F419539

General Info

Members Datasets Scaffolds Average Seq Length
353 217 351 266

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0290906|Ga0501047_0290906_458_1339
Length 293
Sequence MVKARETLKNVAVAGATQPPVGGASATQHRVAVXGASGRMGHMLIEAIRAADDCRLAGALDQPSSPAIGNDAAAFLGHACGVPVTADLRAGLQDAEVLIDFTRPEGTMNHLKVCRELGVKAVIGTTGFSEGQKEQIADAARDIAIVLAPNMSVGVNVTLKLLEMAARTLAEDYDIEIVESHHRHKVDAPSGTALKMGEVIAAALGRDLKQVAKYGREGLTGEREGKTIGFSSVRGGDIVGDHTVLFAGTGERIEIVHRAASRATYAQGSLRAVRFLGDKSNGLYEMFDVLGLR

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
95 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
96 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
114 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
121 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
122 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
123 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
124 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
165 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 3.4
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 0
Rhizoplane 1.7
Rhizosphere 79.6
Stem 0
Stem Tuber 0
Unclassified 10.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1003582 3300003792 Bacteria 7415
2 Ga0055531_10000222 3300003794 Bacteria 62818
3 Ga0070658_10101739 3300005327 Bacteria 2376
4 Ga0070658_10344082 3300005327 Bacteria 1276
5 Ga0070676_10003885 3300005328 Bacteria 7846
6 Ga0068868_100008162 3300005338 Bacteria 7493
7 Ga0070675_100014049 3300005354 Bacteria 6306
8 Ga0070671_100072055 3300005355 Bacteria 2885
9 Ga0070671_100225769 3300005355 Bacteria 1589
10 Ga0070673_100002070 3300005364 Bacteria 12093
11 Ga0070667_100002713 3300005367 Bacteria 15329
12 Ga0070667_100120611 3300005367 Bacteria 2281
13 Ga0070667_100261412 3300005367 Bacteria 1550
14 Ga0070714_100617532 3300005435 Bacteria 1042
15 Ga0070663_100094383 3300005455 Bacteria 2221
16 Ga0068867_100038916 3300005459 Bacteria 3464
17 Ga0070679_100021763 3300005530 Bacteria 6263
18 Ga0070684_100023971 3300005535 Bacteria 5113
19 Ga0068853_100261858 3300005539 Bacteria 1590
20 Ga0070672_100198330 3300005543 Bacteria 1678
21 Ga0070686_100034494 3300005544 Bacteria 3118
22 Ga0068855_100012706 3300005563 Bacteria 10160
23 Ga0068855_100231856 3300005563 Bacteria 2067
24 Ga0068857_100013704 3300005577 Bacteria 7065
25 Ga0068854_100203760 3300005578 Bacteria 1557
26 Ga0068856_100245190 3300005614 Bacteria 1807
27 Ga0068852_100306503 3300005616 Bacteria 1539
28 Ga0068852_100649725 3300005616 Bacteria 1062
29 Ga0068859_100030312 3300005617 Bacteria 5427
30 Ga0068859_100225529 3300005617 Bacteria 1962
31 Ga0068864_100073772 3300005618 Bacteria 2975
32 Ga0068863_100043235 3300005841 Bacteria 4277
33 Ga0075368_10072514 3300006042 Bacteria 1392
34 Ga0075368_10139290 3300006042 Bacteria 1011
35 Ga0075362_10000229 3300006177 Bacteria 15648
36 Ga0075367_10007590 3300006178 Bacteria 5566
37 Ga0075369_10022204 3300006186 Bacteria 2615
38 Ga0075366_10017236 3300006195 Bacteria 4155
39 Ga0075366_10062562 3300006195 Bacteria 2212
40 Ga0075366_10073949 3300006195 Bacteria 2032
41 Ga0075370_10008287 3300006353 Bacteria 5341
42 Ga0068871_100003749 3300006358 Bacteria 10465
43 Ga0068865_100098852 3300006881 Bacteria 2133
44 Ga0097620_100030314 3300006931 Bacteria 5427
45 Ga0097620_100225515 3300006931 Bacteria 1962
46 Ga0105240_10021257 3300009093 Bacteria 8636
47 Ga0105245_10023950 3300009098 Bacteria 5358
48 Ga0105245_10118799 3300009098 Bacteria 2467
49 Ga0105243_10062193 3300009148 Bacteria 2988
50 Ga0105237_10017758 3300009545 Bacteria 7376
51 Ga0105238_10025393 3300009551 Bacteria 6040
52 Ga0105239_10052466 3300010375 Bacteria 4472
53 Ga0163162_10341861 3300013306 Bacteria 1629
54 Ga0157375_10406163 3300013308 Bacteria 1529
55 Ga0157375_10432238 3300013308 Bacteria 1482
56 Ga0157380_10339952 3300014326 Bacteria 1400
57 Ga0182008_10069576 3300014497 Bacteria 1731
58 Ga0157379_10073767 3300014968 Bacteria 3055
59 Ga0157376_10046433 3300014969 Bacteria 3581
60 Ga0157376_10068766 3300014969 Bacteria 3000
61 Ga0182007_10038927 3300015262 Bacteria 1593
62 Ga0209673_1012214 3300025273 Bacteria 3478
63 Ga0209051_1001161 3300025303 Bacteria 23959
64 Ga0209257_1000446 3300025304 Bacteria 77752
65 Ga0207645_10080939 3300025907 Bacteria 2082
66 Ga0207705_10341813 3300025909 Bacteria 1152
67 Ga0207684_10003656 3300025910 Bacteria 14941
68 Ga0207671_10049198 3300025914 Bacteria 3120
69 Ga0207660_10296133 3300025917 Bacteria 1287
70 Ga0207646_10042219 3300025922 Bacteria 4099
71 Ga0207694_10084062 3300025924 Bacteria 2503
72 Ga0207687_10407551 3300025927 Bacteria 1119
73 Ga0207644_10190790 3300025931 Bacteria 1611
74 Ga0207706_10176238 3300025933 Bacteria 1878
75 Ga0207709_10114850 3300025935 Bacteria 1807
76 Ga0207704_10342654 3300025938 Bacteria 1161
77 Ga0207689_10135141 3300025942 Bacteria 2030
78 Ga0207661_10044504 3300025944 Bacteria 3509
79 Ga0207667_10282149 3300025949 Bacteria 1697
80 Ga0207667_10313230 3300025949 Bacteria 1603
81 Ga0207640_10188173 3300025981 Bacteria 1554
82 Ga0207677_10051081 3300026023 Bacteria 2801
83 Ga0207703_10163294 3300026035 Bacteria 1952
84 Ga0207639_10151324 3300026041 Bacteria 1944
85 Ga0207708_10111959 3300026075 Bacteria 2120
86 Ga0207702_10058293 3300026078 Bacteria 3286
87 Ga0207648_10212697 3300026089 Bacteria 1717
88 Ga0207674_10011249 3300026116 Bacteria 10059
89 Ga0207674_10127873 3300026116 Bacteria 2505
90 Ga0207428_10059014 3300027907 Bacteria 3043
91 Ga0307517_10012413 3300028786 Bacteria 11690
92 Ga0307517_10103076 3300028786 Bacteria 2232
93 Ga0307515_10000109 3300028794 Bacteria 195895
94 Ga0307515_10003726 3300028794 Bacteria 31986
95 Ga0307515_10003752 3300028794 Bacteria 31839
96 Ga0307515_10008086 3300028794 Bacteria 20612
97 Ga0307515_10054261 3300028794 Bacteria 5889
98 Ga0307515_10132496 3300028794 Bacteria 2734
99 Ga0307515_10136069 3300028794 Bacteria 2671
100 Ga0307512_10140542 3300030522 Bacteria 1479
101 Ga0265316_10109532 3300031344 Bacteria 2093
102 Ga0307513_10005597 3300031456 Bacteria 16570
103 Ga0307513_10048115 3300031456 Bacteria 4631
104 Ga0307513_10056984 3300031456 Bacteria 4167
105 Ga0307513_10162089 3300031456 Bacteria 2127
106 Ga0307513_10263383 3300031456 Bacteria 1512
107 Ga0307513_10314974 3300031456 Bacteria 1325
108 Ga0307509_10044010 3300031507 Bacteria 4825
109 Ga0307509_10212640 3300031507 Bacteria 1756
110 Ga0307508_10000237 3300031616 Bacteria 67014
111 Ga0307508_10000523 3300031616 Bacteria 45545
112 Ga0307508_10005043 3300031616 Bacteria 12682
113 Ga0307514_10001452 3300031649 Bacteria 28909
114 Ga0307514_10002703 3300031649 Bacteria 17950
115 Ga0307514_10024747 3300031649 Bacteria 4856
116 Ga0316575_10002286 3300031665 Bacteria 6411
117 Ga0316575_10007261 3300031665 Bacteria 4010
118 Ga0316575_10007944 3300031665 Bacteria 3852
119 Ga0316575_10020580 3300031665 Bacteria 2532
120 Ga0316575_10052643 3300031665 Bacteria 1621
121 Ga0316575_10066505 3300031665 Bacteria 1444
122 Ga0316579_10002250 3300031691 Bacteria 7283
123 Ga0316579_10004763 3300031691 Bacteria 5419
124 Ga0316579_10067110 3300031691 Bacteria 1695
125 Ga0316579_10179348 3300031691 Bacteria 1024
126 Ga0316576_10001221 3300031727 Bacteria 13594
127 Ga0316576_10029304 3300031727 Bacteria 3889
128 Ga0316576_10031509 3300031727 Bacteria 3762
129 Ga0316576_10062117 3300031727 Bacteria 2739
130 Ga0316578_10000257 3300031728 Bacteria 15926
131 Ga0316578_10008698 3300031728 Bacteria 5182
132 Ga0316578_10011194 3300031728 Bacteria 4682
133 Ga0316578_10030535 3300031728 Bacteria 3064
134 Ga0307516_10004413 3300031730 Bacteria 17380
135 Ga0307516_10030827 3300031730 Bacteria 5409
136 Ga0307516_10254252 3300031730 Bacteria 1450
137 Ga0316577_10000121 3300031733 Bacteria 22620
138 Ga0316577_10002051 3300031733 Bacteria 9835
139 Ga0316577_10002727 3300031733 Bacteria 8792
140 Ga0316577_10017930 3300031733 Bacteria 3912
141 Ga0316577_10067128 3300031733 Bacteria 2002
142 Ga0316577_10185445 3300031733 Bacteria 1175
143 Ga0316577_10199501 3300031733 Bacteria 1131
144 Ga0307412_10138181 3300031911 Bacteria 1781
145 Ga0307416_100319945 3300032002 Bacteria 1553
146 Ga0316583_10000450 3300032133 Bacteria 12121
147 Ga0316585_10000572 3300032137 Bacteria 9022
148 Ga0316580_10007871 3300032139 Bacteria 3182
149 Ga0316580_10026359 3300032139 Bacteria 1797
150 Ga0316580_10028607 3300032139 Bacteria 1723
151 Ga0316580_10071502 3300032139 Bacteria 1062
152 Ga0316593_10006094 3300032168 Bacteria 3234
153 Ga0316593_10039917 3300032168 Bacteria 1559
154 Ga0307507_10050232 3300033179 Bacteria 4029
155 Ga0316592_1008345 3300033524 Bacteria 2044
156 Ga0316592_1016620 3300033524 Bacteria 1539
157 Ga0316592_1020650 3300033524 Bacteria 1400
158 Ga0316592_1036500 3300033524 Bacteria 1080
159 Ga0316588_1001623 3300033528 Bacteria 3751
160 Ga0316588_1017329 3300033528 Bacteria 1604
161 Ga0316587_1000449 3300033529 Bacteria 4115
162 Ga0316596_1000255 3300033541 Bacteria 8210
163 Ga0316596_1000588 3300033541 Bacteria 6395
164 Ga0316596_1025703 3300033541 Bacteria 1516
165 Ga0316574_0000756 3300035398 Bacteria 13906
166 Ga0316574_0005493 3300035398 Bacteria 6761
167 Ga0316574_0009656 3300035398 Bacteria 5416
168 Ga0316574_0020683 3300035398 Bacteria 3897
169 Ga0316574_0035348 3300035398 Bacteria 3053
170 Ga0316574_0149893 3300035398 Bacteria 1503
171 Ga0316574_0362824 3300035398 Bacteria 916
172 Ga0373931_0024387 3300035691 Bacteria 3064
173 Ga0373937_0618487 3300036401 Bacteria 1028
174 Ga0316582_0000932 3300036647 Bacteria 12045
175 Ga0316582_0002665 3300036647 Bacteria 8453
176 Ga0316582_0037729 3300036647 Bacteria 2998
177 Ga0316582_0052734 3300036647 Bacteria 2585
178 Ga0316582_0244121 3300036647 Bacteria 1230
179 Ga0316584_0000338 3300036712 Bacteria 24024
180 Ga0316584_0004667 3300036712 Bacteria 9083
181 Ga0316584_0005367 3300036712 Bacteria 8596
182 Ga0316584_0032704 3300036712 Bacteria 3850
183 Ga0316584_0054318 3300036712 Bacteria 2998
184 Ga0316584_0086016 3300036712 Bacteria 2354
185 Ga0316584_0229798 3300036712 Bacteria 1360
186 Ga0395899_0001824 3300037312 Bacteria 17641
187 Ga0395899_0053881 3300037312 Bacteria 2978
188 Ga0395899_0179349 3300037312 Bacteria 1488
189 Ga0395900_0001965 3300037418 Bacteria 23218
190 Ga0395900_0020850 3300037418 Bacteria 6697
191 Ga0395900_0089603 3300037418 Bacteria 3162
192 Ga0395900_0127003 3300037418 Bacteria 2615
193 Ga0395900_0445161 3300037418 Bacteria 1252
194 Ga0395898_0004194 3300037466 Bacteria 15799
195 Ga0395898_0004351 3300037466 Bacteria 15501
196 Ga0395905_0001479 3300037471 Bacteria 28137
197 Ga0395905_0022430 3300037471 Bacteria 5970
198 Ga0395905_0079153 3300037471 Bacteria 3080
199 Ga0395905_0105772 3300037471 Bacteria 2642
200 Ga0395905_0128087 3300037471 Bacteria 2387
201 Ga0395905_0761492 3300037471 Bacteria 871
202 Ga0395901_0012980 3300038443 Bacteria 8452
203 Ga0395901_0163461 3300038443 Bacteria 2337
204 Ga0400483_273521 3300039062 Bacteria 1331
205 Ga0400487_34970 3300039110 Bacteria 222491
206 Ga0439439_0031243 3300041406 Bacteria 1356
207 Ga0451802_1361253 3300041460 Bacteria 1334
208 Ga0439445_0003784 3300042004 Bacteria 3400
209 Ga0439449_0006081 3300042007 Bacteria 4616
210 Ga0439457_015879 3300042014 Bacteria 1681
211 Ga0439462_0029032 3300042015 Bacteria 1463
212 Ga0450911_000381 3300042115 Bacteria 14792
213 Ga0450923_013861 3300042125 Bacteria 1487
214 Ga0450897_003195 3300042128 Bacteria 1298
215 Ga0450896_011598 3300042133 Bacteria 1242
216 Ga0450898_007335 3300042134 Bacteria 1715
217 Ga0439446_0010914 3300042156 Bacteria 2456
218 Ga0439434_0028886 3300042435 Bacteria 1681
219 Ga0439459_0038366 3300042438 Bacteria 1007
220 Ga0439464_0003273 3300042439 Bacteria 4075
221 Ga0451577_0003100 3300042876 Bacteria 18746
222 Ga0451577_0008376 3300042876 Bacteria 10063
223 Ga0451577_0111363 3300042876 Bacteria 2449
224 Ga0466969_0031093 3300044656 Bacteria 2718
225 Ga0466972_0205761 3300044658 Bacteria 921
226 Ga0453683_0001005 3300044673 Bacteria 26472
227 Ga0453683_0064438 3300044673 Bacteria 2291
228 Ga0466966_0000016 3300044684 Bacteria 127214
229 Ga0466966_0027666 3300044684 Bacteria 3696
230 Ga0466961_0000621 3300044693 Bacteria 22275
231 Ga0453684_0000005 3300044712 Bacteria 1431632
232 Ga0453684_0000163 3300044712 Bacteria 296196
233 Ga0453684_0000386 3300044712 Bacteria 180948
234 Ga0453684_0004902 3300044712 Bacteria 27396
235 Ga0453684_0005751 3300044712 Bacteria 24224
236 Ga0453684_0055538 3300044712 Bacteria 5148
237 Ga0453684_0126636 3300044712 Bacteria 3072
238 Ga0453684_0324342 3300044712 Bacteria 1743
239 Ga0453684_0356526 3300044712 Bacteria 1648
240 Ga0466970_0028139 3300044765 Bacteria 2952
241 Ga0466957_0037754 3300044842 Bacteria 2909
242 Ga0466957_0058877 3300044842 Bacteria 2354
243 Ga0466960_0366123 3300044901 Bacteria 825
244 Ga0466959_0022337 3300045049 Bacteria 4676
245 Ga0466959_0041726 3300045049 Bacteria 3387
246 Ga0451576_0000738 3300045051 Bacteria 65424
247 Ga0451576_0001961 3300045051 Bacteria 32770
248 Ga0451576_0012420 3300045051 Bacteria 9566
249 Ga0451576_0089621 3300045051 Bacteria 3199
250 Ga0451576_0119377 3300045051 Bacteria 2745
251 Ga0451576_0190089 3300045051 Bacteria 2144
252 Ga0451576_0222381 3300045051 Bacteria 1971
253 Ga0451576_0316022 3300045051 Bacteria 1634
254 Ga0466958_0010535 3300045836 Bacteria 5180
255 Ga0495650_0003849 3300046471 Bacteria 10644
256 Ga0495610_0068740 3300046512 Bacteria 1659
257 Ga0495628_0464106 3300046516 Bacteria 918
258 Ga0495632_0033901 3300046519 Bacteria 2617
259 Ga0495632_0045174 3300046519 Bacteria 2195
260 Ga0495643_0105051 3300046522 Bacteria 1443
261 Ga0495643_0161601 3300046522 Bacteria 1101
262 Ga0495663_0030212 3300046525 Bacteria 1604
263 Ga0495654_0001949 3300046530 Bacteria 13639
264 Ga0495597_0069621 3300046542 Bacteria 1518
265 Ga0495622_0066941 3300046557 Bacteria 1660
266 Ga0495633_0099630 3300046558 Bacteria 1349
267 Ga0495656_0011320 3300046615 Bacteria 3273
268 Ga0495668_0017186 3300046616 Bacteria 4201
269 Ga0495625_0008918 3300046660 Bacteria 8478
270 Ga0495625_0023793 3300046660 Bacteria 4675
271 Ga0495624_0025925 3300046690 Bacteria 3846
272 Ga0495671_0056297 3300046692 Bacteria 1947
273 Ga0495649_0005488 3300046694 Bacteria 8051
274 Ga0495660_0036107 3300046810 Bacteria 2758
275 Ga0495660_0041147 3300046810 Bacteria 2560
276 Ga0495660_0060409 3300046810 Bacteria 2036
277 Ga0495672_0000014 3300047320 Bacteria 505636
278 Ga0495687_000070 3300047443 Bacteria 159227
279 Ga0495687_006998 3300047443 Bacteria 6769
280 Ga0495685_017103 3300047447 Bacteria 2481
281 Ga0495686_0002833 3300047472 Bacteria 15690
282 Ga0495593_0021044 3300047673 Bacteria 3647
283 Ga0495615_0005611 3300048090 Bacteria 2268
284 Ga0495626_0057460 3300048091 Bacteria 1780
285 Ga0496102_0006709 3300048905 Bacteria 9831
286 Ga0496102_0096707 3300048905 Bacteria 2738
287 Ga0496108_0010298 3300048911 Bacteria 7590
288 Ga0496110_0067836 3300048913 Bacteria 3157
289 Ga0496114_0001965 3300048917 Bacteria 15619
290 Ga0496121_0020507 3300048924 Bacteria 6537
291 Ga0496122_0090248 3300048925 Bacteria 2092
292 Ga0496125_0000897 3300048928 Bacteria 47149
293 Ga0496125_0029331 3300048928 Bacteria 4946
294 Ga0496125_0044012 3300048928 Bacteria 3781
295 Ga0496126_0081697 3300048929 Bacteria 2856
296 Ga0496126_0092454 3300048929 Bacteria 2658
297 Ga0495682_0048796 3300049460 Bacteria 1543
298 Ga0501031_0029647 3300049568 Bacteria 3569
299 Ga0501032_0040774 3300049569 Bacteria 3155
300 Ga0501033_0014575 3300049570 Bacteria 5968
301 Ga0501034_0066935 3300049571 Bacteria 3605
302 Ga0501036_0057134 3300049572 Bacteria 3305
303 Ga0501038_0001514 3300049574 Bacteria 21388
304 Ga0501038_0114557 3300049574 Bacteria 2230
305 Ga0501038_0163371 3300049574 Bacteria 1808
306 Ga0501040_0025733 3300049576 Bacteria 3958
307 Ga0501041_0000814 3300049577 Bacteria 16723
308 Ga0501042_0000247 3300049578 Bacteria 26226
309 Ga0501043_0068263 3300049579 Bacteria 2791
310 Ga0501046_0000518 3300049580 Bacteria 38078
311 Ga0501046_0081411 3300049580 Bacteria 2500
312 Ga0501047_0123549 3300049581 Bacteria 2469
313 Ga0501047_0224133 3300049581 Bacteria 1735
314 Ga0501047_0290906 3300049581 Bacteria 1477
315 Ga0501047_0337571 3300049581 Bacteria 1345
316 Ga0501068_0023737 3300049584 Bacteria 3596
317 Ga0501070_0031205 3300049586 Bacteria 4464
318 Ga0501071_0036242 3300049587 Bacteria 3517
319 Ga0501072_0024081 3300049588 Bacteria 4733
320 Ga0501073_0275591 3300049589 Bacteria 1161
321 Ga0501074_0018228 3300049590 Bacteria 5100
322 Ga0501075_0042612 3300049591 Bacteria 3403
323 Ga0501076_0043736 3300049592 Bacteria 3530
324 Ga0501077_0002988 3300049593 Bacteria 10147
325 Ga0501080_0099974 3300049742 Bacteria 2691
326 Ga0501080_0130399 3300049742 Bacteria 2327
327 Ga0501081_0000242 3300049743 Bacteria 27990
328 Ga0501035_0051481 3300049822 Bacteria 3687
329 Ga0501035_0061820 3300049822 Bacteria 3332
330 Ga0501044_0016678 3300049823 Bacteria 7887
331 nmdc:mga00v17_43394_c1 3300050491 Bacteria 2708
332 nmdc:mga0k408_1933_c1 3300050493 Bacteria 11089
333 nmdc:mga0k408_29030_c1 3300050493 Bacteria 3147
334 nmdc:mga06z11_16536_c1 3300050494 Bacteria 3325
335 nmdc:mga06z11_59481_c1 3300050494 Bacteria 1986
336 nmdc:mga07m45_152854_c1 3300050496 Bacteria 1339
337 nmdc:mga08y16_79347_c1 3300050511 Bacteria 3421
338 nmdc:mga08y16_8470_c1 3300050511 Bacteria 10771
339 nmdc:mga0sz30_32782_c1 3300050516 Bacteria 2156
340 Ga0500578_0209653 3300053086 Bacteria 1189
341 Ga0500644_0157544 3300053088 Bacteria 915
342 Ga0500562_006388 3300053108 Bacteria 2972
343 Ga0500568_0009042 3300053139 Bacteria 4755
344 Ga0500619_000148 3300053154 Bacteria 17268
345 Ga0500622_0159377 3300053156 Bacteria 1059
346 Ga0500645_002490 3300053730 Bacteria 8165
347 Ga0500587_000965 3300053739 Bacteria 3870
348 Ga0501084_0058218 3300054114 Bacteria 3233
349 Ga0590077_046178 3300059426 Bacteria 974
350 Ga0501082_0048632 3300060353 Bacteria 3655
351 Ga0530510_0000121 3300061734 Bacteria 44581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053086 Ga0500578_0209653 Ga0500578_0209653_40_804 234
2 3300044684 Ga0466966_0000016 Ga0466966_0000016_90554_91360 242
3 3300044693 Ga0466961_0000621 Ga0466961_0000621_11952_12758 242
4 3300044842 Ga0466957_0037754 Ga0466957_0037754_1374_2180 242
5 3300045049 Ga0466959_0022337 Ga0466959_0022337_2136_2942 242
6 3300045836 Ga0466958_0010535 Ga0466958_0010535_1935_2741 242
7 3300049568 Ga0501031_0029647 Ga0501031_0029647_553_1287 243
8 3300049569 Ga0501032_0040774 Ga0501032_0040774_554_1288 243
9 3300049570 Ga0501033_0014575 Ga0501033_0014575_944_1678 243
10 3300049572 Ga0501036_0057134 Ga0501036_0057134_603_1337 243
11 3300049574 Ga0501038_0001514 Ga0501038_0001514_19182_19916 243
12 3300049576 Ga0501040_0025733 Ga0501040_0025733_1456_2190 243
13 3300049577 Ga0501041_0000814 Ga0501041_0000814_1320_2054 243
14 3300049578 Ga0501042_0000247 Ga0501042_0000247_4083_4817 243
15 3300049579 Ga0501043_0068263 Ga0501043_0068263_280_1014 243
16 3300049580 Ga0501046_0000518 Ga0501046_0000518_6433_7167 243
17 3300049581 Ga0501047_0123549 Ga0501047_0123549_754_1488 243
18 3300049584 Ga0501068_0023737 Ga0501068_0023737_1095_1829 243
19 3300049586 Ga0501070_0031205 Ga0501070_0031205_1889_2623 243
20 3300049587 Ga0501071_0036242 Ga0501071_0036242_1455_2189 243
21 3300049588 Ga0501072_0024081 Ga0501072_0024081_3373_4107 243
22 3300049590 Ga0501074_0018228 Ga0501074_0018228_3102_3836 243
23 3300049591 Ga0501075_0042612 Ga0501075_0042612_603_1337 243
24 3300049592 Ga0501076_0043736 Ga0501076_0043736_603_1337 243
25 3300049593 Ga0501077_0002988 Ga0501077_0002988_7314_8048 243
26 3300049742 Ga0501080_0099974 Ga0501080_0099974_930_1664 243
27 3300049743 Ga0501081_0000242 Ga0501081_0000242_25767_26501 243
28 3300049822 Ga0501035_0061820 Ga0501035_0061820_1159_1893 243
29 3300054114 Ga0501084_0058218 Ga0501084_0058218_1769_2503 243
30 3300060353 Ga0501082_0048632 Ga0501082_0048632_288_1022 243
31 3300061734 Ga0530510_0000121 Ga0530510_0000121_35417_36151 243
32 3300032002 Ga0307416_100319945 Ga0307416_1003199452 245
33 3300044712 Ga0453684_0005751 Ga0453684_0005751_3525_4262 245
34 3300044712 Ga0453684_0324342 Ga0453684_0324342_921_1658 245
35 3300005338 Ga0068868_100008162 Ga0068868_1000081622 246
36 3300005355 Ga0070671_100225769 Ga0070671_1002257691 246
37 3300005617 Ga0068859_100030312 Ga0068859_1000303125 246
38 3300005618 Ga0068864_100073772 Ga0068864_1000737721 246
39 3300005841 Ga0068863_100043235 Ga0068863_1000432354 246
40 3300006931 Ga0097620_100030314 Ga0097620_1000303144 246
41 3300009098 Ga0105245_10023950 Ga0105245_100239504 246
42 3300013306 Ga0163162_10341861 Ga0163162_103418612 246
43 3300014968 Ga0157379_10073767 Ga0157379_100737673 246
44 3300025931 Ga0207644_10190790 Ga0207644_101907902 246
45 3300042876 Ga0451577_0003100 Ga0451577_0003100_14795_15535 246
46 3300042876 Ga0451577_0111363 Ga0451577_0111363_937_1677 246
47 3300044712 Ga0453684_0000005 Ga0453684_0000005_1065878_1066618 246
48 3300044712 Ga0453684_0004902 Ga0453684_0004902_13061_13801 246
49 3300045051 Ga0451576_0000738 Ga0451576_0000738_51402_52142 246
50 3300046616 Ga0495668_0017186 Ga0495668_0017186_1358_2098 246
51 3300031456 Ga0307513_10314974 Ga0307513_103149742 247
52 3300031649 Ga0307514_10024747 Ga0307514_100247475 247
53 3300047443 Ga0495687_000070 Ga0495687_000070_127850_128677 247
54 3300005328 Ga0070676_10003885 Ga0070676_100038853 248
55 3300005354 Ga0070675_100014049 Ga0070675_1000140498 248
56 3300005355 Ga0070671_100072055 Ga0070671_1000720554 248
57 3300005364 Ga0070673_100002070 Ga0070673_1000020707 248
58 3300005367 Ga0070667_100120611 Ga0070667_1001206113 248
59 3300005459 Ga0068867_100038916 Ga0068867_1000389163 248
60 3300005543 Ga0070672_100198330 Ga0070672_1001983302 248
61 3300006195 Ga0075366_10073949 Ga0075366_100739492 248
62 3300006881 Ga0068865_100098852 Ga0068865_1000988522 248
63 3300009098 Ga0105245_10118799 Ga0105245_101187994 248
64 3300013308 Ga0157375_10432238 Ga0157375_104322382 248
65 3300025938 Ga0207704_10342654 Ga0207704_103426541 248
66 3300028786 Ga0307517_10012413 Ga0307517_100124135 248
67 3300028786 Ga0307517_10103076 Ga0307517_101030762 248
68 3300028794 Ga0307515_10054261 Ga0307515_100542613 248
69 3300028794 Ga0307515_10132496 Ga0307515_101324964 248
70 3300031507 Ga0307509_10212640 Ga0307509_102126402 248
71 3300031616 Ga0307508_10000523 Ga0307508_1000052315 248
72 3300031616 Ga0307508_10005043 Ga0307508_1000504314 248
73 3300031730 Ga0307516_10254252 Ga0307516_102542522 248
74 3300035691 Ga0373931_0024387 Ga0373931_0024387_313_1059 248
75 3300046471 Ga0495650_0003849 Ga0495650_0003849_7129_7941 248
76 3300046557 Ga0495622_0066941 Ga0495622_0066941_365_1111 248
77 3300046690 Ga0495624_0025925 Ga0495624_0025925_1851_2597 248
78 3300047673 Ga0495593_0021044 Ga0495593_0021044_1649_2395 248
79 3300042876 Ga0451577_0008376 Ga0451577_0008376_7525_8280 251
80 3300044712 Ga0453684_0126636 Ga0453684_0126636_2007_2762 251
81 3300005535 Ga0070684_100023971 Ga0070684_1000239712 252
82 3300005544 Ga0070686_100034494 Ga0070686_1000344944 252
83 3300005616 Ga0068852_100649725 Ga0068852_1006497252 252
84 3300006358 Ga0068871_100003749 Ga0068871_1000037499 252
85 3300014969 Ga0157376_10046433 Ga0157376_100464334 252
86 3300025944 Ga0207661_10044504 Ga0207661_100445044 252
87 3300026035 Ga0207703_10163294 Ga0207703_101632942 252
88 3300053730 Ga0500645_002490 Ga0500645_002490_6330_7148 253
89 3300009148 Ga0105243_10062193 Ga0105243_100621934 254
90 3300009545 Ga0105237_10017758 Ga0105237_100177584 254
91 3300010375 Ga0105239_10052466 Ga0105239_100524662 254
92 3300014326 Ga0157380_10339952 Ga0157380_103399522 254
93 3300031727 Ga0316576_10029304 Ga0316576_100293043 254
94 3300031733 Ga0316577_10199501 Ga0316577_101995012 254
95 3300035398 Ga0316574_0009656 Ga0316574_0009656_1716_2489 254
96 3300036647 Ga0316582_0002665 Ga0316582_0002665_761_1534 254
97 3300036647 Ga0316582_0037729 Ga0316582_0037729_1455_2228 254
98 3300036647 Ga0316582_0052734 Ga0316582_0052734_18_794 254
99 3300036712 Ga0316584_0000338 Ga0316584_0000338_7988_8761 254
100 3300036712 Ga0316584_0004667 Ga0316584_0004667_7710_8483 254
101 3300036712 Ga0316584_0032704 Ga0316584_0032704_18_794 254
102 3300036712 Ga0316584_0054318 Ga0316584_0054318_1172_1945 254
103 3300039062 Ga0400483_273521 Ga0400483_273521_473_1240 254
104 3300044901 Ga0466960_0366123 Ga0466960_0366123_11_775 254
105 3300046525 Ga0495663_0030212 Ga0495663_0030212_17_781 254
106 3300046558 Ga0495633_0099630 Ga0495633_0099630_530_1294 254
107 3300046615 Ga0495656_0011320 Ga0495656_0011320_1480_2244 254
108 3300046692 Ga0495671_0056297 Ga0495671_0056297_167_931 254
109 3300047447 Ga0495685_017103 Ga0495685_017103_281_1045 254
110 3300050491 nmdc:mga00v17_43394_c1 nmdc:mga00v17_43394_c1_495_1259 254
111 3300050493 nmdc:mga0k408_1933_c1 nmdc:mga0k408_1933_c1_3305_4069 254
112 3300050494 nmdc:mga06z11_59481_c1 nmdc:mga06z11_59481_c1_376_1140 254
113 3300050516 nmdc:mga0sz30_32782_c1 nmdc:mga0sz30_32782_c1_418_1182 254
114 3300053088 Ga0500644_0157544 Ga0500644_0157544_127_891 254
115 3300031344 Ga0265316_10109532 Ga0265316_101095322 255
116 3300046516 Ga0495628_0464106 Ga0495628_0464106_23_799 258
117 3300032133 Ga0316583_10000450 Ga0316583_100004506 262
118 3300048924 Ga0496121_0020507 Ga0496121_0020507_1606_2439 262
119 3300048925 Ga0496122_0090248 Ga0496122_0090248_469_1302 262
120 3300027907 Ga0207428_10059014 Ga0207428_100590143 265
121 3300031691 Ga0316579_10067110 Ga0316579_100671102 265
122 3300031727 Ga0316576_10062117 Ga0316576_100621171 265
123 3300035398 Ga0316574_0149893 Ga0316574_0149893_572_1372 265
124 iso_pu_bacteria 2585428062 2587757158 265
125 3300005327 Ga0070658_10101739 Ga0070658_101017392 266
126 3300005530 Ga0070679_100021763 Ga0070679_1000217638 266
127 3300005563 Ga0068855_100012706 Ga0068855_1000127065 266
128 3300009093 Ga0105240_10021257 Ga0105240_100212574 266
129 3300009551 Ga0105238_10025393 Ga0105238_100253939 266
130 3300025909 Ga0207705_10341813 Ga0207705_103418132 266
131 3300025917 Ga0207660_10296133 Ga0207660_102961331 266
132 3300025949 Ga0207667_10282149 Ga0207667_102821492 266
133 3300031665 Ga0316575_10052643 Ga0316575_100526432 266
134 3300031691 Ga0316579_10002250 Ga0316579_100022503 266
135 3300031728 Ga0316578_10011194 Ga0316578_100111944 266
136 3300031733 Ga0316577_10002727 Ga0316577_100027275 266
137 3300032137 Ga0316585_10000572 Ga0316585_100005722 266
138 3300032139 Ga0316580_10028607 Ga0316580_100286072 266
139 3300033524 Ga0316592_1016620 Ga0316592_10166201 266
140 3300033529 Ga0316587_1000449 Ga0316587_10004493 266
141 3300033541 Ga0316596_1000588 Ga0316596_10005884 266
142 3300035398 Ga0316574_0005493 Ga0316574_0005493_5727_6533 266
143 3300036712 Ga0316584_0086016 Ga0316584_0086016_650_1453 266
144 3300037312 Ga0395899_0053881 Ga0395899_0053881_891_1691 266
145 3300037418 Ga0395900_0127003 Ga0395900_0127003_500_1300 266
146 3300037418 Ga0395900_0445161 Ga0395900_0445161_422_1222 266
147 3300037466 Ga0395898_0004194 Ga0395898_0004194_7313_8113 266
148 3300037471 Ga0395905_0079153 Ga0395905_0079153_1692_2492 266
149 3300038443 Ga0395901_0012980 Ga0395901_0012980_4669_5469 266
150 3300031665 Ga0316575_10020580 Ga0316575_100205802 267
151 3300025933 Ga0207706_10176238 Ga0207706_101762382 268
152 3300026075 Ga0207708_10111959 Ga0207708_101119591 268
153 3300031665 Ga0316575_10002286 Ga0316575_100022862 268
154 3300031665 Ga0316575_10007261 Ga0316575_100072613 268
155 3300031665 Ga0316575_10007944 Ga0316575_100079442 268
156 3300031665 Ga0316575_10066505 Ga0316575_100665052 268
157 3300031691 Ga0316579_10004763 Ga0316579_100047632 268
158 3300031691 Ga0316579_10179348 Ga0316579_101793481 268
159 3300031727 Ga0316576_10001221 Ga0316576_100012217 268
160 3300031727 Ga0316576_10031509 Ga0316576_100315092 268
161 3300031728 Ga0316578_10000257 Ga0316578_100002574 268
162 3300031728 Ga0316578_10008698 Ga0316578_100086983 268
163 3300031728 Ga0316578_10030535 Ga0316578_100305352 268
164 3300031733 Ga0316577_10000121 Ga0316577_100001219 268
165 3300031733 Ga0316577_10002051 Ga0316577_100020514 268
166 3300031733 Ga0316577_10017930 Ga0316577_100179302 268
167 3300031733 Ga0316577_10067128 Ga0316577_100671282 268
168 3300031733 Ga0316577_10185445 Ga0316577_101854452 268
169 3300032139 Ga0316580_10007871 Ga0316580_100078712 268
170 3300032139 Ga0316580_10026359 Ga0316580_100263591 268
171 3300032139 Ga0316580_10071502 Ga0316580_100715021 268
172 3300032168 Ga0316593_10006094 Ga0316593_100060943 268
173 3300032168 Ga0316593_10039917 Ga0316593_100399172 268
174 3300033524 Ga0316592_1008345 Ga0316592_10083451 268
175 3300033524 Ga0316592_1020650 Ga0316592_10206502 268
176 3300033524 Ga0316592_1036500 Ga0316592_10365001 268
177 3300033528 Ga0316588_1001623 Ga0316588_10016232 268
178 3300033528 Ga0316588_1017329 Ga0316588_10173292 268
179 3300033541 Ga0316596_1000255 Ga0316596_10002552 268
180 3300033541 Ga0316596_1025703 Ga0316596_10257032 268
181 3300035398 Ga0316574_0000756 Ga0316574_0000756_6807_7622 268
182 3300035398 Ga0316574_0020683 Ga0316574_0020683_53_859 268
183 3300035398 Ga0316574_0362824 Ga0316574_0362824_51_866 268
184 3300036647 Ga0316582_0000932 Ga0316582_0000932_8458_9273 268
185 3300036647 Ga0316582_0244121 Ga0316582_0244121_391_1206 268
186 3300036712 Ga0316584_0005367 Ga0316584_0005367_5332_6147 268
187 3300036712 Ga0316584_0229798 Ga0316584_0229798_410_1225 268
188 3300044673 Ga0453683_0064438 Ga0453683_0064438_1280_2086 268
189 3300044712 Ga0453684_0000163 Ga0453684_0000163_87880_88686 268
190 3300044712 Ga0453684_0000386 Ga0453684_0000386_164260_165066 268
191 3300045051 Ga0451576_0001961 Ga0451576_0001961_9081_9887 268
192 3300045051 Ga0451576_0012420 Ga0451576_0012420_1945_2751 268
193 3300045051 Ga0451576_0089621 Ga0451576_0089621_995_1801 268
194 3300045051 Ga0451576_0119377 Ga0451576_0119377_1138_1944 268
195 3300045051 Ga0451576_0190089 Ga0451576_0190089_1328_2134 268
196 3300045051 Ga0451576_0222381 Ga0451576_0222381_680_1486 268
197 3300045051 Ga0451576_0316022 Ga0451576_0316022_782_1588 268
198 3300046810 Ga0495660_0041147 Ga0495660_0041147_456_1265 268
199 3300047320 Ga0495672_0000014 Ga0495672_0000014_152225_153046 268
200 3300048911 Ga0496108_0010298 Ga0496108_0010298_847_1653 268
201 3300048913 Ga0496110_0067836 Ga0496110_0067836_1161_1967 268
202 3300048917 Ga0496114_0001965 Ga0496114_0001965_10027_10833 268
203 3300048928 Ga0496125_0000897 Ga0496125_0000897_26174_26980 268
204 3300048929 Ga0496126_0092454 Ga0496126_0092454_359_1165 268
205 3300050511 nmdc:mga08y16_79347_c1 nmdc:mga08y16_79347_c1_352_1158 268
206 3300050511 nmdc:mga08y16_8470_c1 nmdc:mga08y16_8470_c1_7723_8529 268
207 3300053156 Ga0500622_0159377 Ga0500622_0159377_187_993 268
208 3300028794 Ga0307515_10000109 Ga0307515_10000109107 269
209 3300028794 Ga0307515_10003752 Ga0307515_1000375222 269
210 3300028794 Ga0307515_10008086 Ga0307515_1000808621 269
211 3300030522 Ga0307512_10140542 Ga0307512_101405422 269
212 3300031456 Ga0307513_10005597 Ga0307513_100055975 269
213 3300031456 Ga0307513_10263383 Ga0307513_102633832 269
214 3300031507 Ga0307509_10044010 Ga0307509_100440104 269
215 3300031616 Ga0307508_10000237 Ga0307508_1000023745 269
216 3300031649 Ga0307514_10002703 Ga0307514_1000270314 269
217 3300031730 Ga0307516_10004413 Ga0307516_100044132 269
218 3300033179 Ga0307507_10050232 Ga0307507_100502324 269
219 3300041460 Ga0451802_1361253 Ga0451802_1361253_457_1266 269
220 3300044712 Ga0453684_0356526 Ga0453684_0356526_371_1180 269
221 3300046512 Ga0495610_0068740 Ga0495610_0068740_671_1480 269
222 3300046519 Ga0495632_0045174 Ga0495632_0045174_1060_1869 269
223 3300046522 Ga0495643_0161601 Ga0495643_0161601_109_918 269
224 3300046660 Ga0495625_0008918 Ga0495625_0008918_6535_7344 269
225 3300048905 Ga0496102_0006709 Ga0496102_0006709_1035_1844 269
226 3300053739 Ga0500587_000965 Ga0500587_000965_1741_2550 269
227 3300036401 Ga0373937_0618487 Ga0373937_0618487_96_908 270
228 3300047472 Ga0495686_0002833 Ga0495686_0002833_1758_2570 270
229 3300031730 Ga0307516_10030827 Ga0307516_100308275 271
230 3300037471 Ga0395905_0761492 Ga0395905_0761492_37_852 271
231 3300048905 Ga0496102_0096707 Ga0496102_0096707_804_1622 271
232 iso_pu_bacteria 2881101125 2881104615 271
233 3300005327 Ga0070658_10344082 Ga0070658_103440822 272
234 3300005367 Ga0070667_100002713 Ga0070667_1000027136 272
235 3300005539 Ga0068853_100261858 Ga0068853_1002618582 272
236 3300013308 Ga0157375_10406163 Ga0157375_104061632 272
237 3300015262 Ga0182007_10038927 Ga0182007_100389272 272
238 3300026041 Ga0207639_10151324 Ga0207639_101513243 272
239 3300037312 Ga0395899_0001824 Ga0395899_0001824_16492_17310 272
240 3300037312 Ga0395899_0179349 Ga0395899_0179349_649_1467 272
241 3300037418 Ga0395900_0001965 Ga0395900_0001965_20249_21067 272
242 3300037418 Ga0395900_0089603 Ga0395900_0089603_775_1593 272
243 3300037466 Ga0395898_0004351 Ga0395898_0004351_2656_3474 272
244 3300037471 Ga0395905_0001479 Ga0395905_0001479_26628_27446 272
245 3300037471 Ga0395905_0128087 Ga0395905_0128087_1238_2056 272
246 3300038443 Ga0395901_0163461 Ga0395901_0163461_725_1543 272
247 3300044658 Ga0466972_0205761 Ga0466972_0205761_89_910 272
248 3300049571 Ga0501034_0066935 Ga0501034_0066935_1659_2477 272
249 3300049574 Ga0501038_0114557 Ga0501038_0114557_1271_2089 272
250 3300049580 Ga0501046_0081411 Ga0501046_0081411_1263_2081 272
251 3300049581 Ga0501047_0224133 Ga0501047_0224133_122_940 272
252 3300049742 Ga0501080_0130399 Ga0501080_0130399_421_1239 272
253 3300049822 Ga0501035_0051481 Ga0501035_0051481_1338_2156 272
254 3300049823 Ga0501044_0016678 Ga0501044_0016678_6019_6837 272
255 3300053154 Ga0500619_000148 Ga0500619_000148_14397_15218 272
256 3300005435 Ga0070714_100617532 Ga0070714_1006175322 273
257 3300005563 Ga0068855_100231856 Ga0068855_1002318563 273
258 3300005614 Ga0068856_100245190 Ga0068856_1002451903 273
259 3300006195 Ga0075366_10062562 Ga0075366_100625622 273
260 3300014497 Ga0182008_10069576 Ga0182008_100695762 273
261 3300014969 Ga0157376_10068766 Ga0157376_100687662 273
262 3300025924 Ga0207694_10084062 Ga0207694_100840624 273
263 3300025927 Ga0207687_10407551 Ga0207687_104075512 273
264 3300025949 Ga0207667_10313230 Ga0207667_103132302 273
265 3300026023 Ga0207677_10051081 Ga0207677_100510814 273
266 3300026078 Ga0207702_10058293 Ga0207702_100582934 273
267 3300041406 Ga0439439_0031243 Ga0439439_0031243_350_1231 273
268 3300042007 Ga0439449_0006081 Ga0439449_0006081_2187_3068 273
269 3300042014 Ga0439457_015879 Ga0439457_015879_125_1006 273
270 3300042015 Ga0439462_0029032 Ga0439462_0029032_52_933 273
271 3300044656 Ga0466969_0031093 Ga0466969_0031093_673_1494 273
272 3300044684 Ga0466966_0027666 Ga0466966_0027666_1450_2271 273
273 3300044765 Ga0466970_0028139 Ga0466970_0028139_650_1471 273
274 3300045049 Ga0466959_0041726 Ga0466959_0041726_914_1735 273
275 3300046519 Ga0495632_0033901 Ga0495632_0033901_1477_2319 273
276 3300046542 Ga0495597_0069621 Ga0495597_0069621_336_1178 273
277 3300046660 Ga0495625_0023793 Ga0495625_0023793_2904_3746 273
278 3300046694 Ga0495649_0005488 Ga0495649_0005488_4143_4985 273
279 3300046810 Ga0495660_0036107 Ga0495660_0036107_1048_1890 273
280 3300047443 Ga0495687_006998 Ga0495687_006998_1062_1904 273
281 3300048091 Ga0495626_0057460 Ga0495626_0057460_766_1608 273
282 3300049460 Ga0495682_0048796 Ga0495682_0048796_150_992 273
283 3300053139 Ga0500568_0009042 Ga0500568_0009042_3029_3871 273
284 3300005367 Ga0070667_100261412 Ga0070667_1002614122 274
285 3300005455 Ga0070663_100094383 Ga0070663_1000943832 274
286 3300005577 Ga0068857_100013704 Ga0068857_1000137048 274
287 3300005578 Ga0068854_100203760 Ga0068854_1002037602 274
288 3300005616 Ga0068852_100306503 Ga0068852_1003065032 274
289 3300005617 Ga0068859_100225529 Ga0068859_1002255292 274
290 3300006042 Ga0075368_10139290 Ga0075368_101392902 274
291 3300006177 Ga0075362_10000229 Ga0075362_100002296 274
292 3300006178 Ga0075367_10007590 Ga0075367_100075904 274
293 3300006186 Ga0075369_10022204 Ga0075369_100222042 274
294 3300006195 Ga0075366_10017236 Ga0075366_100172363 274
295 3300006931 Ga0097620_100225515 Ga0097620_1002255152 274
296 3300025907 Ga0207645_10080939 Ga0207645_100809393 274
297 3300025914 Ga0207671_10049198 Ga0207671_100491984 274
298 3300025935 Ga0207709_10114850 Ga0207709_101148502 274
299 3300025942 Ga0207689_10135141 Ga0207689_101351411 274
300 3300025981 Ga0207640_10188173 Ga0207640_101881732 274
301 3300026089 Ga0207648_10212697 Ga0207648_102126972 274
302 3300026116 Ga0207674_10011249 Ga0207674_100112492 274
303 3300026116 Ga0207674_10127873 Ga0207674_101278732 274
304 3300028794 Ga0307515_10136069 Ga0307515_101360692 274
305 3300031456 Ga0307513_10056984 Ga0307513_100569844 274
306 3300031456 Ga0307513_10162089 Ga0307513_101620893 274
307 3300046522 Ga0495643_0105051 Ga0495643_0105051_187_1029 274
308 3300048090 Ga0495615_0005611 Ga0495615_0005611_1302_2126 274
309 3300050493 nmdc:mga0k408_29030_c1 nmdc:mga0k408_29030_c1_1567_2409 274
310 3300050494 nmdc:mga06z11_16536_c1 nmdc:mga06z11_16536_c1_2243_3085 274
311 3300050496 nmdc:mga07m45_152854_c1 nmdc:mga07m45_152854_c1_125_967 274
312 3300042134 Ga0450898_007335 Ga0450898_007335_277_1107 275
313 3300053108 Ga0500562_006388 Ga0500562_006388_1084_1914 275
314 3300006042 Ga0075368_10072514 Ga0075368_100725142 276
315 3300006353 Ga0075370_10008287 Ga0075370_100082874 276
316 3300025910 Ga0207684_10003656 Ga0207684_1000365612 276
317 3300025922 Ga0207646_10042219 Ga0207646_100422193 276
318 3300028794 Ga0307515_10003726 Ga0307515_1000372623 276
319 3300031456 Ga0307513_10048115 Ga0307513_100481152 276
320 3300031649 Ga0307514_10001452 Ga0307514_1000145211 276
321 3300031911 Ga0307412_10138181 Ga0307412_101381812 276
322 3300042004 Ga0439445_0003784 Ga0439445_0003784_1830_2663 276
323 3300042115 Ga0450911_000381 Ga0450911_000381_3739_4572 276
324 3300048928 Ga0496125_0029331 Ga0496125_0029331_2683_3516 276
325 3300048928 Ga0496125_0044012 Ga0496125_0044012_1181_2014 276
326 3300048929 Ga0496126_0081697 Ga0496126_0081697_1540_2373 276
327 3300044712 Ga0453684_0055538 Ga0453684_0055538_2357_3205 279
328 3300046530 Ga0495654_0001949 Ga0495654_0001949_2595_3437 279
329 3300059426 Ga0590077_046178 Ga0590077_046178_52_933 279
330 3300037471 Ga0395905_0022430 Ga0395905_0022430_4699_5547 281
331 3300035398 Ga0316574_0035348 Ga0316574_0035348_433_1287 283
332 3300039110 Ga0400487_34970 Ga0400487_34970_211364_212281 283
333 3300046810 Ga0495660_0060409 Ga0495660_0060409_262_1131 284
334 3300044842 Ga0466957_0058877 Ga0466957_0058877_244_1119 289
335 3300037418 Ga0395900_0020850 Ga0395900_0020850_1693_2568 290
336 3300037471 Ga0395905_0105772 Ga0395905_0105772_1394_2269 290
337 3300003792 Ga0055540_1003582 Ga0055540_10035826 291
338 3300003794 Ga0055531_10000222 Ga0055531_1000022255 291
339 3300025273 Ga0209673_1012214 Ga0209673_10122144 291
340 3300025303 Ga0209051_1001161 Ga0209051_100116118 291
341 3300025304 Ga0209257_1000446 Ga0209257_100044672 291
342 3300042125 Ga0450923_013861 Ga0450923_013861_154_1032 291
343 3300042128 Ga0450897_003195 Ga0450897_003195_375_1253 291
344 3300042133 Ga0450896_011598 Ga0450896_011598_238_1116 291
345 3300042156 Ga0439446_0010914 Ga0439446_0010914_1057_1935 291
346 3300042435 Ga0439434_0028886 Ga0439434_0028886_312_1190 291
347 3300042438 Ga0439459_0038366 Ga0439459_0038366_83_961 291
348 3300042439 Ga0439464_0003273 Ga0439464_0003273_1114_1992 291
349 3300044673 Ga0453683_0001005 Ga0453683_0001005_3969_4847 291
350 3300049574 Ga0501038_0163371 Ga0501038_0163371_523_1401 291
351 3300049581 Ga0501047_0290906 Ga0501047_0290906_458_1339 291
352 3300049581 Ga0501047_0337571 Ga0501047_0337571_77_955 291
353 3300049589 Ga0501073_0275591 Ga0501073_0275591_84_962 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

29

151

0.99

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

154

290

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5us6-assembly2.cif.gz_H structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.9669 27 290
5us6-assembly1.cif.gz_D structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.9665 27 291
5tej-assembly1.cif.gz_A structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh 0.9617 27 290
5us6-assembly1.cif.gz_D structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.9593 27 291
5ugj-assembly1.cif.gz_A crystal structure of htpa reductase from neisseria meningitidis 0.9576 28 289
ID Description Score Start End Superfamily
5us6H01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9705 27 290 3.40.50.720
af_P04036_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9697 26 138 3.40.50.720
3ijpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9614 27 289 3.40.50.720
af_P04036_6_261_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9614 28 281 2.40.10.10
5ugjB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 27 291 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A258B9M0-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 1.001 27 134 GO:0008839
GO:0009089
GO:0019877
AF-A0A536ZR58-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9933 38 152 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A4Q3IMP3-F1-model_v4 deleted 0.9875 25 116
AF-D3A833-F1-model_v4 deleted 0.9866 25 144
AF-A0A2N1ZH10-F1-model_v4 deleted 0.9796 27 163

Feature Viewer

pLDDT pTM Quality
88.14 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map