F419476

General Info

Members Datasets Scaffolds Average Seq Length
353 218 353 269

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2614339|Ga0451807_2614339_165_1079
Length 304
Sequence MMHPMVNTAVKAARRAGNIINRASQNLDILAVSEKAVHDYVSEVDREAEQAIIRILHEAYPSHAILAEESGASGKSEYQWIIDPLDGTTNFLHGFPQYAVSIALAHKEVMSQAVIYDPVRNDLFTASRGRGAYLNDKRLRISKRIKLNKSLIGTGFPFREFAHIDAYLAIFRDLTEKTSGMRRAGAATLDLAYVAAGRLDGFWEFGLSPWDMAAGSLLITESGGLVGDLEGNSGYMQSGNIVAGNPLVFGQLIQALAPHLTPALKTKTRPKGRVLRFCALSQRDGKSRSHLTVLQARSGRLLPT

Samples

Sample ID Description Type Environment
1 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
149 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 6.52
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055535_1000167 3300003761 Bacteria 71096
2 Ga0070658_10019827 3300005327 Bacteria 5386
3 Ga0070676_10254328 3300005328 Bacteria 1174
4 Ga0070683_100004472 3300005329 Bacteria 11534
5 Ga0070690_100052825 3300005330 Bacteria 2598
6 Ga0070690_100139640 3300005330 Bacteria 1644
7 Ga0070670_100000425 3300005331 Bacteria 34805
8 Ga0070670_100269894 3300005331 Bacteria 1484
9 Ga0068869_100365476 3300005334 Bacteria 1179
10 Ga0068869_100525804 3300005334 Bacteria 991
11 Ga0070666_10001027 3300005335 Bacteria 17099
12 Ga0070666_10183492 3300005335 Bacteria 1468
13 Ga0070680_100075389 3300005336 Bacteria 2777
14 Ga0070682_100126159 3300005337 Bacteria 1725
15 Ga0068868_100000145 3300005338 Bacteria 46047
16 Ga0068868_100054390 3300005338 Bacteria 3154
17 Ga0070660_100003022 3300005339 Bacteria 11582
18 Ga0070689_100038362 3300005340 Bacteria 3665
19 Ga0070687_100067545 3300005343 Bacteria 1909
20 Ga0070661_100002717 3300005344 Bacteria 12130
21 Ga0070669_100101562 3300005353 Bacteria 2170
22 Ga0070675_100003704 3300005354 Bacteria 11616
23 Ga0070675_100132216 3300005354 Bacteria 2127
24 Ga0070675_100253631 3300005354 Bacteria 1540
25 Ga0070675_100257994 3300005354 Bacteria 1527
26 Ga0070671_100077132 3300005355 Bacteria 2785
27 Ga0070674_100103848 3300005356 Bacteria 2076
28 Ga0070674_100210541 3300005356 Bacteria 1506
29 Ga0070673_100002718 3300005364 Bacteria 10846
30 Ga0070673_100110218 3300005364 Bacteria 2281
31 Ga0070673_100168986 3300005364 Bacteria 1865
32 Ga0070659_100027679 3300005366 Bacteria 4370
33 Ga0070667_100028749 3300005367 Bacteria 4629
34 Ga0070714_100000938 3300005435 Bacteria 20743
35 Ga0070714_100035146 3300005435 Bacteria 4198
36 Ga0070714_100050143 3300005435 Bacteria 3554
37 Ga0070713_100121133 3300005436 Bacteria 2295
38 Ga0070713_100185935 3300005436 Bacteria 1870
39 Ga0070701_10024119 3300005438 Bacteria 2940
40 Ga0070701_10191312 3300005438 Bacteria 1204
41 Ga0070705_100042140 3300005440 Bacteria 2608
42 Ga0070700_100080913 3300005441 Bacteria 2097
43 Ga0070663_100136791 3300005455 Bacteria 1866
44 Ga0070678_100000715 3300005456 Bacteria 16451
45 Ga0070678_100155753 3300005456 Bacteria 1845
46 Ga0070662_100215034 3300005457 Bacteria 1531
47 Ga0070662_100478331 3300005457 Bacteria 1037
48 Ga0070681_10034307 3300005458 Bacteria 5095
49 Ga0070681_10430075 3300005458 Bacteria 1232
50 Ga0068867_100537596 3300005459 Bacteria 1010
51 Ga0068867_100561060 3300005459 Bacteria 990
52 Ga0070697_100183535 3300005536 Bacteria 1774
53 Ga0070672_100013925 3300005543 Bacteria 5690
54 Ga0070672_100422687 3300005543 Bacteria 1145
55 Ga0070695_100011070 3300005545 Bacteria 5391
56 Ga0070665_100036872 3300005548 Bacteria 4917
57 Ga0070665_100059310 3300005548 Bacteria 3836
58 Ga0070704_100127730 3300005549 Bacteria 1964
59 Ga0070704_100539688 3300005549 Bacteria 1018
60 Ga0068855_100000072 3300005563 Bacteria 121486
61 Ga0068855_100196913 3300005563 Bacteria 2270
62 Ga0070664_100000316 3300005564 Bacteria 35228
63 Ga0070702_100093426 3300005615 Bacteria 1829
64 Ga0068852_100000229 3300005616 Bacteria 38015
65 Ga0068859_100147026 3300005617 Bacteria 2432
66 Ga0068859_100196445 3300005617 Bacteria 2102
67 Ga0068864_100047430 3300005618 Bacteria 3690
68 Ga0068864_100074562 3300005618 Bacteria 2961
69 Ga0068861_100202953 3300005719 Bacteria 1665
70 Ga0068851_10005868 3300005834 Bacteria 5592
71 Ga0068851_10156404 3300005834 Bacteria 1249
72 Ga0068863_100025456 3300005841 Bacteria 5643
73 Ga0068863_100026541 3300005841 Bacteria 5524
74 Ga0068858_100005423 3300005842 Bacteria 12496
75 Ga0068860_100005932 3300005843 Bacteria 12294
76 Ga0068862_100397048 3300005844 Bacteria 1289
77 Ga0070712_100253559 3300006175 Bacteria 1407
78 Ga0097621_100001309 3300006237 Bacteria 17131
79 Ga0097621_100238420 3300006237 Bacteria 1589
80 Ga0068871_100001685 3300006358 Bacteria 14824
81 Ga0068871_100005027 3300006358 Bacteria 9238
82 Ga0075428_100001685 3300006844 Bacteria 23558
83 Ga0075428_100262298 3300006844 Bacteria 1860
84 Ga0075430_100015343 3300006846 Bacteria 6525
85 Ga0075431_100000405 3300006847 Bacteria 34877
86 Ga0075433_10004572 3300006852 Bacteria 10793
87 Ga0075434_100001228 3300006871 Bacteria 21308
88 Ga0075434_100399941 3300006871 Unclassified 1394
89 Ga0075429_100010491 3300006880 Bacteria 8011
90 Ga0075429_100161867 3300006880 Bacteria 1960
91 Ga0097620_100147034 3300006931 Bacteria 2432
92 Ga0097620_100196423 3300006931 Bacteria 2102
93 Ga0075435_100112915 3300007076 Bacteria 2261
94 Ga0099794_10073521 3300007265 Bacteria 1678
95 Ga0099795_10000001 3300007788 Bacteria 179944
96 Ga0099795_10001756 3300007788 Bacteria 4850
97 Ga0111539_10013818 3300009094 Bacteria 10090
98 Ga0111539_10040464 3300009094 Bacteria 5612
99 Ga0111539_10218303 3300009094 Bacteria 2221
100 Ga0105245_10012117 3300009098 Bacteria 7498
101 Ga0105245_10040112 3300009098 Bacteria 4169
102 Ga0114129_10172397 3300009147 Bacteria 2948
103 Ga0105242_10073964 3300009176 Bacteria 2834
104 Ga0105242_10266441 3300009176 Bacteria 1550
105 Ga0105248_10130650 3300009177 Bacteria 2833
106 Ga0105248_10143914 3300009177 Bacteria 2690
107 Ga0105237_10461432 3300009545 Bacteria 1276
108 Ga0105238_10212884 3300009551 Bacteria 1909
109 Ga0099796_10000001 3300010159 Bacteria 107173
110 Ga0157371_10289519 3300013102 Bacteria 1184
111 Ga0157370_10027902 3300013104 Bacteria 5561
112 Ga0157369_10779723 3300013105 Bacteria 983
113 Ga0157374_10000860 3300013296 Bacteria 26547
114 Ga0157374_10018024 3300013296 Bacteria 6226
115 Ga0157378_10004072 3300013297 Bacteria 12914
116 Ga0157378_10065959 3300013297 Bacteria 3241
117 Ga0163162_10016546 3300013306 Bacteria 7207
118 Ga0163162_10412550 3300013306 Bacteria 1483
119 Ga0157375_10007106 3300013308 Bacteria 9777
120 Ga0157375_10388958 3300013308 Bacteria 1561
121 Ga0163163_10002837 3300014325 Bacteria 14648
122 Ga0157380_10110041 3300014326 Bacteria 2313
123 Ga0157380_10113111 3300014326 Bacteria 2285
124 Ga0157380_10139807 3300014326 Bacteria 2078
125 Ga0157377_10035191 3300014745 Bacteria 2745
126 Ga0157379_10004663 3300014968 Bacteria 11761
127 Ga0157376_10004036 3300014969 Bacteria 10152
128 Ga0157376_10014114 3300014969 Bacteria 5983
129 Ga0163161_10236604 3300017792 Bacteria 1419
130 Ga0207656_10008437 3300025321 Bacteria 3794
131 Ga0207656_10083694 3300025321 Bacteria 1438
132 Ga0207682_10003380 3300025893 Bacteria 6947
133 Ga0207645_10034564 3300025907 Bacteria 3248
134 Ga0207643_10009078 3300025908 Bacteria 5340
135 Ga0207705_10008649 3300025909 Bacteria 7419
136 Ga0207707_10061039 3300025912 Bacteria 3280
137 Ga0207707_10386010 3300025912 Bacteria 1203
138 Ga0207662_10068403 3300025918 Bacteria 2145
139 Ga0207646_10045803 3300025922 Bacteria 3925
140 Ga0207681_10453240 3300025923 Bacteria 1044
141 Ga0207694_10151899 3300025924 Bacteria 1866
142 Ga0207650_10001393 3300025925 Bacteria 17447
143 Ga0207659_10003124 3300025926 Bacteria 9898
144 Ga0207659_10032634 3300025926 Bacteria 3576
145 Ga0207659_10085094 3300025926 Bacteria 2348
146 Ga0207664_10001788 3300025929 Bacteria 14163
147 Ga0207664_10049216 3300025929 Bacteria 3317
148 Ga0207690_10017584 3300025932 Bacteria 4370
149 Ga0207706_10019630 3300025933 Bacteria 6080
150 Ga0207686_10193236 3300025934 Bacteria 1452
151 Ga0207670_10050295 3300025936 Bacteria 2792
152 Ga0207669_10073322 3300025937 Bacteria 2159
153 Ga0207691_10000667 3300025940 Bacteria 33915
154 Ga0207691_10053596 3300025940 Bacteria 3682
155 Ga0207691_10120645 3300025940 Bacteria 2324
156 Ga0207691_10260991 3300025940 Bacteria 1493
157 Ga0207711_10002694 3300025941 Bacteria 15698
158 Ga0207711_10014099 3300025941 Bacteria 6641
159 Ga0207689_10048275 3300025942 Bacteria 3511
160 Ga0207689_10141572 3300025942 Bacteria 1981
161 Ga0207661_10002441 3300025944 Bacteria 12808
162 Ga0207679_10000649 3300025945 Bacteria 23237
163 Ga0207679_10145906 3300025945 Bacteria 1919
164 Ga0207651_10061319 3300025960 Bacteria 2615
165 Ga0207651_10426143 3300025960 Bacteria 1134
166 Ga0207668_10476564 3300025972 Bacteria 1070
167 Ga0207658_10009511 3300025986 Bacteria 6598
168 Ga0207677_10002541 3300026023 Bacteria 9570
169 Ga0207677_10119344 3300026023 Bacteria 1980
170 Ga0207677_10203741 3300026023 Bacteria 1574
171 Ga0207703_10069468 3300026035 Bacteria 2905
172 Ga0207678_10160899 3300026067 Bacteria 1917
173 Ga0207708_10038460 3300026075 Bacteria 3644
174 Ga0207641_10004933 3300026088 Bacteria 11459
175 Ga0207641_10018984 3300026088 Bacteria 5640
176 Ga0207648_10030965 3300026089 Bacteria 4733
177 Ga0207648_10374245 3300026089 Bacteria 1287
178 Ga0207676_10038029 3300026095 Bacteria 3671
179 Ga0207676_10057056 3300026095 Bacteria 3074
180 Ga0207674_10049157 3300026116 Bacteria 4314
181 Ga0207674_10348966 3300026116 Bacteria 1431
182 Ga0207675_100065930 3300026118 Bacteria 3384
183 Ga0207683_10001353 3300026121 Bacteria 22149
184 Ga0207683_10132779 3300026121 Bacteria 2240
185 Ga0207698_10000201 3300026142 Bacteria 37485
186 Ga0209179_1000006 3300027512 Bacteria 101289
187 Ga0209971_1020636 3300027682 Bacteria 1567
188 Ga0207428_10376002 3300027907 Bacteria 1043
189 Ga0268266_10034651 3300028379 Bacteria 4294
190 Ga0268266_10040174 3300028379 Bacteria 3987
191 Ga0268266_10372741 3300028379 Bacteria 1345
192 Ga0268265_10293347 3300028380 Bacteria 1461
193 Ga0268265_10392762 3300028380 Bacteria 1280
194 Ga0268264_10169199 3300028381 Bacteria 1975
195 Ga0265326_10000879 3300028558 Bacteria 10929
196 Ga0265326_10008960 3300028558 Bacteria 2998
197 Ga0265334_10000015 3300028573 Bacteria 150318
198 Ga0265334_10012646 3300028573 Bacteria 3544
199 Ga0265334_10076576 3300028573 Bacteria 1239
200 Ga0265323_10005604 3300028653 Bacteria 5327
201 Ga0265322_10020853 3300028654 Bacteria 1877
202 Ga0265338_10005171 3300028800 Bacteria 17142
203 Ga0265338_10147851 3300028800 Bacteria 1830
204 Ga0265330_10046389 3300031235 Bacteria 1915
205 Ga0265332_10001626 3300031238 Bacteria 12300
206 Ga0265332_10007450 3300031238 Bacteria 4946
207 Ga0265328_10009856 3300031239 Bacteria 3869
208 Ga0265328_10094912 3300031239 Bacteria 1103
209 Ga0265320_10107249 3300031240 Bacteria 1282
210 Ga0265331_10003020 3300031250 Bacteria 11038
211 Ga0265331_10003444 3300031250 Bacteria 10229
212 Ga0265331_10076046 3300031250 Bacteria 1565
213 Ga0265327_10000133 3300031251 Bacteria 163887
214 Ga0265327_10000542 3300031251 Bacteria 64581
215 Ga0265327_10017618 3300031251 Bacteria 4470
216 Ga0265316_10000744 3300031344 Bacteria 36026
217 Ga0265316_10093678 3300031344 Bacteria 2289
218 Ga0307509_10000075 3300031507 Bacteria 139230
219 Ga0307408_100274899 3300031548 Bacteria 1400
220 Ga0265313_10000277 3300031595 Bacteria 56206
221 Ga0265313_10009298 3300031595 Bacteria 6394
222 Ga0265314_10000335 3300031711 Bacteria 66101
223 Ga0265342_10031276 3300031712 Bacteria 3292
224 Ga0316576_10023367 3300031727 Bacteria 4305
225 Ga0316577_10008398 3300031733 Bacteria 5534
226 Ga0316577_10020998 3300031733 Bacteria 3620
227 Ga0307412_10253090 3300031911 Bacteria 1369
228 Ga0307416_100114615 3300032002 Bacteria 2385
229 Ga0316583_10005090 3300032133 Bacteria 4706
230 Ga0316585_10011152 3300032137 Bacteria 2646
231 Ga0307510_10252581 3300033180 Bacteria 1250
232 Ga0373934_0121447 3300035086 Bacteria 1063
233 Ga0373936_0059454 3300035113 Bacteria 1558
234 Ga0373956_0083627 3300035119 Bacteria 1467
235 Ga0373962_0063301 3300035242 Bacteria 1091
236 Ga0373931_0123239 3300035691 Bacteria 1484
237 Ga0373933_0036513 3300035724 Bacteria 2877
238 Ga0373933_0097291 3300035724 Bacteria 1823
239 Ga0373937_0150272 3300036401 Bacteria 2181
240 Ga0373937_0465853 3300036401 Bacteria 1200
241 Ga0316582_0112152 3300036647 Bacteria 1816
242 Ga0316582_0209160 3300036647 Bacteria 1332
243 Ga0373925_0398192 3300037068 Bacteria 1123
244 Ga0395901_0000533 3300038443 Bacteria 43906
245 Ga0451807_2614339 3300041486 Bacteria 1255
246 Ga0451577_0000600 3300042876 Bacteria 57931
247 Ga0451577_0005072 3300042876 Bacteria 13595
248 Ga0451577_0009608 3300042876 Bacteria 9285
249 Ga0451577_0036021 3300042876 Bacteria 4457
250 Ga0451577_0440942 3300042876 Bacteria 1182
251 Ga0453684_0000005 3300044712 Bacteria 1431632
252 Ga0453684_0000356 3300044712 Bacteria 189329
253 Ga0453684_0002166 3300044712 Bacteria 49117
254 Ga0453684_0002541 3300044712 Bacteria 43926
255 Ga0453684_0047079 3300044712 Bacteria 5725
256 Ga0453684_0058955 3300044712 Bacteria 4954
257 Ga0453684_0082346 3300044712 Bacteria 4009
258 Ga0453684_0221837 3300044712 Unclassified 2189
259 Ga0453684_0353799 3300044712 Bacteria 1655
260 Ga0453684_0473813 3300044712 Bacteria 1390
261 Ga0466970_0015640 3300044765 Bacteria 3905
262 Ga0451576_0000634 3300045051 Bacteria 73076
263 Ga0451576_0002387 3300045051 Bacteria 28262
264 Ga0451576_0012343 3300045051 Bacteria 9598
265 Ga0451576_0075251 3300045051 Bacteria 3513
266 Ga0451576_0230102 3300045051 Bacteria 1936
267 Ga0451576_0237444 3300045051 Bacteria 1904
268 Ga0451576_0840879 3300045051 Bacteria 963
269 Ga0495603_0137281 3300046455 Bacteria 1423
270 Ga0495642_0032982 3300046528 Bacteria 2081
271 Ga0495670_0069415 3300046691 Bacteria 1782
272 Ga0496100_0065688 3300048903 Bacteria 2405
273 Ga0496101_0018622 3300048904 Bacteria 4725
274 Ga0496102_0217706 3300048905 Bacteria 1800
275 Ga0496104_0030300 3300048907 Bacteria 5026
276 Ga0496104_0047596 3300048907 Bacteria 4041
277 Ga0496105_0004965 3300048908 Bacteria 10057
278 Ga0496105_0009078 3300048908 Bacteria 7756
279 Ga0496106_0194524 3300048909 Bacteria 1613
280 Ga0496108_0008184 3300048911 Bacteria 8486
281 Ga0496108_0123628 3300048911 Bacteria 2220
282 Ga0496109_0009828 3300048912 Bacteria 8165
283 Ga0496109_0018297 3300048912 Bacteria 6153
284 Ga0496110_0009462 3300048913 Bacteria 7889
285 Ga0496110_0069388 3300048913 Bacteria 3121
286 Ga0496110_0650697 3300048913 Bacteria 954
287 Ga0496111_0078748 3300048914 Bacteria 2403
288 Ga0496112_0755254 3300048915 Bacteria 899
289 Ga0496114_0007489 3300048917 Bacteria 8630
290 Ga0496114_0020480 3300048917 Bacteria 5368
291 Ga0496114_0098586 3300048917 Bacteria 2492
292 Ga0496114_0127385 3300048917 Bacteria 2196
293 Ga0496115_0033775 3300048918 Bacteria 4040
294 Ga0496122_0089649 3300048925 Unclassified 2102
295 Ga0496125_0007840 3300048928 Bacteria 11284
296 Ga0501033_0334871 3300049570 Bacteria 1062
297 Ga0501034_0032459 3300049571 Bacteria 5302
298 Ga0501034_0137042 3300049571 Bacteria 2428
299 Ga0501038_0055265 3300049574 Bacteria 3411
300 Ga0501039_0073631 3300049575 Bacteria 2654
301 Ga0501039_0264597 3300049575 Bacteria 1351
302 Ga0501040_0060378 3300049576 Bacteria 2605
303 Ga0501041_0000884 3300049577 Bacteria 16204
304 Ga0501041_0002450 3300049577 Bacteria 10538
305 Ga0501042_0031586 3300049578 Bacteria 3746
306 Ga0501043_0053993 3300049579 Bacteria 3155
307 Ga0501043_0203194 3300049579 Bacteria 1537
308 Ga0501048_0382542 3300049582 Bacteria 1005
309 Ga0501048_0474660 3300049582 Bacteria 896
310 Ga0501068_0136294 3300049584 Bacteria 1537
311 Ga0501068_0153991 3300049584 Bacteria 1446
312 Ga0501071_0070881 3300049587 Bacteria 2540
313 Ga0501071_0091162 3300049587 Bacteria 2239
314 Ga0501071_0557569 3300049587 Bacteria 880
315 Ga0501072_0017175 3300049588 Bacteria 5561
316 Ga0501072_0067834 3300049588 Bacteria 2815
317 Ga0501072_0253610 3300049588 Bacteria 1401
318 Ga0501073_0162704 3300049589 Bacteria 1546
319 Ga0501074_0162176 3300049590 Bacteria 1597
320 Ga0501075_0065866 3300049591 Bacteria 2733
321 Ga0501075_0273012 3300049591 Bacteria 1288
322 Ga0501076_0000468 3300049592 Bacteria 25466
323 Ga0501077_0026400 3300049593 Bacteria 3686
324 Ga0501077_0079534 3300049593 Bacteria 2077
325 Ga0501209_003130 3300049656 Bacteria 2678
326 Ga0501079_0015588 3300049741 Bacteria 5802
327 Ga0501079_0126920 3300049741 Bacteria 1984
328 Ga0501080_0132331 3300049742 Bacteria 2309
329 Ga0501080_0177925 3300049742 Bacteria 1959
330 Ga0501081_0002318 3300049743 Bacteria 11987
331 Ga0501081_0017127 3300049743 Bacteria 4794
332 Ga0501081_0054554 3300049743 Bacteria 2761
333 Ga0501081_0074275 3300049743 Bacteria 2372
334 Ga0501081_0483388 3300049743 Bacteria 922
335 Ga0501083_0217124 3300049744 Bacteria 1246
336 Ga0501045_0370673 3300049824 Bacteria 1066
337 nmdc:mga05p37_976373_c1 3300050507 Bacteria 903
338 nmdc:mga09592_40910_c1 3300050508 Bacteria 3895
339 nmdc:mga06r32_20088_c1 3300050510 Bacteria 6143
340 nmdc:mga08y16_116993_c1 3300050511 Bacteria 2775
341 nmdc:mga08y16_27642_c1 3300050511 Bacteria 5977
342 nmdc:mga0n895_239381_c1 3300050512 Bacteria 1841
343 nmdc:mga0n895_4260_c1 3300050512 Bacteria 11703
344 nmdc:mga0rr50_282417_c1 3300050513 Bacteria 1385
345 nmdc:mga0a205_5798_c2 3300050515 Bacteria 10708
346 Ga0500590_054878 3300053148 Bacteria 2017
347 Ga0500637_0111972 3300053178 Bacteria 1583
348 Ga0501084_0004288 3300054114 Bacteria 11611
349 Ga0501084_0024721 3300054114 Bacteria 5013
350 Ga0501082_0009058 3300060353 Bacteria 8584
351 Ga0501082_0066429 3300060353 Bacteria 3106
352 Ga0501082_0304083 3300060353 Bacteria 1389
353 Ga0530510_0254712 3300061734 Bacteria 1308

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100185935 Ga0070713_1001859351 222
2 3300005435 Ga0070714_100000938 Ga0070714_10000093819 223
3 3300025929 Ga0207664_10001788 Ga0207664_1000178813 223
4 3300028558 Ga0265326_10008960 Ga0265326_100089602 223
5 3300028573 Ga0265334_10000015 Ga0265334_1000001515 223
6 3300031595 Ga0265313_10000277 Ga0265313_1000027710 223
7 3300005435 Ga0070714_100050143 Ga0070714_1000501434 229
8 3300044712 Ga0453684_0221837 Ga0453684_0221837_1351_2091 245
9 3300050512 nmdc:mga0n895_239381_c1 nmdc:mga0n895_239381_c1_71_859 255
10 3300036401 Ga0373937_0465853 Ga0373937_0465853_21_791 256
11 3300048911 Ga0496108_0008184 Ga0496108_0008184_2866_3642 257
12 3300038443 Ga0395901_0000533 Ga0395901_0000533_846_1628 258
13 3300049570 Ga0501033_0334871 Ga0501033_0334871_198_995 259
14 3300009545 Ga0105237_10461432 Ga0105237_104614321 260
15 3300048925 Ga0496122_0089649 Ga0496122_0089649_588_1448 260
16 3300049582 Ga0501048_0382542 Ga0501048_0382542_150_932 260
17 3300035086 Ga0373934_0121447 Ga0373934_0121447_142_936 261
18 3300044765 Ga0466970_0015640 Ga0466970_0015640_302_1093 261
19 3300045051 Ga0451576_0237444 Ga0451576_0237444_546_1331 261
20 3300045051 Ga0451576_0840879 Ga0451576_0840879_118_906 261
21 3300005339 Ga0070660_100003022 Ga0070660_10000302211 262
22 3300009098 Ga0105245_10040112 Ga0105245_100401125 262
23 3300013306 Ga0163162_10412550 Ga0163162_104125502 262
24 3300044712 Ga0453684_0002541 Ga0453684_0002541_11946_12734 262
25 3300048917 Ga0496114_0007489 Ga0496114_0007489_2348_3142 262
26 3300048928 Ga0496125_0007840 Ga0496125_0007840_3280_4074 262
27 3300049742 Ga0501080_0177925 Ga0501080_0177925_16_804 262
28 3300005458 Ga0070681_10430075 Ga0070681_104300752 263
29 3300028558 Ga0265326_10000879 Ga0265326_100008797 263
30 3300028573 Ga0265334_10012646 Ga0265334_100126463 263
31 3300028573 Ga0265334_10076576 Ga0265334_100765762 263
32 3300028653 Ga0265323_10005604 Ga0265323_100056043 263
33 3300028654 Ga0265322_10020853 Ga0265322_100208531 263
34 3300028800 Ga0265338_10005171 Ga0265338_1000517115 263
35 3300031235 Ga0265330_10046389 Ga0265330_100463891 263
36 3300031250 Ga0265331_10076046 Ga0265331_100760461 263
37 3300031344 Ga0265316_10000744 Ga0265316_100007443 263
38 3300031595 Ga0265313_10009298 Ga0265313_100092985 263
39 3300031911 Ga0307412_10253090 Ga0307412_102530902 263
40 3300032002 Ga0307416_100114615 Ga0307416_1001146152 263
41 3300049571 Ga0501034_0137042 Ga0501034_0137042_180_971 263
42 3300049575 Ga0501039_0264597 Ga0501039_0264597_357_1148 263
43 3300049577 Ga0501041_0000884 Ga0501041_0000884_11772_12563 263
44 3300049579 Ga0501043_0053993 Ga0501043_0053993_1761_2552 263
45 3300049587 Ga0501071_0070881 Ga0501071_0070881_375_1166 263
46 3300049588 Ga0501072_0067834 Ga0501072_0067834_1667_2458 263
47 3300049591 Ga0501075_0065866 Ga0501075_0065866_1795_2586 263
48 3300049592 Ga0501076_0000468 Ga0501076_0000468_23050_23841 263
49 3300049593 Ga0501077_0026400 Ga0501077_0026400_1265_2056 263
50 3300049656 Ga0501209_003130 Ga0501209_003130_1117_1911 263
51 3300049741 Ga0501079_0015588 Ga0501079_0015588_4467_5258 263
52 3300049743 Ga0501081_0002318 Ga0501081_0002318_5964_6755 263
53 3300053148 Ga0500590_054878 Ga0500590_054878_631_1422 263
54 3300054114 Ga0501084_0024721 Ga0501084_0024721_28_819 263
55 3300060353 Ga0501082_0066429 Ga0501082_0066429_957_1748 263
56 3300005354 Ga0070675_100003704 Ga0070675_1000037042 264
57 3300005354 Ga0070675_100253631 Ga0070675_1002536312 264
58 3300005354 Ga0070675_100257994 Ga0070675_1002579942 264
59 3300005364 Ga0070673_100110218 Ga0070673_1001102183 264
60 3300005436 Ga0070713_100121133 Ga0070713_1001211332 264
61 3300005438 Ga0070701_10191312 Ga0070701_101913121 264
62 3300005459 Ga0068867_100537596 Ga0068867_1005375961 264
63 3300005543 Ga0070672_100422687 Ga0070672_1004226872 264
64 3300005549 Ga0070704_100127730 Ga0070704_1001277302 264
65 3300005563 Ga0068855_100196913 Ga0068855_1001969133 264
66 3300005617 Ga0068859_100196445 Ga0068859_1001964451 264
67 3300006175 Ga0070712_100253559 Ga0070712_1002535591 264
68 3300006844 Ga0075428_100001685 Ga0075428_10000168525 264
69 3300006844 Ga0075428_100262298 Ga0075428_1002622982 264
70 3300006852 Ga0075433_10004572 Ga0075433_100045727 264
71 3300006871 Ga0075434_100001228 Ga0075434_1000012287 264
72 3300006931 Ga0097620_100196423 Ga0097620_1001964231 264
73 3300007076 Ga0075435_100112915 Ga0075435_1001129152 264
74 3300007265 Ga0099794_10073521 Ga0099794_100735212 264
75 3300007788 Ga0099795_10001756 Ga0099795_100017562 264
76 3300009094 Ga0111539_10040464 Ga0111539_100404643 264
77 3300009094 Ga0111539_10218303 Ga0111539_102183032 264
78 3300009147 Ga0114129_10172397 Ga0114129_101723971 264
79 3300013308 Ga0157375_10388958 Ga0157375_103889582 264
80 3300014326 Ga0157380_10110041 Ga0157380_101100412 264
81 3300014326 Ga0157380_10139807 Ga0157380_101398073 264
82 3300025923 Ga0207681_10453240 Ga0207681_104532401 264
83 3300025926 Ga0207659_10085094 Ga0207659_100850942 264
84 3300025940 Ga0207691_10120645 Ga0207691_101206453 264
85 3300025942 Ga0207689_10048275 Ga0207689_100482752 264
86 3300025960 Ga0207651_10426143 Ga0207651_104261432 264
87 3300026089 Ga0207648_10374245 Ga0207648_103742452 264
88 3300026116 Ga0207674_10049157 Ga0207674_100491575 264
89 3300027907 Ga0207428_10376002 Ga0207428_103760021 264
90 3300028380 Ga0268265_10392762 Ga0268265_103927622 264
91 3300028800 Ga0265338_10147851 Ga0265338_101478513 264
92 3300033180 Ga0307510_10252581 Ga0307510_102525812 264
93 3300035113 Ga0373936_0059454 Ga0373936_0059454_122_916 264
94 3300035119 Ga0373956_0083627 Ga0373956_0083627_191_985 264
95 3300035724 Ga0373933_0097291 Ga0373933_0097291_237_1031 264
96 3300036401 Ga0373937_0150272 Ga0373937_0150272_406_1200 264
97 3300045051 Ga0451576_0012343 Ga0451576_0012343_4127_4924 264
98 3300046455 Ga0495603_0137281 Ga0495603_0137281_322_1119 264
99 3300048907 Ga0496104_0047596 Ga0496104_0047596_762_1556 264
100 3300048908 Ga0496105_0009078 Ga0496105_0009078_1457_2251 264
101 3300048909 Ga0496106_0194524 Ga0496106_0194524_579_1376 264
102 3300048917 Ga0496114_0020480 Ga0496114_0020480_3204_3998 264
103 3300048918 Ga0496115_0033775 Ga0496115_0033775_964_1758 264
104 3300049574 Ga0501038_0055265 Ga0501038_0055265_1181_1978 264
105 3300049575 Ga0501039_0073631 Ga0501039_0073631_187_984 264
106 3300049576 Ga0501040_0060378 Ga0501040_0060378_200_997 264
107 3300049577 Ga0501041_0002450 Ga0501041_0002450_9130_9927 264
108 3300049578 Ga0501042_0031586 Ga0501042_0031586_639_1436 264
109 3300049579 Ga0501043_0203194 Ga0501043_0203194_206_1003 264
110 3300049582 Ga0501048_0474660 Ga0501048_0474660_41_838 264
111 3300049584 Ga0501068_0136294 Ga0501068_0136294_219_1016 264
112 3300049584 Ga0501068_0153991 Ga0501068_0153991_515_1312 264
113 3300049587 Ga0501071_0091162 Ga0501071_0091162_770_1567 264
114 3300049588 Ga0501072_0017175 Ga0501072_0017175_3025_3822 264
115 3300049588 Ga0501072_0253610 Ga0501072_0253610_224_1021 264
116 3300049590 Ga0501074_0162176 Ga0501074_0162176_741_1538 264
117 3300049591 Ga0501075_0273012 Ga0501075_0273012_361_1158 264
118 3300049593 Ga0501077_0079534 Ga0501077_0079534_911_1708 264
119 3300049741 Ga0501079_0126920 Ga0501079_0126920_996_1793 264
120 3300049742 Ga0501080_0132331 Ga0501080_0132331_196_993 264
121 3300049743 Ga0501081_0017127 Ga0501081_0017127_617_1414 264
122 3300049743 Ga0501081_0054554 Ga0501081_0054554_172_969 264
123 3300049743 Ga0501081_0074275 Ga0501081_0074275_534_1331 264
124 3300049743 Ga0501081_0483388 Ga0501081_0483388_62_859 264
125 3300049744 Ga0501083_0217124 Ga0501083_0217124_216_1013 264
126 3300049824 Ga0501045_0370673 Ga0501045_0370673_242_1039 264
127 3300050507 nmdc:mga05p37_976373_c1 nmdc:mga05p37_976373_c1_87_884 264
128 3300050511 nmdc:mga08y16_116993_c1 nmdc:mga08y16_116993_c1_62_859 264
129 3300050511 nmdc:mga08y16_27642_c1 nmdc:mga08y16_27642_c1_5157_5954 264
130 3300050512 nmdc:mga0n895_4260_c1 nmdc:mga0n895_4260_c1_235_1032 264
131 3300050515 nmdc:mga0a205_5798_c2 nmdc:mga0a205_5798_c2_3626_4423 264
132 3300054114 Ga0501084_0004288 Ga0501084_0004288_805_1602 264
133 3300060353 Ga0501082_0009058 Ga0501082_0009058_3511_4308 264
134 3300060353 Ga0501082_0304083 Ga0501082_0304083_460_1257 264
135 3300061734 Ga0530510_0254712 Ga0530510_0254712_287_1084 264
136 3300005330 Ga0070690_100139640 Ga0070690_1001396402 265
137 3300005563 Ga0068855_100000072 Ga0068855_10000007214 265
138 3300006880 Ga0075429_100010491 Ga0075429_1000104913 265
139 3300009094 Ga0111539_10013818 Ga0111539_100138189 265
140 3300031239 Ga0265328_10094912 Ga0265328_100949121 265
141 3300031250 Ga0265331_10003020 Ga0265331_1000302015 265
142 3300031251 Ga0265327_10000133 Ga0265327_10000133126 265
143 3300031733 Ga0316577_10020998 Ga0316577_100209983 265
144 3300035242 Ga0373962_0063301 Ga0373962_0063301_167_970 265
145 3300035691 Ga0373931_0123239 Ga0373931_0123239_502_1299 265
146 3300036647 Ga0316582_0209160 Ga0316582_0209160_466_1275 265
147 3300044712 Ga0453684_0082346 Ga0453684_0082346_2667_3464 265
148 3300044712 Ga0453684_0473813 Ga0453684_0473813_403_1200 265
149 3300045051 Ga0451576_0075251 Ga0451576_0075251_1343_2140 265
150 3300049589 Ga0501073_0162704 Ga0501073_0162704_478_1278 265
151 3300050508 nmdc:mga09592_40910_c1 nmdc:mga09592_40910_c1_2844_3647 265
152 3300005337 Ga0070682_100126159 Ga0070682_1001261591 266
153 3300005545 Ga0070695_100011070 Ga0070695_1000110701 266
154 3300005549 Ga0070704_100539688 Ga0070704_1005396881 266
155 3300014326 Ga0157380_10113111 Ga0157380_101131112 266
156 3300025912 Ga0207707_10386010 Ga0207707_103860102 266
157 3300005336 Ga0070680_100075389 Ga0070680_1000753892 267
158 3300005440 Ga0070705_100042140 Ga0070705_1000421402 267
159 3300005458 Ga0070681_10034307 Ga0070681_100343075 267
160 3300005536 Ga0070697_100183535 Ga0070697_1001835351 267
161 3300006846 Ga0075430_100015343 Ga0075430_1000153436 267
162 3300006847 Ga0075431_100000405 Ga0075431_10000040522 267
163 3300006871 Ga0075434_100399941 Ga0075434_1003999411 267
164 3300006880 Ga0075429_100161867 Ga0075429_1001618671 267
165 3300025912 Ga0207707_10061039 Ga0207707_100610393 267
166 3300025922 Ga0207646_10045803 Ga0207646_100458032 267
167 3300031238 Ga0265332_10007450 Ga0265332_100074505 267
168 3300031251 Ga0265327_10017618 Ga0265327_100176186 267
169 3300042876 Ga0451577_0000600 Ga0451577_0000600_20620_21423 267
170 3300042876 Ga0451577_0036021 Ga0451577_0036021_3352_4155 267
171 3300042876 Ga0451577_0440942 Ga0451577_0440942_356_1162 267
172 3300044712 Ga0453684_0000005 Ga0453684_0000005_306404_307207 267
173 3300044712 Ga0453684_0000356 Ga0453684_0000356_122803_123606 267
174 3300044712 Ga0453684_0002166 Ga0453684_0002166_6162_6965 267
175 3300045051 Ga0451576_0000634 Ga0451576_0000634_71732_72535 267
176 3300049571 Ga0501034_0032459 Ga0501034_0032459_2932_3735 267
177 3300050513 nmdc:mga0rr50_282417_c1 nmdc:mga0rr50_282417_c1_480_1283 267
178 3300053178 Ga0500637_0111972 Ga0500637_0111972_151_954 267
179 3300005327 Ga0070658_10019827 Ga0070658_100198273 268
180 3300005329 Ga0070683_100004472 Ga0070683_1000044725 268
181 3300005331 Ga0070670_100000425 Ga0070670_1000004253 268
182 3300005334 Ga0068869_100365476 Ga0068869_1003654761 268
183 3300005335 Ga0070666_10183492 Ga0070666_101834922 268
184 3300005338 Ga0068868_100000145 Ga0068868_10000014531 268
185 3300005344 Ga0070661_100002717 Ga0070661_1000027175 268
186 3300005356 Ga0070674_100103848 Ga0070674_1001038483 268
187 3300005364 Ga0070673_100002718 Ga0070673_1000027182 268
188 3300005366 Ga0070659_100027679 Ga0070659_1000276792 268
189 3300005435 Ga0070714_100035146 Ga0070714_1000351462 268
190 3300005455 Ga0070663_100136791 Ga0070663_1001367912 268
191 3300005456 Ga0070678_100000715 Ga0070678_1000007153 268
192 3300005457 Ga0070662_100215034 Ga0070662_1002150342 268
193 3300005543 Ga0070672_100013925 Ga0070672_1000139256 268
194 3300005548 Ga0070665_100059310 Ga0070665_1000593105 268
195 3300005564 Ga0070664_100000316 Ga0070664_1000003163 268
196 3300005615 Ga0070702_100093426 Ga0070702_1000934262 268
197 3300005616 Ga0068852_100000229 Ga0068852_10000022932 268
198 3300005618 Ga0068864_100047430 Ga0068864_1000474303 268
199 3300005834 Ga0068851_10005868 Ga0068851_100058686 268
200 3300005841 Ga0068863_100025456 Ga0068863_1000254565 268
201 3300006358 Ga0068871_100001685 Ga0068871_1000016859 268
202 3300009177 Ga0105248_10130650 Ga0105248_101306501 268
203 3300013102 Ga0157371_10289519 Ga0157371_102895191 268
204 3300013104 Ga0157370_10027902 Ga0157370_100279027 268
205 3300013105 Ga0157369_10779723 Ga0157369_107797231 268
206 3300013296 Ga0157374_10000860 Ga0157374_100008602 268
207 3300013297 Ga0157378_10004072 Ga0157378_100040725 268
208 3300014745 Ga0157377_10035191 Ga0157377_100351912 268
209 3300014969 Ga0157376_10014114 Ga0157376_100141142 268
210 3300025321 Ga0207656_10008437 Ga0207656_100084373 268
211 3300025909 Ga0207705_10008649 Ga0207705_100086493 268
212 3300025925 Ga0207650_10001393 Ga0207650_1000139316 268
213 3300025926 Ga0207659_10003124 Ga0207659_100031243 268
214 3300025929 Ga0207664_10049216 Ga0207664_100492162 268
215 3300025932 Ga0207690_10017584 Ga0207690_100175843 268
216 3300025937 Ga0207669_10073322 Ga0207669_100733221 268
217 3300025940 Ga0207691_10000667 Ga0207691_100006674 268
218 3300025941 Ga0207711_10014099 Ga0207711_100140992 268
219 3300025944 Ga0207661_10002441 Ga0207661_100024415 268
220 3300025945 Ga0207679_10000649 Ga0207679_1000064921 268
221 3300025960 Ga0207651_10061319 Ga0207651_100613192 268
222 3300026023 Ga0207677_10002541 Ga0207677_100025413 268
223 3300026067 Ga0207678_10160899 Ga0207678_101608992 268
224 3300026088 Ga0207641_10018984 Ga0207641_100189845 268
225 3300026095 Ga0207676_10038029 Ga0207676_100380292 268
226 3300026121 Ga0207683_10001353 Ga0207683_100013535 268
227 3300026142 Ga0207698_10000201 Ga0207698_100002012 268
228 3300028379 Ga0268266_10040174 Ga0268266_100401742 268
229 3300031507 Ga0307509_10000075 Ga0307509_1000007531 268
230 3300035724 Ga0373933_0036513 Ga0373933_0036513_115_921 268
231 3300037068 Ga0373925_0398192 Ga0373925_0398192_78_887 268
232 3300042876 Ga0451577_0009608 Ga0451577_0009608_4045_4857 268
233 3300044712 Ga0453684_0058955 Ga0453684_0058955_216_1043 268
234 3300045051 Ga0451576_0230102 Ga0451576_0230102_844_1656 268
235 3300048905 Ga0496102_0217706 Ga0496102_0217706_64_873 268
236 3300048912 Ga0496109_0009828 Ga0496109_0009828_507_1316 268
237 3300048913 Ga0496110_0009462 Ga0496110_0009462_2341_3150 268
238 3300048915 Ga0496112_0755254 Ga0496112_0755254_25_834 268
239 3300048917 Ga0496114_0098586 Ga0496114_0098586_1066_1875 268
240 3300031548 Ga0307408_100274899 Ga0307408_1002748992 269
241 3300044712 Ga0453684_0047079 Ga0453684_0047079_1701_2510 269
242 3300005328 Ga0070676_10254328 Ga0070676_102543281 270
243 3300005331 Ga0070670_100269894 Ga0070670_1002698942 270
244 3300005334 Ga0068869_100525804 Ga0068869_1005258041 270
245 3300005343 Ga0070687_100067545 Ga0070687_1000675451 270
246 3300005353 Ga0070669_100101562 Ga0070669_1001015622 270
247 3300005354 Ga0070675_100132216 Ga0070675_1001322162 270
248 3300005356 Ga0070674_100210541 Ga0070674_1002105412 270
249 3300005364 Ga0070673_100168986 Ga0070673_1001689862 270
250 3300005438 Ga0070701_10024119 Ga0070701_100241194 270
251 3300005441 Ga0070700_100080913 Ga0070700_1000809132 270
252 3300005456 Ga0070678_100155753 Ga0070678_1001557532 270
253 3300005457 Ga0070662_100478331 Ga0070662_1004783311 270
254 3300005459 Ga0068867_100561060 Ga0068867_1005610601 270
255 3300005719 Ga0068861_100202953 Ga0068861_1002029531 270
256 3300006237 Ga0097621_100238420 Ga0097621_1002384202 270
257 3300009176 Ga0105242_10266441 Ga0105242_102664412 270
258 3300017792 Ga0163161_10236604 Ga0163161_102366041 270
259 3300025893 Ga0207682_10003380 Ga0207682_100033807 270
260 3300025907 Ga0207645_10034564 Ga0207645_100345642 270
261 3300025908 Ga0207643_10009078 Ga0207643_100090783 270
262 3300025918 Ga0207662_10068403 Ga0207662_100684031 270
263 3300025926 Ga0207659_10032634 Ga0207659_100326342 270
264 3300025933 Ga0207706_10019630 Ga0207706_100196305 270
265 3300025934 Ga0207686_10193236 Ga0207686_101932362 270
266 3300025940 Ga0207691_10053596 Ga0207691_100535963 270
267 3300025940 Ga0207691_10260991 Ga0207691_102609911 270
268 3300025942 Ga0207689_10141572 Ga0207689_101415722 270
269 3300025945 Ga0207679_10145906 Ga0207679_101459061 270
270 3300025972 Ga0207668_10476564 Ga0207668_104765641 270
271 3300026023 Ga0207677_10203741 Ga0207677_102037412 270
272 3300026075 Ga0207708_10038460 Ga0207708_100384602 270
273 3300026089 Ga0207648_10030965 Ga0207648_100309655 270
274 3300026116 Ga0207674_10348966 Ga0207674_103489662 270
275 3300026118 Ga0207675_100065930 Ga0207675_1000659302 270
276 3300026121 Ga0207683_10132779 Ga0207683_101327792 270
277 3300028379 Ga0268266_10372741 Ga0268266_103727412 270
278 3300028381 Ga0268264_10169199 Ga0268264_101691992 270
279 3300031238 Ga0265332_10001626 Ga0265332_1000162610 270
280 3300031239 Ga0265328_10009856 Ga0265328_100098562 270
281 3300031240 Ga0265320_10107249 Ga0265320_101072492 270
282 3300031250 Ga0265331_10003444 Ga0265331_100034442 270
283 3300031251 Ga0265327_10000542 Ga0265327_1000054211 270
284 3300031344 Ga0265316_10093678 Ga0265316_100936781 270
285 3300031711 Ga0265314_10000335 Ga0265314_1000033535 270
286 3300031712 Ga0265342_10031276 Ga0265342_100312761 270
287 3300031727 Ga0316576_10023367 Ga0316576_100233673 270
288 3300031733 Ga0316577_10008398 Ga0316577_100083986 270
289 3300032133 Ga0316583_10005090 Ga0316583_100050904 270
290 3300032137 Ga0316585_10011152 Ga0316585_100111524 270
291 3300036647 Ga0316582_0112152 Ga0316582_0112152_92_904 270
292 3300046528 Ga0495642_0032982 Ga0495642_0032982_867_1757 270
293 3300046691 Ga0495670_0069415 Ga0495670_0069415_684_1574 270
294 3300048913 Ga0496110_0650697 Ga0496110_0650697_11_889 270
295 3300050510 nmdc:mga06r32_20088_c1 nmdc:mga06r32_20088_c1_2822_3634 270
296 3300027682 Ga0209971_1020636 Ga0209971_10206362 272
297 3300042876 Ga0451577_0005072 Ga0451577_0005072_1632_2456 272
298 3300044712 Ga0453684_0353799 Ga0453684_0353799_596_1420 272
299 3300045051 Ga0451576_0002387 Ga0451576_0002387_14836_15660 272
300 3300048917 Ga0496114_0127385 Ga0496114_0127385_848_1669 273
301 3300049587 Ga0501071_0557569 Ga0501071_0557569_45_869 273
302 3300005330 Ga0070690_100052825 Ga0070690_1000528252 274
303 3300005335 Ga0070666_10001027 Ga0070666_1000102710 274
304 3300005338 Ga0068868_100054390 Ga0068868_1000543902 274
305 3300005340 Ga0070689_100038362 Ga0070689_1000383622 274
306 3300005355 Ga0070671_100077132 Ga0070671_1000771322 274
307 3300005367 Ga0070667_100028749 Ga0070667_1000287494 274
308 3300005548 Ga0070665_100036872 Ga0070665_1000368722 274
309 3300005617 Ga0068859_100147026 Ga0068859_1001470262 274
310 3300005618 Ga0068864_100074562 Ga0068864_1000745623 274
311 3300005834 Ga0068851_10156404 Ga0068851_101564042 274
312 3300005841 Ga0068863_100026541 Ga0068863_1000265416 274
313 3300005842 Ga0068858_100005423 Ga0068858_10000542312 274
314 3300005843 Ga0068860_100005932 Ga0068860_1000059326 274
315 3300005844 Ga0068862_100397048 Ga0068862_1003970482 274
316 3300006237 Ga0097621_100001309 Ga0097621_10000130912 274
317 3300006358 Ga0068871_100005027 Ga0068871_1000050272 274
318 3300006931 Ga0097620_100147034 Ga0097620_1001470342 274
319 3300007788 Ga0099795_10000001 Ga0099795_1000000167 274
320 3300009098 Ga0105245_10012117 Ga0105245_100121178 274
321 3300009176 Ga0105242_10073964 Ga0105242_100739642 274
322 3300009177 Ga0105248_10143914 Ga0105248_101439142 274
323 3300009551 Ga0105238_10212884 Ga0105238_102128842 274
324 3300010159 Ga0099796_10000001 Ga0099796_1000000152 274
325 3300013296 Ga0157374_10018024 Ga0157374_100180245 274
326 3300013297 Ga0157378_10065959 Ga0157378_100659592 274
327 3300013306 Ga0163162_10016546 Ga0163162_100165463 274
328 3300013308 Ga0157375_10007106 Ga0157375_100071069 274
329 3300014325 Ga0163163_10002837 Ga0163163_1000283711 274
330 3300014968 Ga0157379_10004663 Ga0157379_1000466311 274
331 3300014969 Ga0157376_10004036 Ga0157376_100040366 274
332 3300025321 Ga0207656_10083694 Ga0207656_100836942 274
333 3300025924 Ga0207694_10151899 Ga0207694_101518992 274
334 3300025936 Ga0207670_10050295 Ga0207670_100502952 274
335 3300025941 Ga0207711_10002694 Ga0207711_1000269410 274
336 3300025986 Ga0207658_10009511 Ga0207658_100095113 274
337 3300026023 Ga0207677_10119344 Ga0207677_101193442 274
338 3300026035 Ga0207703_10069468 Ga0207703_100694682 274
339 3300026088 Ga0207641_10004933 Ga0207641_100049339 274
340 3300026095 Ga0207676_10057056 Ga0207676_100570562 274
341 3300027512 Ga0209179_1000006 Ga0209179_100000681 274
342 3300028379 Ga0268266_10034651 Ga0268266_100346512 274
343 3300028380 Ga0268265_10293347 Ga0268265_102933472 274
344 3300048903 Ga0496100_0065688 Ga0496100_0065688_641_1486 274
345 3300048904 Ga0496101_0018622 Ga0496101_0018622_3470_4315 274
346 3300048907 Ga0496104_0030300 Ga0496104_0030300_2132_2977 274
347 3300048908 Ga0496105_0004965 Ga0496105_0004965_1443_2288 274
348 3300048911 Ga0496108_0123628 Ga0496108_0123628_86_931 274
349 3300048912 Ga0496109_0018297 Ga0496109_0018297_4419_5264 274
350 3300048913 Ga0496110_0069388 Ga0496110_0069388_2062_2907 274
351 3300048914 Ga0496111_0078748 Ga0496111_0078748_1104_1949 274
352 3300041486 Ga0451807_2614339 Ga0451807_2614339_165_1079 275
353 3300003761 Ga0055535_1000167 Ga0055535_100016733 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

1

262

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9822 6 263
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9752 6 263
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.974 6 263
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9587 6 263
2qfl-assembly1.cif.gz_A structure of suhb: inositol monophosphatase and extragenic suppressor from e. coli 0.9572 5 261
ID Description Score Start End Superfamily
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9793 146 263 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9677 9 144 3.30.540.10
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9618 146 263 3.40.190.80
6ib8A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9592 146 264 3.40.190.80
af_Q54U72_147_270_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9488 147 262 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A837Q4N6-F1-model_v4 deleted 0.9863 5 153
AF-A0A4Q3Q142-F1-model_v4 deleted 0.9844 1 114
AF-A0A537GFE0-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9824 5 234 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A7C1PI53-F1-model_v4 Inositol monophosphatase 0.9811 134 262 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A528V7A3-F1-model_v4 Inositol monophosphatase 0.9804 109 206 GO:0006020
GO:0007165
GO:0008934

Feature Viewer

pLDDT pTM Quality
83.05 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map