1003090 3300037853 Bacteria 5640
108 Ga0395901_0236287 3300038443 Bacteria 1907
109 Ga0395901_1311550 3300038443 Bacteria 685
110 Ga0439436_0013139 3300041404 Bacteria 2507
111 Ga0439453_0174221 3300041408 Bacteria 522
112 Ga0451791_0848984 3300041451 Bacteria 531
113 Ga0451797_1194980 3300041453 Bacteria 1175
114 Ga0451837_0362817 3300041494 Bacteria 631
115 Ga0451851_0416897 3300041507 Bacteria 706
116 Ga0451853_0772851 3300041512 Bacteria 11288
117 Ga0451853_1058755 3300041512 Bacteria 1284
118 Ga0451853_1707107 3300041512 Bacteria 914
119 Ga0450897_000948 3300042128 Bacteria 1825
120 Ga0450894_001039 3300042131 Bacteria 4251
121 Ga0450895_003181 3300042132 Bacteria 1257
122 Ga0450896_000310 3300042133 Bacteria 4606
123 Ga0450898_006327 3300042134 Bacteria 1815
124 Ga0450899_000059 3300042135 Bacteria 8921
125 Ga0450903_016371 3300042138 Bacteria 1163
126 Ga0450906_000129 3300042145 Bacteria 13330
127 Ga0450910_043417 3300042147 Bacteria 731
128 Ga0450908_002656 3300042184 Bacteria 3506
129 Ga0466969_0042190 3300044656 Bacteria 2279
130 Ga0466969_0208301 3300044656 Bacteria 891
131 Ga0466972_0006168 3300044658 Bacteria 6023
132 Ga0466972_0013582 3300044658 Bacteria 4087
133 Ga0466972_0023582 3300044658 Bacteria 3059
134 Ga0466965_0000887 3300044683 Bacteria 11435
135 Ga0466965_0131484 3300044683 Bacteria 1298
136 Ga0466966_0003462 3300044684 Bacteria 10400
137 Ga0466966_0012932 3300044684 Bacteria 5526
138 Ga0466966_0022107 3300044684 Bacteria 4176
139 Ga0466961_0011828 3300044693 Bacteria 5578
140 Ga0466961_0018522 3300044693 Bacteria 4480
141 Ga0466961_0098584 3300044693 Bacteria 1842
142 Ga0466961_0220128 3300044693 Bacteria 1170
143 Ga0466961_0533372 3300044693 Bacteria 707
144 Ga0466963_0000577 3300044694 Bacteria 17374
145 Ga0466964_0005782 3300044706 Bacteria 4604
146 Ga0466971_0001795 3300044719 Bacteria 9108
147 Ga0466971_0011227 3300044719 Bacteria 3924
148 Ga0466970_0003285 3300044765 Bacteria 7856
149 Ga0466957_0001137 3300044842 Bacteria 13793
150 Ga0466960_0079115 3300044901 Bacteria 1652
151 Ga0466959_0002692 3300045049 Bacteria 11414
152 Ga0466959_0003035 3300045049 Bacteria 10856
153 Ga0466958_0002340 3300045836 Bacteria 9473
154 Ga0466967_0023806 3300045976 Bacteria 5024
155 Ga0466967_0061835 3300045976 Bacteria 3323
156 Ga0495627_129924 3300046453 Bacteria 709
157 Ga0495603_0004443 3300046455 Bacteria 8362
158 Ga0495603_0068093 3300046455 Bacteria 2094
159 Ga0495629_0006242 3300046459 Bacteria 8845
160 Ga0495651_0376258 3300046462 Bacteria 932
161 Ga0495605_0044810 3300046474 Bacteria 2184
162 Ga0495594_0067562 3300046499 Bacteria 1984
163 Ga0495594_0196190 3300046499 Bacteria 1150
164 Ga0495608_0400378 3300046511 Bacteria 840
165 Ga0495620_0109409 3300046515 Bacteria 1096
166 Ga0495631_0114248 3300046518 Bacteria 1161
167 Ga0495648_0227550 3300046524 Bacteria 915
168 Ga0495609_0273430 3300046538 Bacteria 692
169 Ga0495622_0046334 3300046557 Bacteria 2020
170 Ga0495661_0265225 3300046665 Bacteria 871
171 Ga0495657_0268093 3300046675 Bacteria 1024
172 Ga0495613_0014977 3300046689 Bacteria 5755
173 Ga0495670_0014640 3300046691 Bacteria 3858
174 Ga0495589_0057896 3300046794 Bacteria 1905
175 Ga0495589_0156091 3300046794 Bacteria 1088
176 Ga0495589_0233383 3300046794 Bacteria 862
177 Ga0495636_0423607 3300047318 Bacteria 636
178 Ga0495636_0588339 3300047318 Bacteria 543
179 Ga0495676_0010320 3300047321 Bacteria 8473
180 Ga0495683_0036540 3300047323 Bacteria 2493
181 Ga0495614_0002530 3300048089 Bacteria 8122
182 Ga0495614_0040533 3300048089 Bacteria 1998
183 Ga0496102_0155757 3300048905 Bacteria 2148
184 Ga0496109_0103961 3300048912 Bacteria 2636
185 Ga0496110_0682813 3300048913 Bacteria 928
186 Ga0496110_1525452 3300048913 Bacteria 578
187 Ga0496111_0646200 3300048914 Bacteria 772
188 Ga0496114_0122803 3300048917 Bacteria 2235
189 Ga0501031_0286108 3300049568 Bacteria 1069
190 Ga0501032_0009985 3300049569 Bacteria 6855
191 Ga0501032_0124350 3300049569 Bacteria 1704
192 Ga0501032_0267245 3300049569 Bacteria 1108
193 Ga0501033_0016570 3300049570 Bacteria 5576
194 Ga0501033_0025052 3300049570 Bacteria 4495
195 Ga0501034_0044344 3300049571 Bacteria 4499
196 Ga0501034_0082763 3300049571 Bacteria 3211
197 Ga0501036_0016619 3300049572 Bacteria 6144
198 Ga0501036_0029357 3300049572 Bacteria 4647
199 Ga0501036_0322537 3300049572 Bacteria 1290
200 Ga0501036_1111430 3300049572 Bacteria 645
201 Ga0501037_0059298 3300049573 Bacteria 2792
202 Ga0501037_0097015 3300049573 Bacteria 2130
203 Ga0501037_0137261 3300049573 Bacteria 1751
204 Ga0501037_0376624 3300049573 Bacteria 976
205 Ga0501038_0007608 3300049574 Bacteria 9986
206 Ga0501038_0026837 3300049574 Bacteria 5128
207 Ga0501038_0076301 3300049574 Bacteria 2831
208 Ga0501038_0402076 3300049574 Bacteria 1059
209 Ga0501038_0621350 3300049574 Bacteria 816
210 Ga0501039_0004765 3300049575 Bacteria 10274
211 Ga0501039_0009132 3300049575 Bacteria 7555
212 Ga0501039_0066731 3300049575 Bacteria 2793
213 Ga0501039_0146199 3300049575 Bacteria 1857
214 Ga0501040_0388510 3300049576 Bacteria 1002
215 Ga0501040_0565905 3300049576 Bacteria 820
216 Ga0501041_0008968 3300049577 Bacteria 5885
217 Ga0501042_0039693 3300049578 Bacteria 3346
218 Ga0501043_0059628 3300049579 Bacteria 2995
219 Ga0501043_0120030 3300049579 Bacteria 2061
220 Ga0501043_0181170 3300049579 Bacteria 1641
221 Ga0501043_0410299 3300049579 Bacteria 1022
222 Ga0501046_0197011 3300049580 Bacteria 1500
223 Ga0501047_0009849 3300049581 Bacteria 9030
224 Ga0501047_0075120 3300049581 Bacteria 3252
225 Ga0501047_0119709 3300049581 Bacteria 2515
226 Ga0501047_0614844 3300049581 Bacteria 907
227 Ga0501047_0727574 3300049581 Bacteria 809
228 Ga0501048_0062377 3300049582 Bacteria 2638
229 Ga0501068_0063419 3300049584 Bacteria 2248
230 Ga0501068_0101856 3300049584 Bacteria 1780
231 Ga0501068_0645466 3300049584 Bacteria 691
232 Ga0501069_0280390 3300049585 Bacteria 975
233 Ga0501069_0485399 3300049585 Bacteria 736
234 Ga0501070_0005174 3300049586 Bacteria 11114
235 Ga0501070_0005731 3300049586 Bacteria 10590
236 Ga0501070_0075521 3300049586 Bacteria 2790
237 Ga0501071_0007609 3300049587 Bacteria 7135
238 Ga0501071_0017268 3300049587 Bacteria 4974
239 Ga0501072_0106571 3300049588 Bacteria 2229
240 Ga0501074_0005992 3300049590 Bacteria 8770
241 Ga0501074_0077951 3300049590 Bacteria 2378
242 Ga0501076_0147001 3300049592 Bacteria 1916
243 Ga0501076_0439692 3300049592 Bacteria 1074
244 Ga0501077_0201224 3300049593 Bacteria 1265
245 Ga0501080_0228507 3300049742 Bacteria 1701
246 Ga0501081_0093856 3300049743 Bacteria 2113
247 Ga0501035_0004904 3300049822 Bacteria 12695
248 Ga0501035_0008762 3300049822 Bacteria 9417
249 Ga0501035_0070743 3300049822 Bacteria 3090
250 Ga0501035_0302381 3300049822 Bacteria 1347
251 Ga0501044_0020997 3300049823 Bacteria 6972
252 Ga0501044_0065649 3300049823 Bacteria 3700
253 Ga0501044_0155378 3300049823 Bacteria 2267
254 Ga0501045_0035673 3300049824 Bacteria 3611
255 Ga0501045_0122099 3300049824 Bacteria 1934
256 Ga0501045_0470061 3300049824 Bacteria 934
257 Ga0501045_0552288 3300049824 Bacteria 854
258 nmdc:mga0yw44_1647_c2 3300050492 Bacteria 3969
259 nmdc:mga0yw44_222212_c1 3300050492 Bacteria 1252
260 nmdc:mga0yw44_262471_c1 3300050492 Bacteria 1151
261 nmdc:mga0yw44_734389_c1 3300050492 Bacteria 671
262 nmdc:mga05p37_1218879_c1 3300050507 Bacteria 775
263 nmdc:mga06r32_131359_c1 3300050510 Bacteria 2476
264 Ga0495601_0197374 3300053077 Bacteria 1315
265 Ga0500593_000074 3300053117 Bacteria 37556
266 Ga0500573_0051613 3300053140 Bacteria 2365
267 Ga0501084_0267733 3300054114 Bacteria 1442
268 Ga0501082_0019832 3300060353 Bacteria 5799
269 Ga0466962_0001677 3300061719 Bacteria 10389
270 Ga0466962_0008467 3300061719 Bacteria 4929
271 Ga0530510_0047381 3300061734 Bacteria 3106
272 Ga0530510_0756845 3300061734 Bacteria 741
273 Ga0530510_1155100 3300061734 Bacteria 593
274 2812352577 2811994878 Bacteria 5992952
275 2554257137 2554235005 Bacteria 6457341
276 2585297949 2582581312 Bacteria 7308206
277 2585305243 2582581313 Bacteria 10042643
278 2643763411 2643221548 Bacteria 8053412
279 2643900604 2643221578 Bacteria 9213798
280 2644100079 2643221617 Bacteria 5139111
281 2644117685 2643221620 Bacteria 5134593
282 2644266041 2643221647 Bacteria 10741251
283 2644390312 2643221670 Bacteria 6497041
284 2644405175 2643221673 Bacteria 9196637
285 2644437499 2643221678 Bacteria 9540101
286 2644463719 2643221682 Bacteria 6743283
287 2644628093 2643221714 Bacteria 9015452
288 2738870899 2738541305 Bacteria 4910150
289 2774395068 2773857762 Bacteria 5971770
290 2774397187 2773857762 Bacteria 5971770
291 2784589336 2784132148 Bacteria 8627943
292 2785342265 2784746763 Bacteria 9783172
293 2785370388 2784746768 Bacteria 10036182
294 2786671559 2786546132 Bacteria 10419719
295 2804846627 2802429296 Bacteria 7227771
296 2808842962 2808606359 Bacteria 9866990
297 2808921314 2808606375 Bacteria 9466072
298 2809194101 2808606439 Bacteria 5952208
299 2809232996 2808606448 Bacteria 8656184
300 2812348830 2811994878 Bacteria 5992952
301 2812357156 2811994879 Bacteria 9313447
302 2812479800 2811994917 Bacteria 7761064
303 2816422726 2816332119 Bacteria 8120218
304 2819698199 2818991463 Bacteria 7948711
305 2819741907 2818991472 Bacteria 10089953
306 2852639963 2852635781 Bacteria 8251373
307 2862180102 2862178590 Bacteria 8583590
308 2862286556 2862281513 Bacteria 9621493
309 2862294535 2862290372 Bacteria 7471434
310 2862389008 2862382967 Bacteria 10317375
311 2862578524 2862574272 Bacteria 10567477
312 2863412011 2863404153 Bacteria 9672205
313 2867433467 2867428634 Bacteria 9590268
314 2867480710 2867475112 Bacteria 6909112
315 2873155056 2873151551 Bacteria 8625867
316 2875394765 2875391855 Bacteria 7600475
317 2877680219 2877676314 Bacteria 9512378
318 2891969627 2891968417 Bacteria 5821697
319 2891973406 2891968417 Bacteria 5821697
320 2919471386 2919468124 Bacteria 9133025
321 2935392775 2935390628 Bacteria 7043367
322 2946049087 2946045630 Bacteria 8527308
323 2946068719 2946064051 Bacteria 8957905
324 2946076720 2946072368 Bacteria 8999607
325 2947228187 2947224130 Bacteria 9938529
326 2954006235 2954002825 Bacteria 9173742
327 2954385207 2954380949 Bacteria 10050426
328 2954677842 2954673503 Bacteria 9685905
329 2954686313 2954682443 Bacteria 9862841
330 2954695990 2954691527 Bacteria 10720516
331 2954711161 2954701450 Bacteria 10834262
332 2954715396 2954711539 Bacteria 10867210
333 2954725316 2954721474 Bacteria 10456478
334 2954736499 2954731030 Bacteria 10243860
335 2954744250 2954740390 Bacteria 10229294
336 2954755328 2954749733 Bacteria 10366972
337 2954763216 2954759201 Bacteria 9358192
338 2966602393 2966598605 Bacteria 7676064
339 2990048726 2990044586 Bacteria 6603797
340 2990066679 2990059506 Bacteria 9321252
341 3006328438 3006321560 Bacteria 8247479
342 3006399863 3006393351 Bacteria 6615579
343 3006492744 3006486233 Bacteria 8157040
344 3006500276 3006493962 Bacteria 8825450
345 8008566116 8008558824 Bacteria 10610750
346 8008578135 8008574985 Bacteria 7815457
347 8023628721 8023623736 Bacteria 8593882
348 8025415090 8025413630 Bacteria 7014048
349 8048410099 8048406513 Bacteria 8936924
350 8054161253 8054160619 Bacteria 7783213
351 8056453947 8056447290 Bacteria 7680491
352 8056669121 8056667051 Bacteria 6953971
353 8056833157 8056829672 Bacteria 9045328
354 JGI24739J22299_10011054
355 JGI24737J22298_10020531
356 rootH2_10094948
357 Ga0070683_100046824
358 Ga0070680_100001364
359 Ga0070688_100230778
360 Ga0070678_101403960
361 Ga0070678_101695415
362 Ga0070681_10000699
363 Ga0070685_10438638
364 Ga0070698_100458078
365 Ga0070679_100000016
366 Ga0070679_100107453
367 Ga0070684_100321150
368 Ga0068853_100095152
369 Ga0068853_100864097
370 Ga0070665_100024533
371 Ga0070665_100091735
372 Ga0068855_100000171
373 Ga0068854_100055629
374 Ga0068856_100098078
375 Ga0068852_100011543
376 Ga0068851_10223819
377 Ga0075365_10091174
378 Ga0075365_10271509
379 Ga0075363_100605210
380 Ga0075428_100549203
381 Ga0075430_100481416
382 Ga0075431_100125396
383 Ga0105240_10020143
384 Ga0114129_10461351
385 Ga0105243_10187456
386 Ga0105243_10538010
387 Ga0105243_10832395
388 Ga0105243_11540902
389 Ga0105241_10001812
390 Ga0105237_10086743
391 Ga0105237_10728886
392 Ga0105238_10003143
393 Ga0105238_11150841
394 Ga0105239_10257907
395 Ga0105239_11017261
396 Ga0105246_10003160
397 Ga0157369_10358707
398 Ga0157369_11428630
399 Ga0157374_11557189
400 Ga0163162_10966888
401 Ga0157372_10381027
402 Ga0157372_11453994
403 Ga0157372_11678735
404 Ga0157375_10460295
405 Ga0163163_10105441
406 Ga0163163_12138776
407 Ga0157380_10514562
408 Ga0157380_10934871
409 Ga0182008_10002106
410 Ga0182007_10001097
411 Ga0206353_10003944
412 Ga0206353_10352872
413 Ga0209758_1010962
414 Ga0207647_10001791
415 Ga0207647_10042734
416 Ga0207654_10010818
417 Ga0207707_10000185
418 Ga0207695_10002801
419 Ga0207671_10000719
420 Ga0207671_10220805
421 Ga0207660_10002789
422 Ga0207652_10001048
423 Ga0207694_10001609
424 Ga0207687_10058738
425 Ga0207690_10089436
426 Ga0207709_10134902
427 Ga0207661_10565184
428 Ga0207661_10996676
429 Ga0207667_10020232
430 Ga0207640_10006857
431 Ga0207640_11264376
432 Ga0207677_10973868
433 Ga0207639_10516783
434 Ga0207639_10767342
435 Ga0207678_10639953
436 Ga0207648_10531917
437 Ga0209371_1085708
438 Ga0268265_12091143
439 Ga0307517_10045071
440 Ga0268256_1040292
441 Ga0268256_1094871
442 Ga0307512_10000978
443 Ga0316181_1213166
444 Ga0307408_100555394
445 Ga0307508_10017780
446 Ga0307514_10178006
447 Ga0307405_10653683
448 Ga0307413_10117148
449 Ga0307410_11867242
450 Ga0307406_10379274
451 Ga0307409_100424532
452 Ga0307409_100763200
453 Ga0307416_100120469
454 Ga0307416_100708623
455 Ga0307414_11522174
456 Ga0307411_10499564
457 Ga0307415_101182320
458 Ga0316582_0063467
459 Ga0395900_0528276
460 Ga0436364_1003090
461 Ga0395901_0236287
462 Ga0395901_1311550
463 Ga0439436_0013139
464 Ga0439453_0174221
465 Ga0451791_0848984
466 Ga0451797_1194980
467 Ga0451837_0362817
468 Ga0451851_0416897
469 Ga0451853_0772851
470 Ga0451853_1058755
471 Ga0451853_1707107
472 Ga0450897_000948
473 Ga0450894_001039
474 Ga0450895_003181
475 Ga0450896_000310
476 Ga0450898_006327
477 Ga0450899_000059
478 Ga0450903_016371
479 Ga0450906_000129
480 Ga0450910_043417
481 Ga0450908_002656
482 Ga0466969_0042190
483 Ga0466969_0208301
484 Ga0466972_0006168
485 Ga0466972_0013582
486 Ga0466972_0023582
487 Ga0466965_0000887
488 Ga0466965_0131484
489 Ga0466966_0003462
490 Ga0466966_0012932
491 Ga0466966_0022107
492 Ga0466961_0011828
493 Ga0466961_0018522
494 Ga0466961_0098584
495 Ga0466961_0220128
496 Ga0466961_0533372
497 Ga0466963_0000577
498 Ga0466964_0005782
499 Ga0466971_0001795
500 Ga0466971_0011227
501 Ga0466970_0003285
502 Ga0466957_0001137
503 Ga0466960_0079115
504 Ga0466959_0002692
505 Ga0466959_0003035
506 Ga0466958_0002340
507 Ga0466967_0023806
508 Ga0466967_0061835
509 Ga0495627_129924
510 Ga0495603_0004443
511 Ga0495603_0068093
512 Ga0495629_0006242
513 Ga0495651_0376258
514 Ga0495605_0044810
515 Ga0495594_0067562
516 Ga0495594_0196190
517 Ga0495608_0400378
518 Ga0495620_0109409
519 Ga0495631_0114248
520 Ga0495648_0227550
521 Ga0495609_0273430
522 Ga0495622_0046334
523 Ga0495661_0265225
524 Ga0495657_0268093
525 Ga0495613_0014977
526 Ga0495670_0014640
527 Ga0495589_0057896
528 Ga0495589_0156091
529 Ga0495589_0233383
530 Ga0495636_0423607
531 Ga0495636_0588339
532 Ga0495676_0010320
533 Ga0495683_0036540
534 Ga0495614_0002530
535 Ga0495614_0040533
536 Ga0496102_0155757
537 Ga0496109_0103961
538 Ga0496110_0682813
539 Ga0496110_1525452
540 Ga0496111_0646200
541 Ga0496114_0122803
542 Ga0501031_0286108
543 Ga0501032_0009985
544 Ga0501032_0124350
545 Ga0501032_0267245
546 Ga0501033_0016570
547 Ga0501033_0025052
548 Ga0501034_0044344
549 Ga0501034_0082763
550 Ga0501036_0016619
551 Ga0501036_0029357
552 Ga0501036_0322537
553 Ga0501036_1111430
554 Ga0501037_0059298
555 Ga0501037_0097015
556 Ga0501037_0137261
557 Ga0501037_0376624
558 Ga0501038_0007608
559 Ga0501038_0026837
560 Ga0501038_0076301
561 Ga0501038_0402076
562 Ga0501038_0621350
563 Ga0501039_0004765
564 Ga0501039_0009132
565 Ga0501039_0066731
566 Ga0501039_0146199
567 Ga0501040_0388510
568 Ga0501040_0565905
569 Ga0501041_0008968
570 Ga0501042_0039693
571 Ga0501043_0059628
572 Ga0501043_0120030
573 Ga0501043_0181170
574 Ga0501043_0410299
575 Ga0501046_0197011
576 Ga0501047_0009849
577 Ga0501047_0075120
578 Ga0501047_0119709
579 Ga0501047_0614844
580 Ga0501047_0727574
581 Ga0501048_0062377
582 Ga0501068_0063419
583 Ga0501068_0101856
584 Ga0501068_0645466
585 Ga0501069_0280390
586 Ga0501069_0485399
587 Ga0501070_0005174
588 Ga0501070_0005731
589 Ga0501070_0075521
590 Ga0501071_0007609
591 Ga0501071_0017268
592 Ga0501072_0106571
593 Ga0501074_0005992
594 Ga0501074_0077951
595 Ga0501076_0147001
596 Ga0501076_0439692
597 Ga0501077_0201224
598 Ga0501080_0228507
599 Ga0501081_0093856
600 Ga0501035_0004904
601 Ga0501035_0008762
602 Ga0501035_0070743
603 Ga0501035_0302381
604 Ga0501044_0020997
605 Ga0501044_0065649
606 Ga0501044_0155378
607 Ga0501045_0035673
608 Ga0501045_0122099
609 Ga0501045_0470061
610 Ga0501045_0552288
611 nmdc:mga0yw44_1647_c2
612 nmdc:mga0yw44_222212_c1
613 nmdc:mga0yw44_262471_c1
614 nmdc:mga0yw44_734389_c1
615 nmdc:mga05p37_1218879_c1
616 nmdc:mga06r32_131359_c1
617 Ga0495601_0197374
618 Ga0500593_000074
619 Ga0500573_0051613
620 Ga0501084_0267733
621 Ga0501082_0019832
622 Ga0466962_0001677
623 Ga0466962_0008467
624 Ga0530510_0047381
625 Ga0530510_0756845
626 Ga0530510_1155100
627 2812352577
628 2554257137
629 2585297949
630 2585305243
631 2643763411
632 2643900604
633 2644100079
634 2644117685
635 2644266041
636 2644390312
637 2644405175
638 2644437499
639 2644463719
640 2644628093
641 2738870899
642 2774395068
643 2774397187
644 2784589336
645 2785342265
646 2785370388
647 2786671559
648 2804846627
649 2808842962
650 2808921314
651 2809194101
652 2809232996
653 2812348830
654 2812357156
655 2812479800
656 2816422726
657 2819698199
658 2819741907
659 2852639963
660 2862180102
661 2862286556
662 2862294535
663 2862389008
664 2862578524
665 2863412011
666 2867433467
667 2867480710
668 2873155056
669 2875394765
670 2877680219
671 2891969627
672 2891973406
673 2919471386
674 2935392775
675 2946049087
676 2946068719
677 2946076720
678 2947228187
679 2954006235
680 2954385207
681 2954677842
682 2954686313
683 2954695990
684 2954711161
685 2954715396
686 2954725316
687 2954736499
688 2954744250
689 2954755328
690 2954763216
691 2966602393
692 2990048726
693 2990066679
694 3006328438
695 3006399863
696 3006492744
697 3006500276
698 8008566116
699 8008578135
700 8023628721
701 8025415090
702 8048410099
703 8054161253
704 8056453947
705 8056669121
706 8056833157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

32

168

0.92

PF14588

YjgF_endoribonc

YjgF/chorismate_mutase-like, putative endoribonuclease

21

168

0.84

Map