F419553

General Info

Members Datasets Scaffolds Average Seq Length
353 228 706 139

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_140577_c1|nmdc:mga06r32_140577_c1_1877_2374
Length 165
Sequence MRQLSRQDDASSWLLVAENRWELCMPMSTLTPVLALIVWTFVMWFWMYATRIPAMRAAGIDARLVKRKDDIDALPVKVKQVADNYNHLHEQPTIFYALAIYSHLAGTADPTNVTLAWVYVGLRVVHSLIQGTINFTPVRFVVFALASLTLMTMTVRNVQALFPAG

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
174 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
210 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
211 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
214 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
227 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
228 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 1.13
Rhizosphere 95.75
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_140577_c1 3300050510 Bacteria 2390
2 MRS1b_contig_1148178 2162886011 Bacteria 930
3 JGI25405J52794_10006069 3300003911 Bacteria 2201
4 Ga0065715_10099802 3300005293 Bacteria 3370
5 Ga0070676_10271896 3300005328 Bacteria 1138
6 Ga0070683_100554579 3300005329 Bacteria 1099
7 Ga0070690_100002014 3300005330 Bacteria 10828
8 Ga0070670_100928792 3300005331 Bacteria 790
9 Ga0068869_100000378 3300005334 Bacteria 24145
10 Ga0068869_100880553 3300005334 Bacteria 774
11 Ga0068869_100942658 3300005334 Bacteria 749
12 Ga0070666_10103332 3300005335 Bacteria 1966
13 Ga0070680_100243020 3300005336 Bacteria 1522
14 Ga0070682_102045885 3300005337 Bacteria 504
15 Ga0068868_100429461 3300005338 Bacteria 1145
16 Ga0070689_100003599 3300005340 Bacteria 10326
17 Ga0070687_100026225 3300005343 Bacteria 2804
18 Ga0070692_10134770 3300005345 Bacteria 1392
19 Ga0070668_100243692 3300005347 Bacteria 1490
20 Ga0070668_102113373 3300005347 Unclassified 520
21 Ga0070669_100037211 3300005353 Bacteria 3530
22 Ga0070669_100142326 3300005353 Bacteria 1850
23 Ga0070669_100153710 3300005353 Bacteria 1783
24 Ga0070669_100409800 3300005353 Bacteria 1110
25 Ga0070675_100000760 3300005354 Bacteria 22527
26 Ga0070675_100661780 3300005354 Bacteria 950
27 Ga0070675_100776833 3300005354 Bacteria 875
28 Ga0070671_100044333 3300005355 Bacteria 3696
29 Ga0070674_100064947 3300005356 Bacteria 2560
30 Ga0070673_100001835 3300005364 Bacteria 12700
31 Ga0070673_100491985 3300005364 Bacteria 1108
32 Ga0070688_100008922 3300005365 Bacteria 5460
33 Ga0070659_100049940 3300005366 Bacteria 3290
34 Ga0070659_100106810 3300005366 Bacteria 2257
35 Ga0070667_100038117 3300005367 Bacteria 4030
36 Ga0070667_100524912 3300005367 Bacteria 1087
37 Ga0070701_10061979 3300005438 Bacteria 1974
38 Ga0070705_100055722 3300005440 Bacteria 2325
39 Ga0070705_101536098 3300005440 Bacteria 559
40 Ga0070694_100395388 3300005444 Bacteria 1081
41 Ga0070663_100166412 3300005455 Bacteria 1701
42 Ga0070678_100116293 3300005456 Bacteria 2101
43 Ga0070678_101052323 3300005456 Bacteria 750
44 Ga0070662_100002577 3300005457 Bacteria 11172
45 Ga0070681_10843518 3300005458 Bacteria 834
46 Ga0068867_100005822 3300005459 Bacteria 8741
47 Ga0068867_100207522 3300005459 Bacteria 1572
48 Ga0068867_101184353 3300005459 Bacteria 701
49 Ga0070685_10003032 3300005466 Bacteria 8563
50 Ga0070685_10087295 3300005466 Bacteria 1882
51 Ga0070706_100279088 3300005467 Unclassified 1559
52 Ga0070698_100375542 3300005471 Bacteria 1354
53 Ga0070679_100141295 3300005530 Bacteria 2387
54 Ga0070684_100047222 3300005535 Bacteria 3731
55 Ga0070672_100053198 3300005543 Bacteria 3165
56 Ga0070672_100611706 3300005543 Bacteria 950
57 Ga0070686_100028501 3300005544 Bacteria 3387
58 Ga0070695_100877751 3300005545 Bacteria 723
59 Ga0070696_100222869 3300005546 Bacteria 1416
60 Ga0070704_100568392 3300005549 Bacteria 993
61 Ga0070704_100918624 3300005549 Bacteria 788
62 Ga0068855_100124094 3300005563 Bacteria 2954
63 Ga0070664_100006616 3300005564 Bacteria 9345
64 Ga0070664_102092238 3300005564 Bacteria 537
65 Ga0068857_100104009 3300005577 Bacteria 2550
66 Ga0070702_100002546 3300005615 Bacteria 7915
67 Ga0068852_102408446 3300005616 Bacteria 547
68 Ga0068859_100094922 3300005617 Bacteria 3035
69 Ga0068864_100004502 3300005618 Bacteria 11460
70 Ga0068866_10415100 3300005718 Bacteria 872
71 Ga0068861_100002446 3300005719 Bacteria 12107
72 Ga0068861_100040026 3300005719 Bacteria 3502
73 Ga0068851_10281448 3300005834 Bacteria 951
74 Ga0068870_10005428 3300005840 Bacteria 5568
75 Ga0068870_10220343 3300005840 Bacteria 1161
76 Ga0068863_100005083 3300005841 Bacteria 12971
77 Ga0068858_100357257 3300005842 Bacteria 1400
78 Ga0068860_100024109 3300005843 Bacteria 5881
79 Ga0068862_100000630 3300005844 Bacteria 36505
80 Ga0068862_100002696 3300005844 Bacteria 15607
81 Ga0068862_100212311 3300005844 Unclassified 1749
82 Ga0068862_101911310 3300005844 Bacteria 603
83 Ga0081455_10000040 3300005937 Bacteria 134280
84 Ga0081455_10327148 3300005937 Bacteria 1089
85 Ga0097621_100251978 3300006237 Bacteria 1546
86 Ga0068871_100044368 3300006358 Bacteria 3575
87 Ga0075428_100002055 3300006844 Bacteria 21704
88 Ga0075428_100010951 3300006844 Bacteria 10086
89 Ga0075428_100609877 3300006844 Bacteria 1165
90 Ga0075428_100739118 3300006844 Bacteria 1047
91 Ga0075428_102534637 3300006844 Unclassified 525
92 Ga0075430_100001633 3300006846 Bacteria 18310
93 Ga0075430_100018166 3300006846 Bacteria 5986
94 Ga0075430_100079966 3300006846 Bacteria 2738
95 Ga0075430_100107719 3300006846 Bacteria 2325
96 Ga0075431_100000443 3300006847 Bacteria 33960
97 Ga0075431_100010859 3300006847 Bacteria 9162
98 Ga0075431_100024312 3300006847 Bacteria 6206
99 Ga0075431_100179955 3300006847 Bacteria 2170
100 Ga0075431_100307216 3300006847 Bacteria 1601
101 Ga0075431_100335583 3300006847 Bacteria 1522
102 Ga0075433_10341481 3300006852 Bacteria 1324
103 Ga0075429_100054715 3300006880 Bacteria 3471
104 Ga0075429_100062488 3300006880 Bacteria 3244
105 Ga0075429_100247874 3300006880 Bacteria 1560
106 Ga0075429_100378364 3300006880 Bacteria 1239
107 Ga0075429_101450295 3300006880 Bacteria 597
108 Ga0068865_100519720 3300006881 Bacteria 995
109 Ga0068865_101033170 3300006881 Bacteria 721
110 Ga0097620_100094913 3300006931 Bacteria 3035
111 Ga0111539_10045080 3300009094 Bacteria 5280
112 Ga0111539_10047845 3300009094 Bacteria 5110
113 Ga0111539_10436835 3300009094 Bacteria 1524
114 Ga0111539_10983737 3300009094 Bacteria 981
115 Ga0114129_10020480 3300009147 Bacteria 9408
116 Ga0114129_10043331 3300009147 Bacteria 6331
117 Ga0114129_10950253 3300009147 Unclassified 1086
118 Ga0105243_10196015 3300009148 Bacteria 1768
119 Ga0105243_10209627 3300009148 Bacteria 1715
120 Ga0105241_10978924 3300009174 Bacteria 790
121 Ga0105242_10423614 3300009176 Bacteria 1248
122 Ga0105248_10001114 3300009177 Bacteria 29862
123 Ga0105248_10068099 3300009177 Bacteria 3997
124 Ga0105249_10021011 3300009553 Bacteria 5842
125 Ga0105249_10058083 3300009553 Bacteria 3546
126 Ga0105249_12061309 3300009553 Bacteria 643
127 Ga0157378_10294924 3300013297 Bacteria 1567
128 Ga0163162_10122077 3300013306 Bacteria 2710
129 Ga0163162_11103677 3300013306 Bacteria 899
130 Ga0157375_10067623 3300013308 Bacteria 3571
131 Ga0157375_11086972 3300013308 Bacteria 936
132 Ga0163163_10001040 3300014325 Bacteria 23538
133 Ga0157380_10231817 3300014326 Bacteria 1659
134 Ga0157380_11250583 3300014326 Bacteria 788
135 Ga0157377_10036900 3300014745 Bacteria 2690
136 Ga0157379_10402130 3300014968 Bacteria 1259
137 Ga0163161_10017842 3300017792 Bacteria 4972
138 Ga0163161_10127357 3300017792 Bacteria 1918
139 Ga0213876_10000525 3300021384 Bacteria 29265
140 Ga0207688_10013686 3300025901 Bacteria 4410
141 Ga0207688_10325087 3300025901 Bacteria 944
142 Ga0207680_10009010 3300025903 Bacteria 4927
143 Ga0207680_10094963 3300025903 Bacteria 1905
144 Ga0207645_10006199 3300025907 Bacteria 8589
145 Ga0207645_10039400 3300025907 Bacteria 3028
146 Ga0207643_10226046 3300025908 Bacteria 1147
147 Ga0207707_10536290 3300025912 Bacteria 995
148 Ga0207660_10371773 3300025917 Bacteria 1148
149 Ga0207662_10038268 3300025918 Bacteria 2810
150 Ga0207652_10741700 3300025921 Bacteria 874
151 Ga0207681_10015946 3300025923 Bacteria 4692
152 Ga0207681_10034127 3300025923 Bacteria 3343
153 Ga0207681_10315600 3300025923 Bacteria 1241
154 Ga0207650_10067655 3300025925 Bacteria 2680
155 Ga0207650_11461517 3300025925 Bacteria 581
156 Ga0207659_10004221 3300025926 Bacteria 8682
157 Ga0207659_11565385 3300025926 Bacteria 563
158 Ga0207687_10987789 3300025927 Bacteria 722
159 Ga0207644_10081016 3300025931 Bacteria 2398
160 Ga0207690_10052704 3300025932 Bacteria 2726
161 Ga0207690_10234691 3300025932 Bacteria 1410
162 Ga0207706_10016872 3300025933 Bacteria 6587
163 Ga0207706_10019599 3300025933 Bacteria 6086
164 Ga0207686_10763662 3300025934 Bacteria 773
165 Ga0207670_10006095 3300025936 Bacteria 6663
166 Ga0207691_10068015 3300025940 Bacteria 3219
167 Ga0207711_10028166 3300025941 Bacteria 4726
168 Ga0207711_10071105 3300025941 Bacteria 3018
169 Ga0207689_10011887 3300025942 Bacteria 7458
170 Ga0207689_10453707 3300025942 Bacteria 1072
171 Ga0207679_10007211 3300025945 Bacteria 7043
172 Ga0207667_10208447 3300025949 Bacteria 2004
173 Ga0207651_10028978 3300025960 Bacteria 3501
174 Ga0207712_10002239 3300025961 Bacteria 12597
175 Ga0207712_10643717 3300025961 Bacteria 921
176 Ga0207668_10006268 3300025972 Bacteria 7029
177 Ga0207668_10072206 3300025972 Bacteria 2468
178 Ga0207668_10225800 3300025972 Bacteria 1507
179 Ga0207668_10709095 3300025972 Unclassified 885
180 Ga0207640_10320958 3300025981 Bacteria 1233
181 Ga0207658_10029173 3300025986 Bacteria 3893
182 Ga0207658_10131822 3300025986 Bacteria 2009
183 Ga0207658_11267520 3300025986 Bacteria 674
184 Ga0207677_10245353 3300026023 Bacteria 1451
185 Ga0207677_10397818 3300026023 Bacteria 1167
186 Ga0207703_10231359 3300026035 Bacteria 1657
187 Ga0207703_12159521 3300026035 Unclassified 533
188 Ga0207678_10974903 3300026067 Bacteria 750
189 Ga0207641_10088180 3300026088 Bacteria 2708
190 Ga0207648_10007826 3300026089 Bacteria 10434
191 Ga0207648_10208877 3300026089 Bacteria 1733
192 Ga0207676_10080923 3300026095 Bacteria 2637
193 Ga0207676_10178370 3300026095 Bacteria 1858
194 Ga0207674_10018256 3300026116 Bacteria 7628
195 Ga0207675_100008951 3300026118 Bacteria 9392
196 Ga0207675_101082925 3300026118 Bacteria 821
197 Ga0207683_10038169 3300026121 Bacteria 4184
198 Ga0207698_10836749 3300026142 Bacteria 924
199 Ga0207428_10033746 3300027907 Bacteria 4198
200 Ga0207428_10043807 3300027907 Bacteria 3613
201 Ga0207428_10948773 3300027907 Bacteria 606
202 Ga0268266_10086062 3300028379 Bacteria 2747
203 Ga0268265_10003663 3300028380 Bacteria 10955
204 Ga0268265_10014143 3300028380 Bacteria 5438
205 Ga0268265_10244830 3300028380 Unclassified 1584
206 Ga0268265_10696719 3300028380 Bacteria 981
207 Ga0268264_10030340 3300028381 Bacteria 4431
208 Ga0265334_10149404 3300028573 Bacteria 824
209 Ga0265318_10000577 3300028577 Bacteria 25745
210 Ga0265338_10242658 3300028800 Bacteria 1333
211 Ga0265328_10083776 3300031239 Bacteria 1176
212 Ga0265325_10064165 3300031241 Bacteria 1857
213 Ga0265329_10102856 3300031242 Bacteria 910
214 Ga0265340_10038458 3300031247 Bacteria 2366
215 Ga0265339_10023326 3300031249 Bacteria 3579
216 Ga0265339_10026768 3300031249 Bacteria 3300
217 Ga0265331_10056181 3300031250 Bacteria 1870
218 Ga0265331_10065772 3300031250 Bacteria 1704
219 Ga0265316_10054050 3300031344 Bacteria 3145
220 Ga0307408_100341013 3300031548 Bacteria 1268
221 Ga0307408_100783555 3300031548 Bacteria 864
222 Ga0316575_10055545 3300031665 Bacteria 1577
223 Ga0316579_10404285 3300031691 Bacteria 660
224 Ga0265314_10005842 3300031711 Bacteria 11019
225 Ga0265314_10200988 3300031711 Bacteria 1178
226 Ga0265342_10308193 3300031712 Bacteria 832
227 Ga0265342_10402136 3300031712 Bacteria 707
228 Ga0316576_10156052 3300031727 Bacteria 1720
229 Ga0316578_10023980 3300031728 Bacteria 3419
230 Ga0307405_10054757 3300031731 Unclassified 2492
231 Ga0307405_10210140 3300031731 Bacteria 1420
232 Ga0316577_10016175 3300031733 Bacteria 4107
233 Ga0307413_10065186 3300031824 Bacteria 2267
234 Ga0307413_10117595 3300031824 Bacteria 1793
235 Ga0307413_12182638 3300031824 Bacteria 502
236 Ga0307410_10878594 3300031852 Bacteria 767
237 Ga0307406_10097038 3300031901 Bacteria 1998
238 Ga0307406_10378770 3300031901 Bacteria 1115
239 Ga0307406_11299542 3300031901 Bacteria 635
240 Ga0307412_10111422 3300031911 Bacteria 1955
241 Ga0307412_10207306 3300031911 Bacteria 1493
242 Ga0307416_102208945 3300032002 Bacteria 651
243 Ga0307414_10306174 3300032004 Bacteria 1346
244 Ga0307411_10276407 3300032005 Bacteria 1334
245 Ga0307411_10953781 3300032005 Bacteria 765
246 Ga0307415_101535104 3300032126 Bacteria 638
247 Ga0316580_10024071 3300032139 Bacteria 1881
248 Ga0373938_0088973 3300034957 Bacteria 762
249 Ga0373928_0041343 3300035084 Bacteria 1060
250 Ga0373951_0183494 3300035091 Bacteria 602
251 Ga0373939_0177557 3300035114 Bacteria 792
252 Ga0373941_0193670 3300035115 Bacteria 769
253 Ga0373962_0062822 3300035242 Bacteria 1094
254 Ga0316574_0039418 3300035398 Bacteria 2904
255 Ga0373931_0167625 3300035691 Bacteria 1292
256 Ga0316582_0033570 3300036647 Bacteria 3153
257 Ga0316584_0049478 3300036712 Bacteria 3141
258 Ga0316584_0122388 3300036712 Bacteria 1944
259 Ga0436365_0616688 3300039437 Bacteria 20979
260 Ga0439461_0077504 3300041410 Bacteria 780
261 Ga0451798_0759273 3300041458 Bacteria 875
262 Ga0451807_0736485 3300041486 Bacteria 593
263 Ga0451847_0733357 3300041503 Bacteria 624
264 Ga0451853_1491001 3300041512 Bacteria 754
265 Ga0450912_018705 3300042116 Bacteria 656
266 Ga0450893_0015587 3300042532 Bacteria 1282
267 Ga0451577_0029788 3300042876 Bacteria 4933
268 Ga0451577_0099625 3300042876 Bacteria 2596
269 Ga0451577_0195917 3300042876 Unclassified 1823
270 Ga0451577_1015265 3300042876 Bacteria 744
271 Ga0439440_0155797 3300042993 Bacteria 657
272 Ga0466973_0212763 3300044659 Bacteria 1417
273 Ga0453683_0101753 3300044673 Bacteria 1804
274 Ga0453684_0019959 3300044712 Bacteria 10159
275 Ga0453684_0124724 3300044712 Bacteria 3102
276 Ga0453684_1340931 3300044712 Bacteria 744
277 Ga0466968_0070571 3300044735 Unclassified 1520
278 Ga0466960_0016978 3300044901 Bacteria 3167
279 Ga0451576_0010471 3300045051 Bacteria 10632
280 Ga0451576_0024465 3300045051 Bacteria 6523
281 Ga0451576_0044936 3300045051 Bacteria 4654
282 Ga0495603_0539712 3300046455 Bacteria 668
283 Ga0495603_0685719 3300046455 Unclassified 586
284 Ga0495580_0108461 3300046472 Bacteria 1928
285 Ga0495630_0173916 3300046517 Bacteria 1641
286 Ga0495666_0238483 3300046526 Bacteria 830
287 Ga0495611_0203118 3300046648 Bacteria 924
288 Ga0495658_0439652 3300046683 Bacteria 833
289 Ga0495581_0110215 3300047315 Bacteria 1601
290 Ga0495581_0693877 3300047315 Bacteria 587
291 Ga0495672_0182713 3300047320 Unclassified 1061
292 Ga0495680_0021476 3300047322 Bacteria 5403
293 Ga0495680_0575660 3300047322 Bacteria 756
294 Ga0495686_0000013 3300047472 Bacteria 489656
295 Ga0495686_0073828 3300047472 Bacteria 2094
296 Ga0495686_0307358 3300047472 Bacteria 873
297 Ga0496102_0768850 3300048905 Bacteria 886
298 Ga0496113_0310175 3300048916 Bacteria 1264
299 Ga0501298_006850 3300049521 Bacteria 1876
300 Ga0501299_042430 3300049522 Unclassified 917
301 Ga0501032_0000435 3300049569 Bacteria 34412
302 Ga0501034_0155333 3300049571 Bacteria 2262
303 Ga0501036_0123874 3300049572 Bacteria 2183
304 Ga0501036_1120816 3300049572 Bacteria 642
305 Ga0501037_0014104 3300049573 Bacteria 5887
306 Ga0501043_0133244 3300049579 Bacteria 1947
307 Ga0501046_0018931 3300049580 Bacteria 5719
308 Ga0501047_0000256 3300049581 Bacteria 62551
309 Ga0501048_0229845 3300049582 Bacteria 1316
310 Ga0501067_0000046 3300049583 Bacteria 73150
311 Ga0501068_0006837 3300049584 Bacteria 6305
312 Ga0501071_1002911 3300049587 Bacteria 645
313 Ga0501073_0000019 3300049589 Bacteria 144300
314 Ga0501077_0000035 3300049593 Bacteria 68535
315 Ga0501216_059680 3300049660 Bacteria 767
316 Ga0501235_115282 3300049669 Bacteria 668
317 Ga0501236_075008 3300049670 Bacteria 625
318 Ga0501255_045284 3300049684 Bacteria 658
319 Ga0501259_060357 3300049688 Bacteria 791
320 Ga0501080_0000668 3300049742 Bacteria 27299
321 Ga0501270_089311 3300049767 Unclassified 626
322 Ga0501283_003696 3300049779 Bacteria 2037
323 Ga0501044_0009685 3300049823 Bacteria 10480
324 nmdc:mga05p37_2639_c1 3300050507 Bacteria 20877
325 nmdc:mga05p37_355231_c2 3300050507 Bacteria 1248
326 nmdc:mga05p37_99253_c1 3300050507 Bacteria 3586
327 nmdc:mga09592_213780_c1 3300050508 Bacteria 1671
328 nmdc:mga09592_2742_c1 3300050508 Bacteria 14233
329 nmdc:mga09592_299737_c1 3300050508 Bacteria 1394
330 nmdc:mga09592_359600_c1 3300050508 Bacteria 1260
331 nmdc:mga0qj67_110225_c1 3300050509 Bacteria 2222
332 nmdc:mga0qj67_1113726_c1 3300050509 Bacteria 616
333 nmdc:mga0qj67_17529_c2 3300050509 Bacteria 4758
334 nmdc:mga0qj67_45456_c1 3300050509 Bacteria 3465
335 nmdc:mga0qj67_60841_c1 3300050509 Bacteria 2998
336 nmdc:mga0qj67_854892_c1 3300050509 Bacteria 718
337 nmdc:mga06r32_2499_c1 3300050510 Bacteria 16450
338 nmdc:mga06r32_3865_c1 3300050510 Bacteria 13408
339 nmdc:mga06r32_409250_c1 3300050510 Unclassified 1338
340 nmdc:mga06r32_680604_c1 3300050510 Bacteria 995
341 nmdc:mga08y16_30406_c1 3300050511 Bacteria 5685
342 nmdc:mga08y16_360724_c1 3300050511 Bacteria 1492
343 nmdc:mga08y16_69044_c1 3300050511 Bacteria 3685
344 nmdc:mga08y16_9529_c1 3300050511 Bacteria 10191
345 nmdc:mga0n895_472796_c1 3300050512 Bacteria 1264
346 nmdc:mga0a205_319783_c1 3300050515 Bacteria 1423
347 Ga0500595_037481 3300053119 Bacteria 1581
348 Ga0500658_0314479 3300053134 Bacteria 720
349 Ga0500588_0007588 3300053146 Bacteria 2505
350 Ga0501082_1185578 3300060353 Bacteria 667
351 2643731533 2643221541 Bacteria 5498788
352 2644042139 2643221606 Bacteria 5588032
353 2644394218 2643221671 Bacteria 5496681
354 nmdc:mga06r32_140577_c1
355 MRS1b_contig_1148178
356 JGI25405J52794_10006069
357 Ga0065715_10099802
358 Ga0070676_10271896
359 Ga0070683_100554579
360 Ga0070690_100002014
361 Ga0070670_100928792
362 Ga0068869_100000378
363 Ga0068869_100880553
364 Ga0068869_100942658
365 Ga0070666_10103332
366 Ga0070680_100243020
367 Ga0070682_102045885
368 Ga0068868_100429461
369 Ga0070689_100003599
370 Ga0070687_100026225
371 Ga0070692_10134770
372 Ga0070668_100243692
373 Ga0070668_102113373
374 Ga0070669_100037211
375 Ga0070669_100142326
376 Ga0070669_100153710
377 Ga0070669_100409800
378 Ga0070675_100000760
379 Ga0070675_100661780
380 Ga0070675_100776833
381 Ga0070671_100044333
382 Ga0070674_100064947
383 Ga0070673_100001835
384 Ga0070673_100491985
385 Ga0070688_100008922
386 Ga0070659_100049940
387 Ga0070659_100106810
388 Ga0070667_100038117
389 Ga0070667_100524912
390 Ga0070701_10061979
391 Ga0070705_100055722
392 Ga0070705_101536098
393 Ga0070694_100395388
394 Ga0070663_100166412
395 Ga0070678_100116293
396 Ga0070678_101052323
397 Ga0070662_100002577
398 Ga0070681_10843518
399 Ga0068867_100005822
400 Ga0068867_100207522
401 Ga0068867_101184353
402 Ga0070685_10003032
403 Ga0070685_10087295
404 Ga0070706_100279088
405 Ga0070698_100375542
406 Ga0070679_100141295
407 Ga0070684_100047222
408 Ga0070672_100053198
409 Ga0070672_100611706
410 Ga0070686_100028501
411 Ga0070695_100877751
412 Ga0070696_100222869
413 Ga0070704_100568392
414 Ga0070704_100918624
415 Ga0068855_100124094
416 Ga0070664_100006616
417 Ga0070664_102092238
418 Ga0068857_100104009
419 Ga0070702_100002546
420 Ga0068852_102408446
421 Ga0068859_100094922
422 Ga0068864_100004502
423 Ga0068866_10415100
424 Ga0068861_100002446
425 Ga0068861_100040026
426 Ga0068851_10281448
427 Ga0068870_10005428
428 Ga0068870_10220343
429 Ga0068863_100005083
430 Ga0068858_100357257
431 Ga0068860_100024109
432 Ga0068862_100000630
433 Ga0068862_100002696
434 Ga0068862_100212311
435 Ga0068862_101911310
436 Ga0081455_10000040
437 Ga0081455_10327148
438 Ga0097621_100251978
439 Ga0068871_100044368
440 Ga0075428_100002055
441 Ga0075428_100010951
442 Ga0075428_100609877
443 Ga0075428_100739118
444 Ga0075428_102534637
445 Ga0075430_100001633
446 Ga0075430_100018166
447 Ga0075430_100079966
448 Ga0075430_100107719
449 Ga0075431_100000443
450 Ga0075431_100010859
451 Ga0075431_100024312
452 Ga0075431_100179955
453 Ga0075431_100307216
454 Ga0075431_100335583
455 Ga0075433_10341481
456 Ga0075429_100054715
457 Ga0075429_100062488
458 Ga0075429_100247874
459 Ga0075429_100378364
460 Ga0075429_101450295
461 Ga0068865_100519720
462 Ga0068865_101033170
463 Ga0097620_100094913
464 Ga0111539_10045080
465 Ga0111539_10047845
466 Ga0111539_10436835
467 Ga0111539_10983737
468 Ga0114129_10020480
469 Ga0114129_10043331
470 Ga0114129_10950253
471 Ga0105243_10196015
472 Ga0105243_10209627
473 Ga0105241_10978924
474 Ga0105242_10423614
475 Ga0105248_10001114
476 Ga0105248_10068099
477 Ga0105249_10021011
478 Ga0105249_10058083
479 Ga0105249_12061309
480 Ga0157378_10294924
481 Ga0163162_10122077
482 Ga0163162_11103677
483 Ga0157375_10067623
484 Ga0157375_11086972
485 Ga0163163_10001040
486 Ga0157380_10231817
487 Ga0157380_11250583
488 Ga0157377_10036900
489 Ga0157379_10402130
490 Ga0163161_10017842
491 Ga0163161_10127357
492 Ga0213876_10000525
493 Ga0207688_10013686
494 Ga0207688_10325087
495 Ga0207680_10009010
496 Ga0207680_10094963
497 Ga0207645_10006199
498 Ga0207645_10039400
499 Ga0207643_10226046
500 Ga0207707_10536290
501 Ga0207660_10371773
502 Ga0207662_10038268
503 Ga0207652_10741700
504 Ga0207681_10015946
505 Ga0207681_10034127
506 Ga0207681_10315600
507 Ga0207650_10067655
508 Ga0207650_11461517
509 Ga0207659_10004221
510 Ga0207659_11565385
511 Ga0207687_10987789
512 Ga0207644_10081016
513 Ga0207690_10052704
514 Ga0207690_10234691
515 Ga0207706_10016872
516 Ga0207706_10019599
517 Ga0207686_10763662
518 Ga0207670_10006095
519 Ga0207691_10068015
520 Ga0207711_10028166
521 Ga0207711_10071105
522 Ga0207689_10011887
523 Ga0207689_10453707
524 Ga0207679_10007211
525 Ga0207667_10208447
526 Ga0207651_10028978
527 Ga0207712_10002239
528 Ga0207712_10643717
529 Ga0207668_10006268
530 Ga0207668_10072206
531 Ga0207668_10225800
532 Ga0207668_10709095
533 Ga0207640_10320958
534 Ga0207658_10029173
535 Ga0207658_10131822
536 Ga0207658_11267520
537 Ga0207677_10245353
538 Ga0207677_10397818
539 Ga0207703_10231359
540 Ga0207703_12159521
541 Ga0207678_10974903
542 Ga0207641_10088180
543 Ga0207648_10007826
544 Ga0207648_10208877
545 Ga0207676_10080923
546 Ga0207676_10178370
547 Ga0207674_10018256
548 Ga0207675_100008951
549 Ga0207675_101082925
550 Ga0207683_10038169
551 Ga0207698_10836749
552 Ga0207428_10033746
553 Ga0207428_10043807
554 Ga0207428_10948773
555 Ga0268266_10086062
556 Ga0268265_10003663
557 Ga0268265_10014143
558 Ga0268265_10244830
559 Ga0268265_10696719
560 Ga0268264_10030340
561 Ga0265334_10149404
562 Ga0265318_10000577
563 Ga0265338_10242658
564 Ga0265328_10083776
565 Ga0265325_10064165
566 Ga0265329_10102856
567 Ga0265340_10038458
568 Ga0265339_10023326
569 Ga0265339_10026768
570 Ga0265331_10056181
571 Ga0265331_10065772
572 Ga0265316_10054050
573 Ga0307408_100341013
574 Ga0307408_100783555
575 Ga0316575_10055545
576 Ga0316579_10404285
577 Ga0265314_10005842
578 Ga0265314_10200988
579 Ga0265342_10308193
580 Ga0265342_10402136
581 Ga0316576_10156052
582 Ga0316578_10023980
583 Ga0307405_10054757
584 Ga0307405_10210140
585 Ga0316577_10016175
586 Ga0307413_10065186
587 Ga0307413_10117595
588 Ga0307413_12182638
589 Ga0307410_10878594
590 Ga0307406_10097038
591 Ga0307406_10378770
592 Ga0307406_11299542
593 Ga0307412_10111422
594 Ga0307412_10207306
595 Ga0307416_102208945
596 Ga0307414_10306174
597 Ga0307411_10276407
598 Ga0307411_10953781
599 Ga0307415_101535104
600 Ga0316580_10024071
601 Ga0373938_0088973
602 Ga0373928_0041343
603 Ga0373951_0183494
604 Ga0373939_0177557
605 Ga0373941_0193670
606 Ga0373962_0062822
607 Ga0316574_0039418
608 Ga0373931_0167625
609 Ga0316582_0033570
610 Ga0316584_0049478
611 Ga0316584_0122388
612 Ga0436365_0616688
613 Ga0439461_0077504
614 Ga0451798_0759273
615 Ga0451807_0736485
616 Ga0451847_0733357
617 Ga0451853_1491001
618 Ga0450912_018705
619 Ga0450893_0015587
620 Ga0451577_0029788
621 Ga0451577_0099625
622 Ga0451577_0195917
623 Ga0451577_1015265
624 Ga0439440_0155797
625 Ga0466973_0212763
626 Ga0453683_0101753
627 Ga0453684_0019959
628 Ga0453684_0124724
629 Ga0453684_1340931
630 Ga0466968_0070571
631 Ga0466960_0016978
632 Ga0451576_0010471
633 Ga0451576_0024465
634 Ga0451576_0044936
635 Ga0495603_0539712
636 Ga0495603_0685719
637 Ga0495580_0108461
638 Ga0495630_0173916
639 Ga0495666_0238483
640 Ga0495611_0203118
641 Ga0495658_0439652
642 Ga0495581_0110215
643 Ga0495581_0693877
644 Ga0495672_0182713
645 Ga0495680_0021476
646 Ga0495680_0575660
647 Ga0495686_0000013
648 Ga0495686_0073828
649 Ga0495686_0307358
650 Ga0496102_0768850
651 Ga0496113_0310175
652 Ga0501298_006850
653 Ga0501299_042430
654 Ga0501032_0000435
655 Ga0501034_0155333
656 Ga0501036_0123874
657 Ga0501036_1120816
658 Ga0501037_0014104
659 Ga0501043_0133244
660 Ga0501046_0018931
661 Ga0501047_0000256
662 Ga0501048_0229845
663 Ga0501067_0000046
664 Ga0501068_0006837
665 Ga0501071_1002911
666 Ga0501073_0000019
667 Ga0501077_0000035
668 Ga0501216_059680
669 Ga0501235_115282
670 Ga0501236_075008
671 Ga0501255_045284
672 Ga0501259_060357
673 Ga0501080_0000668
674 Ga0501270_089311
675 Ga0501283_003696
676 Ga0501044_0009685
677 nmdc:mga05p37_2639_c1
678 nmdc:mga05p37_355231_c2
679 nmdc:mga05p37_99253_c1
680 nmdc:mga09592_213780_c1
681 nmdc:mga09592_2742_c1
682 nmdc:mga09592_299737_c1
683 nmdc:mga09592_359600_c1
684 nmdc:mga0qj67_110225_c1
685 nmdc:mga0qj67_1113726_c1
686 nmdc:mga0qj67_17529_c2
687 nmdc:mga0qj67_45456_c1
688 nmdc:mga0qj67_60841_c1
689 nmdc:mga0qj67_854892_c1
690 nmdc:mga06r32_2499_c1
691 nmdc:mga06r32_3865_c1
692 nmdc:mga06r32_409250_c1
693 nmdc:mga06r32_680604_c1
694 nmdc:mga08y16_30406_c1
695 nmdc:mga08y16_360724_c1
696 nmdc:mga08y16_69044_c1
697 nmdc:mga08y16_9529_c1
698 nmdc:mga0n895_472796_c1
699 nmdc:mga0a205_319783_c1
700 Ga0500595_037481
701 Ga0500658_0314479
702 Ga0500588_0007588
703 Ga0501082_1185578
704 2643731533
705 2644042139
706 2644394218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

29

159

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7403 5 136
6sss-assembly1.cif.gz_C crystal structure of human microsomal glutathione s-transferase 2 0.7313 5 137
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7085 5 136
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.6959 3 136
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.6702 3 136
ID Description Score Start End Superfamily
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.755 5 136 1.20.120.550
af_Q54BJ9_2_159_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7452 5 131 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7363 5 136 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7209 5 136 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7043 5 136 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A6P1B7G6-F1-model_v4 deleted 0.9739 51 131
AF-A0A841HID4-F1-model_v4 MAPEG family protein 0.9725 1 137 GO:0016020
AF-A0A257JJQ1-F1-model_v4 MAPEG family protein 0.9694 6 111 GO:0016020
AF-A0A841HID4-F1-model_v4 MAPEG family protein 0.9588 1 137 GO:0016020
AF-F4QM80-F1-model_v4 MAPEG family protein 0.9584 20 137 GO:0016020

Map