F419476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 353 | 218 | 353 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_2614339|Ga0451807_2614339_165_1079 |
| Length | 304 |
| Sequence | MMHPMVNTAVKAARRAGNIINRASQNLDILAVSEKAVHDYVSEVDREAEQAIIRILHEAYPSHAILAEESGASGKSEYQWIIDPLDGTTNFLHGFPQYAVSIALAHKEVMSQAVIYDPVRNDLFTASRGRGAYLNDKRLRISKRIKLNKSLIGTGFPFREFAHIDAYLAIFRDLTEKTSGMRRAGAATLDLAYVAAGRLDGFWEFGLSPWDMAAGSLLITESGGLVGDLEGNSGYMQSGNIVAGNPLVFGQLIQALAPHLTPALKTKTRPKGRVLRFCALSQRDGKSRSHLTVLQARSGRLLPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 62 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 145 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 149 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 202 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 216 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 6.52 |
| Rhizosphere | 91.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055535_1000167 | 3300003761 | Bacteria | 71096 |
| 2 | Ga0070658_10019827 | 3300005327 | Bacteria | 5386 |
| 3 | Ga0070676_10254328 | 3300005328 | Bacteria | 1174 |
| 4 | Ga0070683_100004472 | 3300005329 | Bacteria | 11534 |
| 5 | Ga0070690_100052825 | 3300005330 | Bacteria | 2598 |
| 6 | Ga0070690_100139640 | 3300005330 | Bacteria | 1644 |
| 7 | Ga0070670_100000425 | 3300005331 | Bacteria | 34805 |
| 8 | Ga0070670_100269894 | 3300005331 | Bacteria | 1484 |
| 9 | Ga0068869_100365476 | 3300005334 | Bacteria | 1179 |
| 10 | Ga0068869_100525804 | 3300005334 | Bacteria | 991 |
| 11 | Ga0070666_10001027 | 3300005335 | Bacteria | 17099 |
| 12 | Ga0070666_10183492 | 3300005335 | Bacteria | 1468 |
| 13 | Ga0070680_100075389 | 3300005336 | Bacteria | 2777 |
| 14 | Ga0070682_100126159 | 3300005337 | Bacteria | 1725 |
| 15 | Ga0068868_100000145 | 3300005338 | Bacteria | 46047 |
| 16 | Ga0068868_100054390 | 3300005338 | Bacteria | 3154 |
| 17 | Ga0070660_100003022 | 3300005339 | Bacteria | 11582 |
| 18 | Ga0070689_100038362 | 3300005340 | Bacteria | 3665 |
| 19 | Ga0070687_100067545 | 3300005343 | Bacteria | 1909 |
| 20 | Ga0070661_100002717 | 3300005344 | Bacteria | 12130 |
| 21 | Ga0070669_100101562 | 3300005353 | Bacteria | 2170 |
| 22 | Ga0070675_100003704 | 3300005354 | Bacteria | 11616 |
| 23 | Ga0070675_100132216 | 3300005354 | Bacteria | 2127 |
| 24 | Ga0070675_100253631 | 3300005354 | Bacteria | 1540 |
| 25 | Ga0070675_100257994 | 3300005354 | Bacteria | 1527 |
| 26 | Ga0070671_100077132 | 3300005355 | Bacteria | 2785 |
| 27 | Ga0070674_100103848 | 3300005356 | Bacteria | 2076 |
| 28 | Ga0070674_100210541 | 3300005356 | Bacteria | 1506 |
| 29 | Ga0070673_100002718 | 3300005364 | Bacteria | 10846 |
| 30 | Ga0070673_100110218 | 3300005364 | Bacteria | 2281 |
| 31 | Ga0070673_100168986 | 3300005364 | Bacteria | 1865 |
| 32 | Ga0070659_100027679 | 3300005366 | Bacteria | 4370 |
| 33 | Ga0070667_100028749 | 3300005367 | Bacteria | 4629 |
| 34 | Ga0070714_100000938 | 3300005435 | Bacteria | 20743 |
| 35 | Ga0070714_100035146 | 3300005435 | Bacteria | 4198 |
| 36 | Ga0070714_100050143 | 3300005435 | Bacteria | 3554 |
| 37 | Ga0070713_100121133 | 3300005436 | Bacteria | 2295 |
| 38 | Ga0070713_100185935 | 3300005436 | Bacteria | 1870 |
| 39 | Ga0070701_10024119 | 3300005438 | Bacteria | 2940 |
| 40 | Ga0070701_10191312 | 3300005438 | Bacteria | 1204 |
| 41 | Ga0070705_100042140 | 3300005440 | Bacteria | 2608 |
| 42 | Ga0070700_100080913 | 3300005441 | Bacteria | 2097 |
| 43 | Ga0070663_100136791 | 3300005455 | Bacteria | 1866 |
| 44 | Ga0070678_100000715 | 3300005456 | Bacteria | 16451 |
| 45 | Ga0070678_100155753 | 3300005456 | Bacteria | 1845 |
| 46 | Ga0070662_100215034 | 3300005457 | Bacteria | 1531 |
| 47 | Ga0070662_100478331 | 3300005457 | Bacteria | 1037 |
| 48 | Ga0070681_10034307 | 3300005458 | Bacteria | 5095 |
| 49 | Ga0070681_10430075 | 3300005458 | Bacteria | 1232 |
| 50 | Ga0068867_100537596 | 3300005459 | Bacteria | 1010 |
| 51 | Ga0068867_100561060 | 3300005459 | Bacteria | 990 |
| 52 | Ga0070697_100183535 | 3300005536 | Bacteria | 1774 |
| 53 | Ga0070672_100013925 | 3300005543 | Bacteria | 5690 |
| 54 | Ga0070672_100422687 | 3300005543 | Bacteria | 1145 |
| 55 | Ga0070695_100011070 | 3300005545 | Bacteria | 5391 |
| 56 | Ga0070665_100036872 | 3300005548 | Bacteria | 4917 |
| 57 | Ga0070665_100059310 | 3300005548 | Bacteria | 3836 |
| 58 | Ga0070704_100127730 | 3300005549 | Bacteria | 1964 |
| 59 | Ga0070704_100539688 | 3300005549 | Bacteria | 1018 |
| 60 | Ga0068855_100000072 | 3300005563 | Bacteria | 121486 |
| 61 | Ga0068855_100196913 | 3300005563 | Bacteria | 2270 |
| 62 | Ga0070664_100000316 | 3300005564 | Bacteria | 35228 |
| 63 | Ga0070702_100093426 | 3300005615 | Bacteria | 1829 |
| 64 | Ga0068852_100000229 | 3300005616 | Bacteria | 38015 |
| 65 | Ga0068859_100147026 | 3300005617 | Bacteria | 2432 |
| 66 | Ga0068859_100196445 | 3300005617 | Bacteria | 2102 |
| 67 | Ga0068864_100047430 | 3300005618 | Bacteria | 3690 |
| 68 | Ga0068864_100074562 | 3300005618 | Bacteria | 2961 |
| 69 | Ga0068861_100202953 | 3300005719 | Bacteria | 1665 |
| 70 | Ga0068851_10005868 | 3300005834 | Bacteria | 5592 |
| 71 | Ga0068851_10156404 | 3300005834 | Bacteria | 1249 |
| 72 | Ga0068863_100025456 | 3300005841 | Bacteria | 5643 |
| 73 | Ga0068863_100026541 | 3300005841 | Bacteria | 5524 |
| 74 | Ga0068858_100005423 | 3300005842 | Bacteria | 12496 |
| 75 | Ga0068860_100005932 | 3300005843 | Bacteria | 12294 |
| 76 | Ga0068862_100397048 | 3300005844 | Bacteria | 1289 |
| 77 | Ga0070712_100253559 | 3300006175 | Bacteria | 1407 |
| 78 | Ga0097621_100001309 | 3300006237 | Bacteria | 17131 |
| 79 | Ga0097621_100238420 | 3300006237 | Bacteria | 1589 |
| 80 | Ga0068871_100001685 | 3300006358 | Bacteria | 14824 |
| 81 | Ga0068871_100005027 | 3300006358 | Bacteria | 9238 |
| 82 | Ga0075428_100001685 | 3300006844 | Bacteria | 23558 |
| 83 | Ga0075428_100262298 | 3300006844 | Bacteria | 1860 |
| 84 | Ga0075430_100015343 | 3300006846 | Bacteria | 6525 |
| 85 | Ga0075431_100000405 | 3300006847 | Bacteria | 34877 |
| 86 | Ga0075433_10004572 | 3300006852 | Bacteria | 10793 |
| 87 | Ga0075434_100001228 | 3300006871 | Bacteria | 21308 |
| 88 | Ga0075434_100399941 | 3300006871 | Unclassified | 1394 |
| 89 | Ga0075429_100010491 | 3300006880 | Bacteria | 8011 |
| 90 | Ga0075429_100161867 | 3300006880 | Bacteria | 1960 |
| 91 | Ga0097620_100147034 | 3300006931 | Bacteria | 2432 |
| 92 | Ga0097620_100196423 | 3300006931 | Bacteria | 2102 |
| 93 | Ga0075435_100112915 | 3300007076 | Bacteria | 2261 |
| 94 | Ga0099794_10073521 | 3300007265 | Bacteria | 1678 |
| 95 | Ga0099795_10000001 | 3300007788 | Bacteria | 179944 |
| 96 | Ga0099795_10001756 | 3300007788 | Bacteria | 4850 |
| 97 | Ga0111539_10013818 | 3300009094 | Bacteria | 10090 |
| 98 | Ga0111539_10040464 | 3300009094 | Bacteria | 5612 |
| 99 | Ga0111539_10218303 | 3300009094 | Bacteria | 2221 |
| 100 | Ga0105245_10012117 | 3300009098 | Bacteria | 7498 |
| 101 | Ga0105245_10040112 | 3300009098 | Bacteria | 4169 |
| 102 | Ga0114129_10172397 | 3300009147 | Bacteria | 2948 |
| 103 | Ga0105242_10073964 | 3300009176 | Bacteria | 2834 |
| 104 | Ga0105242_10266441 | 3300009176 | Bacteria | 1550 |
| 105 | Ga0105248_10130650 | 3300009177 | Bacteria | 2833 |
| 106 | Ga0105248_10143914 | 3300009177 | Bacteria | 2690 |
| 107 | Ga0105237_10461432 | 3300009545 | Bacteria | 1276 |
| 108 | Ga0105238_10212884 | 3300009551 | Bacteria | 1909 |
| 109 | Ga0099796_10000001 | 3300010159 | Bacteria | 107173 |
| 110 | Ga0157371_10289519 | 3300013102 | Bacteria | 1184 |
| 111 | Ga0157370_10027902 | 3300013104 | Bacteria | 5561 |
| 112 | Ga0157369_10779723 | 3300013105 | Bacteria | 983 |
| 113 | Ga0157374_10000860 | 3300013296 | Bacteria | 26547 |
| 114 | Ga0157374_10018024 | 3300013296 | Bacteria | 6226 |
| 115 | Ga0157378_10004072 | 3300013297 | Bacteria | 12914 |
| 116 | Ga0157378_10065959 | 3300013297 | Bacteria | 3241 |
| 117 | Ga0163162_10016546 | 3300013306 | Bacteria | 7207 |
| 118 | Ga0163162_10412550 | 3300013306 | Bacteria | 1483 |
| 119 | Ga0157375_10007106 | 3300013308 | Bacteria | 9777 |
| 120 | Ga0157375_10388958 | 3300013308 | Bacteria | 1561 |
| 121 | Ga0163163_10002837 | 3300014325 | Bacteria | 14648 |
| 122 | Ga0157380_10110041 | 3300014326 | Bacteria | 2313 |
| 123 | Ga0157380_10113111 | 3300014326 | Bacteria | 2285 |
| 124 | Ga0157380_10139807 | 3300014326 | Bacteria | 2078 |
| 125 | Ga0157377_10035191 | 3300014745 | Bacteria | 2745 |
| 126 | Ga0157379_10004663 | 3300014968 | Bacteria | 11761 |
| 127 | Ga0157376_10004036 | 3300014969 | Bacteria | 10152 |
| 128 | Ga0157376_10014114 | 3300014969 | Bacteria | 5983 |
| 129 | Ga0163161_10236604 | 3300017792 | Bacteria | 1419 |
| 130 | Ga0207656_10008437 | 3300025321 | Bacteria | 3794 |
| 131 | Ga0207656_10083694 | 3300025321 | Bacteria | 1438 |
| 132 | Ga0207682_10003380 | 3300025893 | Bacteria | 6947 |
| 133 | Ga0207645_10034564 | 3300025907 | Bacteria | 3248 |
| 134 | Ga0207643_10009078 | 3300025908 | Bacteria | 5340 |
| 135 | Ga0207705_10008649 | 3300025909 | Bacteria | 7419 |
| 136 | Ga0207707_10061039 | 3300025912 | Bacteria | 3280 |
| 137 | Ga0207707_10386010 | 3300025912 | Bacteria | 1203 |
| 138 | Ga0207662_10068403 | 3300025918 | Bacteria | 2145 |
| 139 | Ga0207646_10045803 | 3300025922 | Bacteria | 3925 |
| 140 | Ga0207681_10453240 | 3300025923 | Bacteria | 1044 |
| 141 | Ga0207694_10151899 | 3300025924 | Bacteria | 1866 |
| 142 | Ga0207650_10001393 | 3300025925 | Bacteria | 17447 |
| 143 | Ga0207659_10003124 | 3300025926 | Bacteria | 9898 |
| 144 | Ga0207659_10032634 | 3300025926 | Bacteria | 3576 |
| 145 | Ga0207659_10085094 | 3300025926 | Bacteria | 2348 |
| 146 | Ga0207664_10001788 | 3300025929 | Bacteria | 14163 |
| 147 | Ga0207664_10049216 | 3300025929 | Bacteria | 3317 |
| 148 | Ga0207690_10017584 | 3300025932 | Bacteria | 4370 |
| 149 | Ga0207706_10019630 | 3300025933 | Bacteria | 6080 |
| 150 | Ga0207686_10193236 | 3300025934 | Bacteria | 1452 |
| 151 | Ga0207670_10050295 | 3300025936 | Bacteria | 2792 |
| 152 | Ga0207669_10073322 | 3300025937 | Bacteria | 2159 |
| 153 | Ga0207691_10000667 | 3300025940 | Bacteria | 33915 |
| 154 | Ga0207691_10053596 | 3300025940 | Bacteria | 3682 |
| 155 | Ga0207691_10120645 | 3300025940 | Bacteria | 2324 |
| 156 | Ga0207691_10260991 | 3300025940 | Bacteria | 1493 |
| 157 | Ga0207711_10002694 | 3300025941 | Bacteria | 15698 |
| 158 | Ga0207711_10014099 | 3300025941 | Bacteria | 6641 |
| 159 | Ga0207689_10048275 | 3300025942 | Bacteria | 3511 |
| 160 | Ga0207689_10141572 | 3300025942 | Bacteria | 1981 |
| 161 | Ga0207661_10002441 | 3300025944 | Bacteria | 12808 |
| 162 | Ga0207679_10000649 | 3300025945 | Bacteria | 23237 |
| 163 | Ga0207679_10145906 | 3300025945 | Bacteria | 1919 |
| 164 | Ga0207651_10061319 | 3300025960 | Bacteria | 2615 |
| 165 | Ga0207651_10426143 | 3300025960 | Bacteria | 1134 |
| 166 | Ga0207668_10476564 | 3300025972 | Bacteria | 1070 |
| 167 | Ga0207658_10009511 | 3300025986 | Bacteria | 6598 |
| 168 | Ga0207677_10002541 | 3300026023 | Bacteria | 9570 |
| 169 | Ga0207677_10119344 | 3300026023 | Bacteria | 1980 |
| 170 | Ga0207677_10203741 | 3300026023 | Bacteria | 1574 |
| 171 | Ga0207703_10069468 | 3300026035 | Bacteria | 2905 |
| 172 | Ga0207678_10160899 | 3300026067 | Bacteria | 1917 |
| 173 | Ga0207708_10038460 | 3300026075 | Bacteria | 3644 |
| 174 | Ga0207641_10004933 | 3300026088 | Bacteria | 11459 |
| 175 | Ga0207641_10018984 | 3300026088 | Bacteria | 5640 |
| 176 | Ga0207648_10030965 | 3300026089 | Bacteria | 4733 |
| 177 | Ga0207648_10374245 | 3300026089 | Bacteria | 1287 |
| 178 | Ga0207676_10038029 | 3300026095 | Bacteria | 3671 |
| 179 | Ga0207676_10057056 | 3300026095 | Bacteria | 3074 |
| 180 | Ga0207674_10049157 | 3300026116 | Bacteria | 4314 |
| 181 | Ga0207674_10348966 | 3300026116 | Bacteria | 1431 |
| 182 | Ga0207675_100065930 | 3300026118 | Bacteria | 3384 |
| 183 | Ga0207683_10001353 | 3300026121 | Bacteria | 22149 |
| 184 | Ga0207683_10132779 | 3300026121 | Bacteria | 2240 |
| 185 | Ga0207698_10000201 | 3300026142 | Bacteria | 37485 |
| 186 | Ga0209179_1000006 | 3300027512 | Bacteria | 101289 |
| 187 | Ga0209971_1020636 | 3300027682 | Bacteria | 1567 |
| 188 | Ga0207428_10376002 | 3300027907 | Bacteria | 1043 |
| 189 | Ga0268266_10034651 | 3300028379 | Bacteria | 4294 |
| 190 | Ga0268266_10040174 | 3300028379 | Bacteria | 3987 |
| 191 | Ga0268266_10372741 | 3300028379 | Bacteria | 1345 |
| 192 | Ga0268265_10293347 | 3300028380 | Bacteria | 1461 |
| 193 | Ga0268265_10392762 | 3300028380 | Bacteria | 1280 |
| 194 | Ga0268264_10169199 | 3300028381 | Bacteria | 1975 |
| 195 | Ga0265326_10000879 | 3300028558 | Bacteria | 10929 |
| 196 | Ga0265326_10008960 | 3300028558 | Bacteria | 2998 |
| 197 | Ga0265334_10000015 | 3300028573 | Bacteria | 150318 |
| 198 | Ga0265334_10012646 | 3300028573 | Bacteria | 3544 |
| 199 | Ga0265334_10076576 | 3300028573 | Bacteria | 1239 |
| 200 | Ga0265323_10005604 | 3300028653 | Bacteria | 5327 |
| 201 | Ga0265322_10020853 | 3300028654 | Bacteria | 1877 |
| 202 | Ga0265338_10005171 | 3300028800 | Bacteria | 17142 |
| 203 | Ga0265338_10147851 | 3300028800 | Bacteria | 1830 |
| 204 | Ga0265330_10046389 | 3300031235 | Bacteria | 1915 |
| 205 | Ga0265332_10001626 | 3300031238 | Bacteria | 12300 |
| 206 | Ga0265332_10007450 | 3300031238 | Bacteria | 4946 |
| 207 | Ga0265328_10009856 | 3300031239 | Bacteria | 3869 |
| 208 | Ga0265328_10094912 | 3300031239 | Bacteria | 1103 |
| 209 | Ga0265320_10107249 | 3300031240 | Bacteria | 1282 |
| 210 | Ga0265331_10003020 | 3300031250 | Bacteria | 11038 |
| 211 | Ga0265331_10003444 | 3300031250 | Bacteria | 10229 |
| 212 | Ga0265331_10076046 | 3300031250 | Bacteria | 1565 |
| 213 | Ga0265327_10000133 | 3300031251 | Bacteria | 163887 |
| 214 | Ga0265327_10000542 | 3300031251 | Bacteria | 64581 |
| 215 | Ga0265327_10017618 | 3300031251 | Bacteria | 4470 |
| 216 | Ga0265316_10000744 | 3300031344 | Bacteria | 36026 |
| 217 | Ga0265316_10093678 | 3300031344 | Bacteria | 2289 |
| 218 | Ga0307509_10000075 | 3300031507 | Bacteria | 139230 |
| 219 | Ga0307408_100274899 | 3300031548 | Bacteria | 1400 |
| 220 | Ga0265313_10000277 | 3300031595 | Bacteria | 56206 |
| 221 | Ga0265313_10009298 | 3300031595 | Bacteria | 6394 |
| 222 | Ga0265314_10000335 | 3300031711 | Bacteria | 66101 |
| 223 | Ga0265342_10031276 | 3300031712 | Bacteria | 3292 |
| 224 | Ga0316576_10023367 | 3300031727 | Bacteria | 4305 |
| 225 | Ga0316577_10008398 | 3300031733 | Bacteria | 5534 |
| 226 | Ga0316577_10020998 | 3300031733 | Bacteria | 3620 |
| 227 | Ga0307412_10253090 | 3300031911 | Bacteria | 1369 |
| 228 | Ga0307416_100114615 | 3300032002 | Bacteria | 2385 |
| 229 | Ga0316583_10005090 | 3300032133 | Bacteria | 4706 |
| 230 | Ga0316585_10011152 | 3300032137 | Bacteria | 2646 |
| 231 | Ga0307510_10252581 | 3300033180 | Bacteria | 1250 |
| 232 | Ga0373934_0121447 | 3300035086 | Bacteria | 1063 |
| 233 | Ga0373936_0059454 | 3300035113 | Bacteria | 1558 |
| 234 | Ga0373956_0083627 | 3300035119 | Bacteria | 1467 |
| 235 | Ga0373962_0063301 | 3300035242 | Bacteria | 1091 |
| 236 | Ga0373931_0123239 | 3300035691 | Bacteria | 1484 |
| 237 | Ga0373933_0036513 | 3300035724 | Bacteria | 2877 |
| 238 | Ga0373933_0097291 | 3300035724 | Bacteria | 1823 |
| 239 | Ga0373937_0150272 | 3300036401 | Bacteria | 2181 |
| 240 | Ga0373937_0465853 | 3300036401 | Bacteria | 1200 |
| 241 | Ga0316582_0112152 | 3300036647 | Bacteria | 1816 |
| 242 | Ga0316582_0209160 | 3300036647 | Bacteria | 1332 |
| 243 | Ga0373925_0398192 | 3300037068 | Bacteria | 1123 |
| 244 | Ga0395901_0000533 | 3300038443 | Bacteria | 43906 |
| 245 | Ga0451807_2614339 | 3300041486 | Bacteria | 1255 |
| 246 | Ga0451577_0000600 | 3300042876 | Bacteria | 57931 |
| 247 | Ga0451577_0005072 | 3300042876 | Bacteria | 13595 |
| 248 | Ga0451577_0009608 | 3300042876 | Bacteria | 9285 |
| 249 | Ga0451577_0036021 | 3300042876 | Bacteria | 4457 |
| 250 | Ga0451577_0440942 | 3300042876 | Bacteria | 1182 |
| 251 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 252 | Ga0453684_0000356 | 3300044712 | Bacteria | 189329 |
| 253 | Ga0453684_0002166 | 3300044712 | Bacteria | 49117 |
| 254 | Ga0453684_0002541 | 3300044712 | Bacteria | 43926 |
| 255 | Ga0453684_0047079 | 3300044712 | Bacteria | 5725 |
| 256 | Ga0453684_0058955 | 3300044712 | Bacteria | 4954 |
| 257 | Ga0453684_0082346 | 3300044712 | Bacteria | 4009 |
| 258 | Ga0453684_0221837 | 3300044712 | Unclassified | 2189 |
| 259 | Ga0453684_0353799 | 3300044712 | Bacteria | 1655 |
| 260 | Ga0453684_0473813 | 3300044712 | Bacteria | 1390 |
| 261 | Ga0466970_0015640 | 3300044765 | Bacteria | 3905 |
| 262 | Ga0451576_0000634 | 3300045051 | Bacteria | 73076 |
| 263 | Ga0451576_0002387 | 3300045051 | Bacteria | 28262 |
| 264 | Ga0451576_0012343 | 3300045051 | Bacteria | 9598 |
| 265 | Ga0451576_0075251 | 3300045051 | Bacteria | 3513 |
| 266 | Ga0451576_0230102 | 3300045051 | Bacteria | 1936 |
| 267 | Ga0451576_0237444 | 3300045051 | Bacteria | 1904 |
| 268 | Ga0451576_0840879 | 3300045051 | Bacteria | 963 |
| 269 | Ga0495603_0137281 | 3300046455 | Bacteria | 1423 |
| 270 | Ga0495642_0032982 | 3300046528 | Bacteria | 2081 |
| 271 | Ga0495670_0069415 | 3300046691 | Bacteria | 1782 |
| 272 | Ga0496100_0065688 | 3300048903 | Bacteria | 2405 |
| 273 | Ga0496101_0018622 | 3300048904 | Bacteria | 4725 |
| 274 | Ga0496102_0217706 | 3300048905 | Bacteria | 1800 |
| 275 | Ga0496104_0030300 | 3300048907 | Bacteria | 5026 |
| 276 | Ga0496104_0047596 | 3300048907 | Bacteria | 4041 |
| 277 | Ga0496105_0004965 | 3300048908 | Bacteria | 10057 |
| 278 | Ga0496105_0009078 | 3300048908 | Bacteria | 7756 |
| 279 | Ga0496106_0194524 | 3300048909 | Bacteria | 1613 |
| 280 | Ga0496108_0008184 | 3300048911 | Bacteria | 8486 |
| 281 | Ga0496108_0123628 | 3300048911 | Bacteria | 2220 |
| 282 | Ga0496109_0009828 | 3300048912 | Bacteria | 8165 |
| 283 | Ga0496109_0018297 | 3300048912 | Bacteria | 6153 |
| 284 | Ga0496110_0009462 | 3300048913 | Bacteria | 7889 |
| 285 | Ga0496110_0069388 | 3300048913 | Bacteria | 3121 |
| 286 | Ga0496110_0650697 | 3300048913 | Bacteria | 954 |
| 287 | Ga0496111_0078748 | 3300048914 | Bacteria | 2403 |
| 288 | Ga0496112_0755254 | 3300048915 | Bacteria | 899 |
| 289 | Ga0496114_0007489 | 3300048917 | Bacteria | 8630 |
| 290 | Ga0496114_0020480 | 3300048917 | Bacteria | 5368 |
| 291 | Ga0496114_0098586 | 3300048917 | Bacteria | 2492 |
| 292 | Ga0496114_0127385 | 3300048917 | Bacteria | 2196 |
| 293 | Ga0496115_0033775 | 3300048918 | Bacteria | 4040 |
| 294 | Ga0496122_0089649 | 3300048925 | Unclassified | 2102 |
| 295 | Ga0496125_0007840 | 3300048928 | Bacteria | 11284 |
| 296 | Ga0501033_0334871 | 3300049570 | Bacteria | 1062 |
| 297 | Ga0501034_0032459 | 3300049571 | Bacteria | 5302 |
| 298 | Ga0501034_0137042 | 3300049571 | Bacteria | 2428 |
| 299 | Ga0501038_0055265 | 3300049574 | Bacteria | 3411 |
| 300 | Ga0501039_0073631 | 3300049575 | Bacteria | 2654 |
| 301 | Ga0501039_0264597 | 3300049575 | Bacteria | 1351 |
| 302 | Ga0501040_0060378 | 3300049576 | Bacteria | 2605 |
| 303 | Ga0501041_0000884 | 3300049577 | Bacteria | 16204 |
| 304 | Ga0501041_0002450 | 3300049577 | Bacteria | 10538 |
| 305 | Ga0501042_0031586 | 3300049578 | Bacteria | 3746 |
| 306 | Ga0501043_0053993 | 3300049579 | Bacteria | 3155 |
| 307 | Ga0501043_0203194 | 3300049579 | Bacteria | 1537 |
| 308 | Ga0501048_0382542 | 3300049582 | Bacteria | 1005 |
| 309 | Ga0501048_0474660 | 3300049582 | Bacteria | 896 |
| 310 | Ga0501068_0136294 | 3300049584 | Bacteria | 1537 |
| 311 | Ga0501068_0153991 | 3300049584 | Bacteria | 1446 |
| 312 | Ga0501071_0070881 | 3300049587 | Bacteria | 2540 |
| 313 | Ga0501071_0091162 | 3300049587 | Bacteria | 2239 |
| 314 | Ga0501071_0557569 | 3300049587 | Bacteria | 880 |
| 315 | Ga0501072_0017175 | 3300049588 | Bacteria | 5561 |
| 316 | Ga0501072_0067834 | 3300049588 | Bacteria | 2815 |
| 317 | Ga0501072_0253610 | 3300049588 | Bacteria | 1401 |
| 318 | Ga0501073_0162704 | 3300049589 | Bacteria | 1546 |
| 319 | Ga0501074_0162176 | 3300049590 | Bacteria | 1597 |
| 320 | Ga0501075_0065866 | 3300049591 | Bacteria | 2733 |
| 321 | Ga0501075_0273012 | 3300049591 | Bacteria | 1288 |
| 322 | Ga0501076_0000468 | 3300049592 | Bacteria | 25466 |
| 323 | Ga0501077_0026400 | 3300049593 | Bacteria | 3686 |
| 324 | Ga0501077_0079534 | 3300049593 | Bacteria | 2077 |
| 325 | Ga0501209_003130 | 3300049656 | Bacteria | 2678 |
| 326 | Ga0501079_0015588 | 3300049741 | Bacteria | 5802 |
| 327 | Ga0501079_0126920 | 3300049741 | Bacteria | 1984 |
| 328 | Ga0501080_0132331 | 3300049742 | Bacteria | 2309 |
| 329 | Ga0501080_0177925 | 3300049742 | Bacteria | 1959 |
| 330 | Ga0501081_0002318 | 3300049743 | Bacteria | 11987 |
| 331 | Ga0501081_0017127 | 3300049743 | Bacteria | 4794 |
| 332 | Ga0501081_0054554 | 3300049743 | Bacteria | 2761 |
| 333 | Ga0501081_0074275 | 3300049743 | Bacteria | 2372 |
| 334 | Ga0501081_0483388 | 3300049743 | Bacteria | 922 |
| 335 | Ga0501083_0217124 | 3300049744 | Bacteria | 1246 |
| 336 | Ga0501045_0370673 | 3300049824 | Bacteria | 1066 |
| 337 | nmdc:mga05p37_976373_c1 | 3300050507 | Bacteria | 903 |
| 338 | nmdc:mga09592_40910_c1 | 3300050508 | Bacteria | 3895 |
| 339 | nmdc:mga06r32_20088_c1 | 3300050510 | Bacteria | 6143 |
| 340 | nmdc:mga08y16_116993_c1 | 3300050511 | Bacteria | 2775 |
| 341 | nmdc:mga08y16_27642_c1 | 3300050511 | Bacteria | 5977 |
| 342 | nmdc:mga0n895_239381_c1 | 3300050512 | Bacteria | 1841 |
| 343 | nmdc:mga0n895_4260_c1 | 3300050512 | Bacteria | 11703 |
| 344 | nmdc:mga0rr50_282417_c1 | 3300050513 | Bacteria | 1385 |
| 345 | nmdc:mga0a205_5798_c2 | 3300050515 | Bacteria | 10708 |
| 346 | Ga0500590_054878 | 3300053148 | Bacteria | 2017 |
| 347 | Ga0500637_0111972 | 3300053178 | Bacteria | 1583 |
| 348 | Ga0501084_0004288 | 3300054114 | Bacteria | 11611 |
| 349 | Ga0501084_0024721 | 3300054114 | Bacteria | 5013 |
| 350 | Ga0501082_0009058 | 3300060353 | Bacteria | 8584 |
| 351 | Ga0501082_0066429 | 3300060353 | Bacteria | 3106 |
| 352 | Ga0501082_0304083 | 3300060353 | Bacteria | 1389 |
| 353 | Ga0530510_0254712 | 3300061734 | Bacteria | 1308 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100185935 | Ga0070713_1001859351 | 222 |
| 2 | 3300005435 | Ga0070714_100000938 | Ga0070714_10000093819 | 223 |
| 3 | 3300025929 | Ga0207664_10001788 | Ga0207664_1000178813 | 223 |
| 4 | 3300028558 | Ga0265326_10008960 | Ga0265326_100089602 | 223 |
| 5 | 3300028573 | Ga0265334_10000015 | Ga0265334_1000001515 | 223 |
| 6 | 3300031595 | Ga0265313_10000277 | Ga0265313_1000027710 | 223 |
| 7 | 3300005435 | Ga0070714_100050143 | Ga0070714_1000501434 | 229 |
| 8 | 3300044712 | Ga0453684_0221837 | Ga0453684_0221837_1351_2091 | 245 |
| 9 | 3300050512 | nmdc:mga0n895_239381_c1 | nmdc:mga0n895_239381_c1_71_859 | 255 |
| 10 | 3300036401 | Ga0373937_0465853 | Ga0373937_0465853_21_791 | 256 |
| 11 | 3300048911 | Ga0496108_0008184 | Ga0496108_0008184_2866_3642 | 257 |
| 12 | 3300038443 | Ga0395901_0000533 | Ga0395901_0000533_846_1628 | 258 |
| 13 | 3300049570 | Ga0501033_0334871 | Ga0501033_0334871_198_995 | 259 |
| 14 | 3300009545 | Ga0105237_10461432 | Ga0105237_104614321 | 260 |
| 15 | 3300048925 | Ga0496122_0089649 | Ga0496122_0089649_588_1448 | 260 |
| 16 | 3300049582 | Ga0501048_0382542 | Ga0501048_0382542_150_932 | 260 |
| 17 | 3300035086 | Ga0373934_0121447 | Ga0373934_0121447_142_936 | 261 |
| 18 | 3300044765 | Ga0466970_0015640 | Ga0466970_0015640_302_1093 | 261 |
| 19 | 3300045051 | Ga0451576_0237444 | Ga0451576_0237444_546_1331 | 261 |
| 20 | 3300045051 | Ga0451576_0840879 | Ga0451576_0840879_118_906 | 261 |
| 21 | 3300005339 | Ga0070660_100003022 | Ga0070660_10000302211 | 262 |
| 22 | 3300009098 | Ga0105245_10040112 | Ga0105245_100401125 | 262 |
| 23 | 3300013306 | Ga0163162_10412550 | Ga0163162_104125502 | 262 |
| 24 | 3300044712 | Ga0453684_0002541 | Ga0453684_0002541_11946_12734 | 262 |
| 25 | 3300048917 | Ga0496114_0007489 | Ga0496114_0007489_2348_3142 | 262 |
| 26 | 3300048928 | Ga0496125_0007840 | Ga0496125_0007840_3280_4074 | 262 |
| 27 | 3300049742 | Ga0501080_0177925 | Ga0501080_0177925_16_804 | 262 |
| 28 | 3300005458 | Ga0070681_10430075 | Ga0070681_104300752 | 263 |
| 29 | 3300028558 | Ga0265326_10000879 | Ga0265326_100008797 | 263 |
| 30 | 3300028573 | Ga0265334_10012646 | Ga0265334_100126463 | 263 |
| 31 | 3300028573 | Ga0265334_10076576 | Ga0265334_100765762 | 263 |
| 32 | 3300028653 | Ga0265323_10005604 | Ga0265323_100056043 | 263 |
| 33 | 3300028654 | Ga0265322_10020853 | Ga0265322_100208531 | 263 |
| 34 | 3300028800 | Ga0265338_10005171 | Ga0265338_1000517115 | 263 |
| 35 | 3300031235 | Ga0265330_10046389 | Ga0265330_100463891 | 263 |
| 36 | 3300031250 | Ga0265331_10076046 | Ga0265331_100760461 | 263 |
| 37 | 3300031344 | Ga0265316_10000744 | Ga0265316_100007443 | 263 |
| 38 | 3300031595 | Ga0265313_10009298 | Ga0265313_100092985 | 263 |
| 39 | 3300031911 | Ga0307412_10253090 | Ga0307412_102530902 | 263 |
| 40 | 3300032002 | Ga0307416_100114615 | Ga0307416_1001146152 | 263 |
| 41 | 3300049571 | Ga0501034_0137042 | Ga0501034_0137042_180_971 | 263 |
| 42 | 3300049575 | Ga0501039_0264597 | Ga0501039_0264597_357_1148 | 263 |
| 43 | 3300049577 | Ga0501041_0000884 | Ga0501041_0000884_11772_12563 | 263 |
| 44 | 3300049579 | Ga0501043_0053993 | Ga0501043_0053993_1761_2552 | 263 |
| 45 | 3300049587 | Ga0501071_0070881 | Ga0501071_0070881_375_1166 | 263 |
| 46 | 3300049588 | Ga0501072_0067834 | Ga0501072_0067834_1667_2458 | 263 |
| 47 | 3300049591 | Ga0501075_0065866 | Ga0501075_0065866_1795_2586 | 263 |
| 48 | 3300049592 | Ga0501076_0000468 | Ga0501076_0000468_23050_23841 | 263 |
| 49 | 3300049593 | Ga0501077_0026400 | Ga0501077_0026400_1265_2056 | 263 |
| 50 | 3300049656 | Ga0501209_003130 | Ga0501209_003130_1117_1911 | 263 |
| 51 | 3300049741 | Ga0501079_0015588 | Ga0501079_0015588_4467_5258 | 263 |
| 52 | 3300049743 | Ga0501081_0002318 | Ga0501081_0002318_5964_6755 | 263 |
| 53 | 3300053148 | Ga0500590_054878 | Ga0500590_054878_631_1422 | 263 |
| 54 | 3300054114 | Ga0501084_0024721 | Ga0501084_0024721_28_819 | 263 |
| 55 | 3300060353 | Ga0501082_0066429 | Ga0501082_0066429_957_1748 | 263 |
| 56 | 3300005354 | Ga0070675_100003704 | Ga0070675_1000037042 | 264 |
| 57 | 3300005354 | Ga0070675_100253631 | Ga0070675_1002536312 | 264 |
| 58 | 3300005354 | Ga0070675_100257994 | Ga0070675_1002579942 | 264 |
| 59 | 3300005364 | Ga0070673_100110218 | Ga0070673_1001102183 | 264 |
| 60 | 3300005436 | Ga0070713_100121133 | Ga0070713_1001211332 | 264 |
| 61 | 3300005438 | Ga0070701_10191312 | Ga0070701_101913121 | 264 |
| 62 | 3300005459 | Ga0068867_100537596 | Ga0068867_1005375961 | 264 |
| 63 | 3300005543 | Ga0070672_100422687 | Ga0070672_1004226872 | 264 |
| 64 | 3300005549 | Ga0070704_100127730 | Ga0070704_1001277302 | 264 |
| 65 | 3300005563 | Ga0068855_100196913 | Ga0068855_1001969133 | 264 |
| 66 | 3300005617 | Ga0068859_100196445 | Ga0068859_1001964451 | 264 |
| 67 | 3300006175 | Ga0070712_100253559 | Ga0070712_1002535591 | 264 |
| 68 | 3300006844 | Ga0075428_100001685 | Ga0075428_10000168525 | 264 |
| 69 | 3300006844 | Ga0075428_100262298 | Ga0075428_1002622982 | 264 |
| 70 | 3300006852 | Ga0075433_10004572 | Ga0075433_100045727 | 264 |
| 71 | 3300006871 | Ga0075434_100001228 | Ga0075434_1000012287 | 264 |
| 72 | 3300006931 | Ga0097620_100196423 | Ga0097620_1001964231 | 264 |
| 73 | 3300007076 | Ga0075435_100112915 | Ga0075435_1001129152 | 264 |
| 74 | 3300007265 | Ga0099794_10073521 | Ga0099794_100735212 | 264 |
| 75 | 3300007788 | Ga0099795_10001756 | Ga0099795_100017562 | 264 |
| 76 | 3300009094 | Ga0111539_10040464 | Ga0111539_100404643 | 264 |
| 77 | 3300009094 | Ga0111539_10218303 | Ga0111539_102183032 | 264 |
| 78 | 3300009147 | Ga0114129_10172397 | Ga0114129_101723971 | 264 |
| 79 | 3300013308 | Ga0157375_10388958 | Ga0157375_103889582 | 264 |
| 80 | 3300014326 | Ga0157380_10110041 | Ga0157380_101100412 | 264 |
| 81 | 3300014326 | Ga0157380_10139807 | Ga0157380_101398073 | 264 |
| 82 | 3300025923 | Ga0207681_10453240 | Ga0207681_104532401 | 264 |
| 83 | 3300025926 | Ga0207659_10085094 | Ga0207659_100850942 | 264 |
| 84 | 3300025940 | Ga0207691_10120645 | Ga0207691_101206453 | 264 |
| 85 | 3300025942 | Ga0207689_10048275 | Ga0207689_100482752 | 264 |
| 86 | 3300025960 | Ga0207651_10426143 | Ga0207651_104261432 | 264 |
| 87 | 3300026089 | Ga0207648_10374245 | Ga0207648_103742452 | 264 |
| 88 | 3300026116 | Ga0207674_10049157 | Ga0207674_100491575 | 264 |
| 89 | 3300027907 | Ga0207428_10376002 | Ga0207428_103760021 | 264 |
| 90 | 3300028380 | Ga0268265_10392762 | Ga0268265_103927622 | 264 |
| 91 | 3300028800 | Ga0265338_10147851 | Ga0265338_101478513 | 264 |
| 92 | 3300033180 | Ga0307510_10252581 | Ga0307510_102525812 | 264 |
| 93 | 3300035113 | Ga0373936_0059454 | Ga0373936_0059454_122_916 | 264 |
| 94 | 3300035119 | Ga0373956_0083627 | Ga0373956_0083627_191_985 | 264 |
| 95 | 3300035724 | Ga0373933_0097291 | Ga0373933_0097291_237_1031 | 264 |
| 96 | 3300036401 | Ga0373937_0150272 | Ga0373937_0150272_406_1200 | 264 |
| 97 | 3300045051 | Ga0451576_0012343 | Ga0451576_0012343_4127_4924 | 264 |
| 98 | 3300046455 | Ga0495603_0137281 | Ga0495603_0137281_322_1119 | 264 |
| 99 | 3300048907 | Ga0496104_0047596 | Ga0496104_0047596_762_1556 | 264 |
| 100 | 3300048908 | Ga0496105_0009078 | Ga0496105_0009078_1457_2251 | 264 |
| 101 | 3300048909 | Ga0496106_0194524 | Ga0496106_0194524_579_1376 | 264 |
| 102 | 3300048917 | Ga0496114_0020480 | Ga0496114_0020480_3204_3998 | 264 |
| 103 | 3300048918 | Ga0496115_0033775 | Ga0496115_0033775_964_1758 | 264 |
| 104 | 3300049574 | Ga0501038_0055265 | Ga0501038_0055265_1181_1978 | 264 |
| 105 | 3300049575 | Ga0501039_0073631 | Ga0501039_0073631_187_984 | 264 |
| 106 | 3300049576 | Ga0501040_0060378 | Ga0501040_0060378_200_997 | 264 |
| 107 | 3300049577 | Ga0501041_0002450 | Ga0501041_0002450_9130_9927 | 264 |
| 108 | 3300049578 | Ga0501042_0031586 | Ga0501042_0031586_639_1436 | 264 |
| 109 | 3300049579 | Ga0501043_0203194 | Ga0501043_0203194_206_1003 | 264 |
| 110 | 3300049582 | Ga0501048_0474660 | Ga0501048_0474660_41_838 | 264 |
| 111 | 3300049584 | Ga0501068_0136294 | Ga0501068_0136294_219_1016 | 264 |
| 112 | 3300049584 | Ga0501068_0153991 | Ga0501068_0153991_515_1312 | 264 |
| 113 | 3300049587 | Ga0501071_0091162 | Ga0501071_0091162_770_1567 | 264 |
| 114 | 3300049588 | Ga0501072_0017175 | Ga0501072_0017175_3025_3822 | 264 |
| 115 | 3300049588 | Ga0501072_0253610 | Ga0501072_0253610_224_1021 | 264 |
| 116 | 3300049590 | Ga0501074_0162176 | Ga0501074_0162176_741_1538 | 264 |
| 117 | 3300049591 | Ga0501075_0273012 | Ga0501075_0273012_361_1158 | 264 |
| 118 | 3300049593 | Ga0501077_0079534 | Ga0501077_0079534_911_1708 | 264 |
| 119 | 3300049741 | Ga0501079_0126920 | Ga0501079_0126920_996_1793 | 264 |
| 120 | 3300049742 | Ga0501080_0132331 | Ga0501080_0132331_196_993 | 264 |
| 121 | 3300049743 | Ga0501081_0017127 | Ga0501081_0017127_617_1414 | 264 |
| 122 | 3300049743 | Ga0501081_0054554 | Ga0501081_0054554_172_969 | 264 |
| 123 | 3300049743 | Ga0501081_0074275 | Ga0501081_0074275_534_1331 | 264 |
| 124 | 3300049743 | Ga0501081_0483388 | Ga0501081_0483388_62_859 | 264 |
| 125 | 3300049744 | Ga0501083_0217124 | Ga0501083_0217124_216_1013 | 264 |
| 126 | 3300049824 | Ga0501045_0370673 | Ga0501045_0370673_242_1039 | 264 |
| 127 | 3300050507 | nmdc:mga05p37_976373_c1 | nmdc:mga05p37_976373_c1_87_884 | 264 |
| 128 | 3300050511 | nmdc:mga08y16_116993_c1 | nmdc:mga08y16_116993_c1_62_859 | 264 |
| 129 | 3300050511 | nmdc:mga08y16_27642_c1 | nmdc:mga08y16_27642_c1_5157_5954 | 264 |
| 130 | 3300050512 | nmdc:mga0n895_4260_c1 | nmdc:mga0n895_4260_c1_235_1032 | 264 |
| 131 | 3300050515 | nmdc:mga0a205_5798_c2 | nmdc:mga0a205_5798_c2_3626_4423 | 264 |
| 132 | 3300054114 | Ga0501084_0004288 | Ga0501084_0004288_805_1602 | 264 |
| 133 | 3300060353 | Ga0501082_0009058 | Ga0501082_0009058_3511_4308 | 264 |
| 134 | 3300060353 | Ga0501082_0304083 | Ga0501082_0304083_460_1257 | 264 |
| 135 | 3300061734 | Ga0530510_0254712 | Ga0530510_0254712_287_1084 | 264 |
| 136 | 3300005330 | Ga0070690_100139640 | Ga0070690_1001396402 | 265 |
| 137 | 3300005563 | Ga0068855_100000072 | Ga0068855_10000007214 | 265 |
| 138 | 3300006880 | Ga0075429_100010491 | Ga0075429_1000104913 | 265 |
| 139 | 3300009094 | Ga0111539_10013818 | Ga0111539_100138189 | 265 |
| 140 | 3300031239 | Ga0265328_10094912 | Ga0265328_100949121 | 265 |
| 141 | 3300031250 | Ga0265331_10003020 | Ga0265331_1000302015 | 265 |
| 142 | 3300031251 | Ga0265327_10000133 | Ga0265327_10000133126 | 265 |
| 143 | 3300031733 | Ga0316577_10020998 | Ga0316577_100209983 | 265 |
| 144 | 3300035242 | Ga0373962_0063301 | Ga0373962_0063301_167_970 | 265 |
| 145 | 3300035691 | Ga0373931_0123239 | Ga0373931_0123239_502_1299 | 265 |
| 146 | 3300036647 | Ga0316582_0209160 | Ga0316582_0209160_466_1275 | 265 |
| 147 | 3300044712 | Ga0453684_0082346 | Ga0453684_0082346_2667_3464 | 265 |
| 148 | 3300044712 | Ga0453684_0473813 | Ga0453684_0473813_403_1200 | 265 |
| 149 | 3300045051 | Ga0451576_0075251 | Ga0451576_0075251_1343_2140 | 265 |
| 150 | 3300049589 | Ga0501073_0162704 | Ga0501073_0162704_478_1278 | 265 |
| 151 | 3300050508 | nmdc:mga09592_40910_c1 | nmdc:mga09592_40910_c1_2844_3647 | 265 |
| 152 | 3300005337 | Ga0070682_100126159 | Ga0070682_1001261591 | 266 |
| 153 | 3300005545 | Ga0070695_100011070 | Ga0070695_1000110701 | 266 |
| 154 | 3300005549 | Ga0070704_100539688 | Ga0070704_1005396881 | 266 |
| 155 | 3300014326 | Ga0157380_10113111 | Ga0157380_101131112 | 266 |
| 156 | 3300025912 | Ga0207707_10386010 | Ga0207707_103860102 | 266 |
| 157 | 3300005336 | Ga0070680_100075389 | Ga0070680_1000753892 | 267 |
| 158 | 3300005440 | Ga0070705_100042140 | Ga0070705_1000421402 | 267 |
| 159 | 3300005458 | Ga0070681_10034307 | Ga0070681_100343075 | 267 |
| 160 | 3300005536 | Ga0070697_100183535 | Ga0070697_1001835351 | 267 |
| 161 | 3300006846 | Ga0075430_100015343 | Ga0075430_1000153436 | 267 |
| 162 | 3300006847 | Ga0075431_100000405 | Ga0075431_10000040522 | 267 |
| 163 | 3300006871 | Ga0075434_100399941 | Ga0075434_1003999411 | 267 |
| 164 | 3300006880 | Ga0075429_100161867 | Ga0075429_1001618671 | 267 |
| 165 | 3300025912 | Ga0207707_10061039 | Ga0207707_100610393 | 267 |
| 166 | 3300025922 | Ga0207646_10045803 | Ga0207646_100458032 | 267 |
| 167 | 3300031238 | Ga0265332_10007450 | Ga0265332_100074505 | 267 |
| 168 | 3300031251 | Ga0265327_10017618 | Ga0265327_100176186 | 267 |
| 169 | 3300042876 | Ga0451577_0000600 | Ga0451577_0000600_20620_21423 | 267 |
| 170 | 3300042876 | Ga0451577_0036021 | Ga0451577_0036021_3352_4155 | 267 |
| 171 | 3300042876 | Ga0451577_0440942 | Ga0451577_0440942_356_1162 | 267 |
| 172 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_306404_307207 | 267 |
| 173 | 3300044712 | Ga0453684_0000356 | Ga0453684_0000356_122803_123606 | 267 |
| 174 | 3300044712 | Ga0453684_0002166 | Ga0453684_0002166_6162_6965 | 267 |
| 175 | 3300045051 | Ga0451576_0000634 | Ga0451576_0000634_71732_72535 | 267 |
| 176 | 3300049571 | Ga0501034_0032459 | Ga0501034_0032459_2932_3735 | 267 |
| 177 | 3300050513 | nmdc:mga0rr50_282417_c1 | nmdc:mga0rr50_282417_c1_480_1283 | 267 |
| 178 | 3300053178 | Ga0500637_0111972 | Ga0500637_0111972_151_954 | 267 |
| 179 | 3300005327 | Ga0070658_10019827 | Ga0070658_100198273 | 268 |
| 180 | 3300005329 | Ga0070683_100004472 | Ga0070683_1000044725 | 268 |
| 181 | 3300005331 | Ga0070670_100000425 | Ga0070670_1000004253 | 268 |
| 182 | 3300005334 | Ga0068869_100365476 | Ga0068869_1003654761 | 268 |
| 183 | 3300005335 | Ga0070666_10183492 | Ga0070666_101834922 | 268 |
| 184 | 3300005338 | Ga0068868_100000145 | Ga0068868_10000014531 | 268 |
| 185 | 3300005344 | Ga0070661_100002717 | Ga0070661_1000027175 | 268 |
| 186 | 3300005356 | Ga0070674_100103848 | Ga0070674_1001038483 | 268 |
| 187 | 3300005364 | Ga0070673_100002718 | Ga0070673_1000027182 | 268 |
| 188 | 3300005366 | Ga0070659_100027679 | Ga0070659_1000276792 | 268 |
| 189 | 3300005435 | Ga0070714_100035146 | Ga0070714_1000351462 | 268 |
| 190 | 3300005455 | Ga0070663_100136791 | Ga0070663_1001367912 | 268 |
| 191 | 3300005456 | Ga0070678_100000715 | Ga0070678_1000007153 | 268 |
| 192 | 3300005457 | Ga0070662_100215034 | Ga0070662_1002150342 | 268 |
| 193 | 3300005543 | Ga0070672_100013925 | Ga0070672_1000139256 | 268 |
| 194 | 3300005548 | Ga0070665_100059310 | Ga0070665_1000593105 | 268 |
| 195 | 3300005564 | Ga0070664_100000316 | Ga0070664_1000003163 | 268 |
| 196 | 3300005615 | Ga0070702_100093426 | Ga0070702_1000934262 | 268 |
| 197 | 3300005616 | Ga0068852_100000229 | Ga0068852_10000022932 | 268 |
| 198 | 3300005618 | Ga0068864_100047430 | Ga0068864_1000474303 | 268 |
| 199 | 3300005834 | Ga0068851_10005868 | Ga0068851_100058686 | 268 |
| 200 | 3300005841 | Ga0068863_100025456 | Ga0068863_1000254565 | 268 |
| 201 | 3300006358 | Ga0068871_100001685 | Ga0068871_1000016859 | 268 |
| 202 | 3300009177 | Ga0105248_10130650 | Ga0105248_101306501 | 268 |
| 203 | 3300013102 | Ga0157371_10289519 | Ga0157371_102895191 | 268 |
| 204 | 3300013104 | Ga0157370_10027902 | Ga0157370_100279027 | 268 |
| 205 | 3300013105 | Ga0157369_10779723 | Ga0157369_107797231 | 268 |
| 206 | 3300013296 | Ga0157374_10000860 | Ga0157374_100008602 | 268 |
| 207 | 3300013297 | Ga0157378_10004072 | Ga0157378_100040725 | 268 |
| 208 | 3300014745 | Ga0157377_10035191 | Ga0157377_100351912 | 268 |
| 209 | 3300014969 | Ga0157376_10014114 | Ga0157376_100141142 | 268 |
| 210 | 3300025321 | Ga0207656_10008437 | Ga0207656_100084373 | 268 |
| 211 | 3300025909 | Ga0207705_10008649 | Ga0207705_100086493 | 268 |
| 212 | 3300025925 | Ga0207650_10001393 | Ga0207650_1000139316 | 268 |
| 213 | 3300025926 | Ga0207659_10003124 | Ga0207659_100031243 | 268 |
| 214 | 3300025929 | Ga0207664_10049216 | Ga0207664_100492162 | 268 |
| 215 | 3300025932 | Ga0207690_10017584 | Ga0207690_100175843 | 268 |
| 216 | 3300025937 | Ga0207669_10073322 | Ga0207669_100733221 | 268 |
| 217 | 3300025940 | Ga0207691_10000667 | Ga0207691_100006674 | 268 |
| 218 | 3300025941 | Ga0207711_10014099 | Ga0207711_100140992 | 268 |
| 219 | 3300025944 | Ga0207661_10002441 | Ga0207661_100024415 | 268 |
| 220 | 3300025945 | Ga0207679_10000649 | Ga0207679_1000064921 | 268 |
| 221 | 3300025960 | Ga0207651_10061319 | Ga0207651_100613192 | 268 |
| 222 | 3300026023 | Ga0207677_10002541 | Ga0207677_100025413 | 268 |
| 223 | 3300026067 | Ga0207678_10160899 | Ga0207678_101608992 | 268 |
| 224 | 3300026088 | Ga0207641_10018984 | Ga0207641_100189845 | 268 |
| 225 | 3300026095 | Ga0207676_10038029 | Ga0207676_100380292 | 268 |
| 226 | 3300026121 | Ga0207683_10001353 | Ga0207683_100013535 | 268 |
| 227 | 3300026142 | Ga0207698_10000201 | Ga0207698_100002012 | 268 |
| 228 | 3300028379 | Ga0268266_10040174 | Ga0268266_100401742 | 268 |
| 229 | 3300031507 | Ga0307509_10000075 | Ga0307509_1000007531 | 268 |
| 230 | 3300035724 | Ga0373933_0036513 | Ga0373933_0036513_115_921 | 268 |
| 231 | 3300037068 | Ga0373925_0398192 | Ga0373925_0398192_78_887 | 268 |
| 232 | 3300042876 | Ga0451577_0009608 | Ga0451577_0009608_4045_4857 | 268 |
| 233 | 3300044712 | Ga0453684_0058955 | Ga0453684_0058955_216_1043 | 268 |
| 234 | 3300045051 | Ga0451576_0230102 | Ga0451576_0230102_844_1656 | 268 |
| 235 | 3300048905 | Ga0496102_0217706 | Ga0496102_0217706_64_873 | 268 |
| 236 | 3300048912 | Ga0496109_0009828 | Ga0496109_0009828_507_1316 | 268 |
| 237 | 3300048913 | Ga0496110_0009462 | Ga0496110_0009462_2341_3150 | 268 |
| 238 | 3300048915 | Ga0496112_0755254 | Ga0496112_0755254_25_834 | 268 |
| 239 | 3300048917 | Ga0496114_0098586 | Ga0496114_0098586_1066_1875 | 268 |
| 240 | 3300031548 | Ga0307408_100274899 | Ga0307408_1002748992 | 269 |
| 241 | 3300044712 | Ga0453684_0047079 | Ga0453684_0047079_1701_2510 | 269 |
| 242 | 3300005328 | Ga0070676_10254328 | Ga0070676_102543281 | 270 |
| 243 | 3300005331 | Ga0070670_100269894 | Ga0070670_1002698942 | 270 |
| 244 | 3300005334 | Ga0068869_100525804 | Ga0068869_1005258041 | 270 |
| 245 | 3300005343 | Ga0070687_100067545 | Ga0070687_1000675451 | 270 |
| 246 | 3300005353 | Ga0070669_100101562 | Ga0070669_1001015622 | 270 |
| 247 | 3300005354 | Ga0070675_100132216 | Ga0070675_1001322162 | 270 |
| 248 | 3300005356 | Ga0070674_100210541 | Ga0070674_1002105412 | 270 |
| 249 | 3300005364 | Ga0070673_100168986 | Ga0070673_1001689862 | 270 |
| 250 | 3300005438 | Ga0070701_10024119 | Ga0070701_100241194 | 270 |
| 251 | 3300005441 | Ga0070700_100080913 | Ga0070700_1000809132 | 270 |
| 252 | 3300005456 | Ga0070678_100155753 | Ga0070678_1001557532 | 270 |
| 253 | 3300005457 | Ga0070662_100478331 | Ga0070662_1004783311 | 270 |
| 254 | 3300005459 | Ga0068867_100561060 | Ga0068867_1005610601 | 270 |
| 255 | 3300005719 | Ga0068861_100202953 | Ga0068861_1002029531 | 270 |
| 256 | 3300006237 | Ga0097621_100238420 | Ga0097621_1002384202 | 270 |
| 257 | 3300009176 | Ga0105242_10266441 | Ga0105242_102664412 | 270 |
| 258 | 3300017792 | Ga0163161_10236604 | Ga0163161_102366041 | 270 |
| 259 | 3300025893 | Ga0207682_10003380 | Ga0207682_100033807 | 270 |
| 260 | 3300025907 | Ga0207645_10034564 | Ga0207645_100345642 | 270 |
| 261 | 3300025908 | Ga0207643_10009078 | Ga0207643_100090783 | 270 |
| 262 | 3300025918 | Ga0207662_10068403 | Ga0207662_100684031 | 270 |
| 263 | 3300025926 | Ga0207659_10032634 | Ga0207659_100326342 | 270 |
| 264 | 3300025933 | Ga0207706_10019630 | Ga0207706_100196305 | 270 |
| 265 | 3300025934 | Ga0207686_10193236 | Ga0207686_101932362 | 270 |
| 266 | 3300025940 | Ga0207691_10053596 | Ga0207691_100535963 | 270 |
| 267 | 3300025940 | Ga0207691_10260991 | Ga0207691_102609911 | 270 |
| 268 | 3300025942 | Ga0207689_10141572 | Ga0207689_101415722 | 270 |
| 269 | 3300025945 | Ga0207679_10145906 | Ga0207679_101459061 | 270 |
| 270 | 3300025972 | Ga0207668_10476564 | Ga0207668_104765641 | 270 |
| 271 | 3300026023 | Ga0207677_10203741 | Ga0207677_102037412 | 270 |
| 272 | 3300026075 | Ga0207708_10038460 | Ga0207708_100384602 | 270 |
| 273 | 3300026089 | Ga0207648_10030965 | Ga0207648_100309655 | 270 |
| 274 | 3300026116 | Ga0207674_10348966 | Ga0207674_103489662 | 270 |
| 275 | 3300026118 | Ga0207675_100065930 | Ga0207675_1000659302 | 270 |
| 276 | 3300026121 | Ga0207683_10132779 | Ga0207683_101327792 | 270 |
| 277 | 3300028379 | Ga0268266_10372741 | Ga0268266_103727412 | 270 |
| 278 | 3300028381 | Ga0268264_10169199 | Ga0268264_101691992 | 270 |
| 279 | 3300031238 | Ga0265332_10001626 | Ga0265332_1000162610 | 270 |
| 280 | 3300031239 | Ga0265328_10009856 | Ga0265328_100098562 | 270 |
| 281 | 3300031240 | Ga0265320_10107249 | Ga0265320_101072492 | 270 |
| 282 | 3300031250 | Ga0265331_10003444 | Ga0265331_100034442 | 270 |
| 283 | 3300031251 | Ga0265327_10000542 | Ga0265327_1000054211 | 270 |
| 284 | 3300031344 | Ga0265316_10093678 | Ga0265316_100936781 | 270 |
| 285 | 3300031711 | Ga0265314_10000335 | Ga0265314_1000033535 | 270 |
| 286 | 3300031712 | Ga0265342_10031276 | Ga0265342_100312761 | 270 |
| 287 | 3300031727 | Ga0316576_10023367 | Ga0316576_100233673 | 270 |
| 288 | 3300031733 | Ga0316577_10008398 | Ga0316577_100083986 | 270 |
| 289 | 3300032133 | Ga0316583_10005090 | Ga0316583_100050904 | 270 |
| 290 | 3300032137 | Ga0316585_10011152 | Ga0316585_100111524 | 270 |
| 291 | 3300036647 | Ga0316582_0112152 | Ga0316582_0112152_92_904 | 270 |
| 292 | 3300046528 | Ga0495642_0032982 | Ga0495642_0032982_867_1757 | 270 |
| 293 | 3300046691 | Ga0495670_0069415 | Ga0495670_0069415_684_1574 | 270 |
| 294 | 3300048913 | Ga0496110_0650697 | Ga0496110_0650697_11_889 | 270 |
| 295 | 3300050510 | nmdc:mga06r32_20088_c1 | nmdc:mga06r32_20088_c1_2822_3634 | 270 |
| 296 | 3300027682 | Ga0209971_1020636 | Ga0209971_10206362 | 272 |
| 297 | 3300042876 | Ga0451577_0005072 | Ga0451577_0005072_1632_2456 | 272 |
| 298 | 3300044712 | Ga0453684_0353799 | Ga0453684_0353799_596_1420 | 272 |
| 299 | 3300045051 | Ga0451576_0002387 | Ga0451576_0002387_14836_15660 | 272 |
| 300 | 3300048917 | Ga0496114_0127385 | Ga0496114_0127385_848_1669 | 273 |
| 301 | 3300049587 | Ga0501071_0557569 | Ga0501071_0557569_45_869 | 273 |
| 302 | 3300005330 | Ga0070690_100052825 | Ga0070690_1000528252 | 274 |
| 303 | 3300005335 | Ga0070666_10001027 | Ga0070666_1000102710 | 274 |
| 304 | 3300005338 | Ga0068868_100054390 | Ga0068868_1000543902 | 274 |
| 305 | 3300005340 | Ga0070689_100038362 | Ga0070689_1000383622 | 274 |
| 306 | 3300005355 | Ga0070671_100077132 | Ga0070671_1000771322 | 274 |
| 307 | 3300005367 | Ga0070667_100028749 | Ga0070667_1000287494 | 274 |
| 308 | 3300005548 | Ga0070665_100036872 | Ga0070665_1000368722 | 274 |
| 309 | 3300005617 | Ga0068859_100147026 | Ga0068859_1001470262 | 274 |
| 310 | 3300005618 | Ga0068864_100074562 | Ga0068864_1000745623 | 274 |
| 311 | 3300005834 | Ga0068851_10156404 | Ga0068851_101564042 | 274 |
| 312 | 3300005841 | Ga0068863_100026541 | Ga0068863_1000265416 | 274 |
| 313 | 3300005842 | Ga0068858_100005423 | Ga0068858_10000542312 | 274 |
| 314 | 3300005843 | Ga0068860_100005932 | Ga0068860_1000059326 | 274 |
| 315 | 3300005844 | Ga0068862_100397048 | Ga0068862_1003970482 | 274 |
| 316 | 3300006237 | Ga0097621_100001309 | Ga0097621_10000130912 | 274 |
| 317 | 3300006358 | Ga0068871_100005027 | Ga0068871_1000050272 | 274 |
| 318 | 3300006931 | Ga0097620_100147034 | Ga0097620_1001470342 | 274 |
| 319 | 3300007788 | Ga0099795_10000001 | Ga0099795_1000000167 | 274 |
| 320 | 3300009098 | Ga0105245_10012117 | Ga0105245_100121178 | 274 |
| 321 | 3300009176 | Ga0105242_10073964 | Ga0105242_100739642 | 274 |
| 322 | 3300009177 | Ga0105248_10143914 | Ga0105248_101439142 | 274 |
| 323 | 3300009551 | Ga0105238_10212884 | Ga0105238_102128842 | 274 |
| 324 | 3300010159 | Ga0099796_10000001 | Ga0099796_1000000152 | 274 |
| 325 | 3300013296 | Ga0157374_10018024 | Ga0157374_100180245 | 274 |
| 326 | 3300013297 | Ga0157378_10065959 | Ga0157378_100659592 | 274 |
| 327 | 3300013306 | Ga0163162_10016546 | Ga0163162_100165463 | 274 |
| 328 | 3300013308 | Ga0157375_10007106 | Ga0157375_100071069 | 274 |
| 329 | 3300014325 | Ga0163163_10002837 | Ga0163163_1000283711 | 274 |
| 330 | 3300014968 | Ga0157379_10004663 | Ga0157379_1000466311 | 274 |
| 331 | 3300014969 | Ga0157376_10004036 | Ga0157376_100040366 | 274 |
| 332 | 3300025321 | Ga0207656_10083694 | Ga0207656_100836942 | 274 |
| 333 | 3300025924 | Ga0207694_10151899 | Ga0207694_101518992 | 274 |
| 334 | 3300025936 | Ga0207670_10050295 | Ga0207670_100502952 | 274 |
| 335 | 3300025941 | Ga0207711_10002694 | Ga0207711_1000269410 | 274 |
| 336 | 3300025986 | Ga0207658_10009511 | Ga0207658_100095113 | 274 |
| 337 | 3300026023 | Ga0207677_10119344 | Ga0207677_101193442 | 274 |
| 338 | 3300026035 | Ga0207703_10069468 | Ga0207703_100694682 | 274 |
| 339 | 3300026088 | Ga0207641_10004933 | Ga0207641_100049339 | 274 |
| 340 | 3300026095 | Ga0207676_10057056 | Ga0207676_100570562 | 274 |
| 341 | 3300027512 | Ga0209179_1000006 | Ga0209179_100000681 | 274 |
| 342 | 3300028379 | Ga0268266_10034651 | Ga0268266_100346512 | 274 |
| 343 | 3300028380 | Ga0268265_10293347 | Ga0268265_102933472 | 274 |
| 344 | 3300048903 | Ga0496100_0065688 | Ga0496100_0065688_641_1486 | 274 |
| 345 | 3300048904 | Ga0496101_0018622 | Ga0496101_0018622_3470_4315 | 274 |
| 346 | 3300048907 | Ga0496104_0030300 | Ga0496104_0030300_2132_2977 | 274 |
| 347 | 3300048908 | Ga0496105_0004965 | Ga0496105_0004965_1443_2288 | 274 |
| 348 | 3300048911 | Ga0496108_0123628 | Ga0496108_0123628_86_931 | 274 |
| 349 | 3300048912 | Ga0496109_0018297 | Ga0496109_0018297_4419_5264 | 274 |
| 350 | 3300048913 | Ga0496110_0069388 | Ga0496110_0069388_2062_2907 | 274 |
| 351 | 3300048914 | Ga0496111_0078748 | Ga0496111_0078748_1104_1949 | 274 |
| 352 | 3300041486 | Ga0451807_2614339 | Ga0451807_2614339_165_1079 | 275 |
| 353 | 3300003761 | Ga0055535_1000167 | Ga0055535_100016733 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3luz-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9822 | 6 | 263 |
| 3luz-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9752 | 6 | 263 |
| 3luz-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.974 | 6 | 263 |
| 3luz-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9587 | 6 | 263 |
| 2qfl-assembly1.cif.gz_A | structure of suhb: inositol monophosphatase and extragenic suppressor from e. coli | 0.9572 | 5 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3luzB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9793 | 146 | 263 | 3.40.190.80 |
| 5zhhC01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9677 | 9 | 144 | 3.30.540.10 |
| 3luzB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9618 | 146 | 263 | 3.40.190.80 |
| 6ib8A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9592 | 146 | 264 | 3.40.190.80 |
| af_Q54U72_147_270_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9488 | 147 | 262 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A837Q4N6-F1-model_v4 | deleted | 0.9863 | 5 | 153 |
|
| AF-A0A4Q3Q142-F1-model_v4 | deleted | 0.9844 | 1 | 114 |
|
| AF-A0A537GFE0-F1-model_v4 | Inositol-1-monophosphatase (EC 3.1.3.25) | 0.9824 | 5 | 234 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A7C1PI53-F1-model_v4 | Inositol monophosphatase | 0.9811 | 134 | 262 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A528V7A3-F1-model_v4 | Inositol monophosphatase | 0.9804 | 109 | 206 |
GO:0006020
GO:0007165 GO:0008934 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar