F419469

General Info

Members Datasets Scaffolds Average Seq Length
353 167 352 123

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1344316|Ga0436360_1344316_208_642
Length 144
Sequence LTVREVPQRRVAYHRTVMPQPAGLLYSKEHEWIKLDGDTATVGITDYAQSSLGDIVYVELPRLGSSLEQFGSIGVIESVKAVSDIYTPVGGEVVAVNDAIESDPALVNRDPFGEGWLFKVKLADVSQRDTLLSPDAYDKLVAEA

Samples

Sample ID Description Type Environment
1 2671180694 Paenibacillus sp. A3 Isolate Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
87 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
105 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
116 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
164 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 0
Rhizosphere 91.22
Stem 0
Stem Tuber 0
Unclassified 7.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10079663 3300001990 Bacteria 975
2 rootH2_10034013 3300003320 Bacteria 5602
3 rootH2_10049147 3300003320 Bacteria 1561
4 JGI25404J52841_10045260 3300003659 Bacteria 928
5 Ga0070658_10028394 3300005327 Bacteria 4490
6 Ga0070658_10647647 3300005327 Bacteria 917
7 Ga0070658_10859544 3300005327 Bacteria 788
8 Ga0070658_11938034 3300005327 Bacteria 509
9 Ga0070676_10207196 3300005328 Bacteria 1288
10 Ga0070683_100258705 3300005329 Bacteria 1655
11 Ga0070666_10000705 3300005335 Bacteria 20271
12 Ga0070660_100105286 3300005339 Bacteria 2239
13 Ga0070660_100406179 3300005339 Bacteria 1127
14 Ga0070661_100161059 3300005344 Bacteria 1699
15 Ga0070661_100495308 3300005344 Bacteria 977
16 Ga0070692_10221269 3300005345 Bacteria 1119
17 Ga0070668_100899517 3300005347 Bacteria 791
18 Ga0070659_100021006 3300005366 Bacteria 4966
19 Ga0070659_101515750 3300005366 Bacteria 597
20 Ga0070667_100701365 3300005367 Bacteria 937
21 Ga0070667_100976192 3300005367 Bacteria 790
22 Ga0070709_10073792 3300005434 Bacteria 2209
23 Ga0070700_100622107 3300005441 Bacteria 849
24 Ga0070663_100060865 3300005455 Bacteria 2717
25 Ga0070681_10000001 3300005458 Bacteria 946857
26 Ga0070681_10130151 3300005458 Bacteria 2449
27 Ga0070699_100665927 3300005518 Bacteria 950
28 Ga0070679_100000032 3300005530 Bacteria 105384
29 Ga0070679_100009848 3300005530 Bacteria 9042
30 Ga0070679_100038619 3300005530 Bacteria 4747
31 Ga0070679_100698863 3300005530 Bacteria 957
32 Ga0070684_100117901 3300005535 Bacteria 2385
33 Ga0070684_101723214 3300005535 Bacteria 591
34 Ga0068853_100126789 3300005539 Bacteria 2281
35 Ga0068853_100400884 3300005539 Bacteria 1284
36 Ga0068853_100502350 3300005539 Bacteria 1145
37 Ga0068853_101397632 3300005539 Bacteria 677
38 Ga0070695_100179723 3300005545 Bacteria 1498
39 Ga0070696_100730805 3300005546 Bacteria 809
40 Ga0070693_100037018 3300005547 Bacteria 2717
41 Ga0070693_100048452 3300005547 Bacteria 2420
42 Ga0070665_100000381 3300005548 Bacteria 65638
43 Ga0070665_100545939 3300005548 Bacteria 1171
44 Ga0070665_100949257 3300005548 Bacteria 872
45 Ga0070665_101577468 3300005548 Bacteria 664
46 Ga0068855_100025194 3300005563 Bacteria 7122
47 Ga0068855_100111856 3300005563 Bacteria 3134
48 Ga0068855_100116080 3300005563 Bacteria 3068
49 Ga0068855_100696505 3300005563 Bacteria 1087
50 Ga0068855_101806067 3300005563 Bacteria 621
51 Ga0068855_102188306 3300005563 Bacteria 555
52 Ga0070664_100157563 3300005564 Bacteria 2007
53 Ga0068857_100005550 3300005577 Bacteria 10763
54 Ga0068854_100018528 3300005578 Bacteria 4676
55 Ga0068854_100051259 3300005578 Bacteria 2956
56 Ga0068856_100013166 3300005614 Bacteria 8012
57 Ga0068856_100077766 3300005614 Bacteria 3288
58 Ga0068856_100256924 3300005614 Bacteria 1762
59 Ga0068856_100367302 3300005614 Bacteria 1458
60 Ga0068856_102232657 3300005614 Bacteria 556
61 Ga0068852_100053541 3300005616 Bacteria 3474
62 Ga0068852_100081170 3300005616 Bacteria 2878
63 Ga0068852_100101397 3300005616 Bacteria 2599
64 Ga0068852_100210532 3300005616 Bacteria 1844
65 Ga0068852_100456611 3300005616 Bacteria 1266
66 Ga0068851_10479681 3300005834 Bacteria 743
67 Ga0068858_100008493 3300005842 Bacteria 9869
68 Ga0068860_100927761 3300005843 Bacteria 887
69 Ga0081540_1002200 3300005983 Bacteria 16104
70 Ga0075428_100022647 3300006844 Bacteria 6954
71 Ga0075433_10131881 3300006852 Bacteria 2220
72 Ga0075436_100021021 3300006914 Bacteria 4477
73 Ga0105240_10004317 3300009093 Bacteria 21704
74 Ga0105240_10020072 3300009093 Bacteria 8921
75 Ga0105240_10064329 3300009093 Bacteria 4558
76 Ga0105240_10073829 3300009093 Bacteria 4212
77 Ga0105240_10076267 3300009093 Bacteria 4133
78 Ga0105240_10157366 3300009093 Bacteria 2701
79 Ga0105240_10294583 3300009093 Bacteria 1858
80 Ga0105240_10330596 3300009093 Bacteria 1734
81 Ga0105240_10381695 3300009093 Bacteria 1591
82 Ga0105240_10782685 3300009093 Bacteria 1035
83 Ga0105241_10047631 3300009174 Bacteria 3260
84 Ga0105241_10221007 3300009174 Bacteria 1592
85 Ga0105241_11580875 3300009174 Bacteria 633
86 Ga0105241_12676714 3300009174 Bacteria 502
87 Ga0105248_10000005 3300009177 Bacteria 673111
88 Ga0105248_10575043 3300009177 Bacteria 1271
89 Ga0105248_11236351 3300009177 Bacteria 845
90 Ga0105248_12148750 3300009177 Bacteria 635
91 Ga0105237_10294619 3300009545 Bacteria 1625
92 Ga0105237_10491106 3300009545 Bacteria 1234
93 Ga0105237_11435678 3300009545 Bacteria 696
94 Ga0105238_10023221 3300009551 Bacteria 6322
95 Ga0105238_10310199 3300009551 Bacteria 1562
96 Ga0105239_10036584 3300010375 Bacteria 5389
97 Ga0105239_10109369 3300010375 Bacteria 3063
98 Ga0105239_10127180 3300010375 Bacteria 2833
99 Ga0105239_10153678 3300010375 Bacteria 2569
100 Ga0105239_10187100 3300010375 Bacteria 2318
101 Ga0105239_11556111 3300010375 Bacteria 764
102 Ga0157373_10249629 3300013100 Bacteria 1255
103 Ga0157371_10546530 3300013102 Bacteria 858
104 Ga0157371_10904707 3300013102 Bacteria 669
105 Ga0157370_10229203 3300013104 Bacteria 1720
106 Ga0157370_10716427 3300013104 Bacteria 913
107 Ga0157370_11654020 3300013104 Bacteria 575
108 Ga0157369_10020412 3300013105 Bacteria 7405
109 Ga0157369_10093655 3300013105 Bacteria 3206
110 Ga0157369_10246958 3300013105 Bacteria 1863
111 Ga0157369_10436875 3300013105 Bacteria 1356
112 Ga0157369_10594582 3300013105 Bacteria 1142
113 Ga0157369_11265105 3300013105 Bacteria 752
114 Ga0157374_10272893 3300013296 Bacteria 1668
115 Ga0157372_10051447 3300013307 Bacteria 4585
116 Ga0157372_10285030 3300013307 Bacteria 1921
117 Ga0157372_10458335 3300013307 Bacteria 1486
118 Ga0157375_13171311 3300013308 Bacteria 548
119 Ga0163163_10087620 3300014325 Bacteria 3124
120 Ga0157379_10004979 3300014968 Bacteria 11401
121 Ga0157376_10608443 3300014969 Bacteria 1088
122 Ga0213872_10001920 3300021361 Bacteria 12717
123 Ga0213872_10013123 3300021361 Bacteria 3884
124 Ga0213872_10016636 3300021361 Bacteria 3411
125 Ga0213872_10321654 3300021361 Bacteria 639
126 Ga0213874_10019750 3300021377 Bacteria 1838
127 Ga0213874_10231645 3300021377 Bacteria 675
128 Ga0213876_10000785 3300021384 Bacteria 21620
129 Ga0213876_10541657 3300021384 Bacteria 619
130 Ga0213875_10000001 3300021388 Bacteria 2793540
131 Ga0213875_10001207 3300021388 Bacteria 17602
132 Ga0213875_10006216 3300021388 Bacteria 6295
133 Ga0213875_10008758 3300021388 Bacteria 5164
134 Ga0213871_10029332 3300021441 Bacteria 1426
135 Ga0207699_10137951 3300025906 Bacteria 1599
136 Ga0207705_10000101 3300025909 Bacteria 98231
137 Ga0207705_10160541 3300025909 Bacteria 1688
138 Ga0207654_10040633 3300025911 Bacteria 2622
139 Ga0207654_10231412 3300025911 Bacteria 1231
140 Ga0207654_10306674 3300025911 Bacteria 1081
141 Ga0207654_10400419 3300025911 Bacteria 954
142 Ga0207654_10727050 3300025911 Bacteria 714
143 Ga0207654_11068170 3300025911 Bacteria 588
144 Ga0207707_10000001 3300025912 Bacteria 1212482
145 Ga0207695_10002104 3300025913 Bacteria 30252
146 Ga0207695_10014491 3300025913 Bacteria 9332
147 Ga0207695_10025998 3300025913 Bacteria 6541
148 Ga0207695_10080400 3300025913 Bacteria 3301
149 Ga0207695_10089071 3300025913 Bacteria 3104
150 Ga0207695_10270497 3300025913 Bacteria 1595
151 Ga0207695_10276544 3300025913 Bacteria 1573
152 Ga0207695_10376682 3300025913 Bacteria 1305
153 Ga0207695_10434736 3300025913 Bacteria 1196
154 Ga0207695_10440345 3300025913 Bacteria 1187
155 Ga0207671_10398262 3300025914 Bacteria 1095
156 Ga0207671_11268291 3300025914 Bacteria 575
157 Ga0207693_10114415 3300025915 Bacteria 2117
158 Ga0207660_10000280 3300025917 Bacteria 33705
159 Ga0207660_10040748 3300025917 Bacteria 3253
160 Ga0207660_10071727 3300025917 Bacteria 2520
161 Ga0207657_10049230 3300025919 Bacteria 3674
162 Ga0207657_10198489 3300025919 Bacteria 1615
163 Ga0207649_10202373 3300025920 Bacteria 1403
164 Ga0207649_10915745 3300025920 Bacteria 688
165 Ga0207652_10000722 3300025921 Bacteria 32051
166 Ga0207652_10011076 3300025921 Bacteria 7269
167 Ga0207652_10154548 3300025921 Bacteria 2055
168 Ga0207694_10005311 3300025924 Bacteria 9925
169 Ga0207694_10035915 3300025924 Bacteria 3802
170 Ga0207664_10003018 3300025929 Bacteria 11192
171 Ga0207664_10528177 3300025929 Bacteria 1058
172 Ga0207690_10005032 3300025932 Bacteria 7809
173 Ga0207690_11188123 3300025932 Bacteria 637
174 Ga0207711_10000002 3300025941 Bacteria 1228676
175 Ga0207711_10477233 3300025941 Bacteria 1162
176 Ga0207679_10149173 3300025945 Bacteria 1901
177 Ga0207667_10008750 3300025949 Bacteria 12000
178 Ga0207667_10049835 3300025949 Bacteria 4420
179 Ga0207667_10113728 3300025949 Bacteria 2790
180 Ga0207667_10205452 3300025949 Bacteria 2020
181 Ga0207640_10005210 3300025981 Bacteria 7075
182 Ga0207640_10007820 3300025981 Bacteria 5902
183 Ga0207640_11658151 3300025981 Bacteria 577
184 Ga0207703_10006047 3300026035 Bacteria 9680
185 Ga0207639_10299644 3300026041 Bacteria 1421
186 Ga0207639_11790332 3300026041 Bacteria 575
187 Ga0207639_12231634 3300026041 Bacteria 509
188 Ga0207678_10059344 3300026067 Bacteria 3292
189 Ga0207702_10008840 3300026078 Bacteria 8490
190 Ga0207702_10081309 3300026078 Bacteria 2813
191 Ga0207702_10105336 3300026078 Bacteria 2498
192 Ga0207702_10121659 3300026078 Bacteria 2337
193 Ga0207702_10304215 3300026078 Bacteria 1514
194 Ga0207702_10475651 3300026078 Bacteria 1215
195 Ga0207648_10592736 3300026089 Bacteria 1021
196 Ga0207674_10000261 3300026116 Bacteria 66008
197 Ga0207674_10045284 3300026116 Bacteria 4526
198 Ga0207674_10125854 3300026116 Bacteria 2528
199 Ga0207698_10030262 3300026142 Bacteria 3890
200 Ga0207698_10050690 3300026142 Bacteria 3168
201 Ga0207698_10216380 3300026142 Bacteria 1728
202 Ga0207698_10241903 3300026142 Bacteria 1645
203 Ga0265356_1000881 3300028017 Bacteria 4911
204 Ga0265357_1038151 3300028023 Bacteria 560
205 Ga0268266_10000900 3300028379 Bacteria 38445
206 Ga0268266_10007047 3300028379 Bacteria 10208
207 Ga0268266_10184279 3300028379 Bacteria 1903
208 Ga0268266_10364888 3300028379 Bacteria 1359
209 Ga0268264_10772504 3300028381 Bacteria 958
210 Ga0265338_10010999 3300028800 Bacteria 10510
211 Ga0265338_10051209 3300028800 Bacteria 3721
212 Ga0265330_10067416 3300031235 Bacteria 1551
213 Ga0265320_10001113 3300031240 Bacteria 19838
214 Ga0265325_10000642 3300031241 Bacteria 25412
215 Ga0265325_10020513 3300031241 Bacteria 3643
216 Ga0265325_10061112 3300031241 Bacteria 1912
217 Ga0265340_10006802 3300031247 Bacteria 6258
218 Ga0265340_10020117 3300031247 Bacteria 3435
219 Ga0265340_10229775 3300031247 Bacteria 830
220 Ga0265339_10002646 3300031249 Bacteria 12770
221 Ga0265339_10160369 3300031249 Bacteria 1132
222 Ga0265331_10063903 3300031250 Bacteria 1733
223 Ga0265331_10248664 3300031250 Bacteria 797
224 Ga0265316_10013102 3300031344 Bacteria 7392
225 Ga0265316_10113840 3300031344 Bacteria 2047
226 Ga0265316_10624474 3300031344 Bacteria 763
227 Ga0265316_10655082 3300031344 Bacteria 742
228 Ga0265313_10002994 3300031595 Bacteria 14065
229 Ga0265313_10332176 3300031595 Bacteria 605
230 Ga0265314_10026248 3300031711 Bacteria 4379
231 Ga0265314_10238585 3300031711 Bacteria 1050
232 Ga0265314_10441495 3300031711 Bacteria 695
233 Ga0265342_10043060 3300031712 Bacteria 2726
234 Ga0265342_10046922 3300031712 Bacteria 2595
235 Ga0307406_10248388 3300031901 Bacteria 1339
236 Ga0307412_10136408 3300031911 Bacteria 1791
237 Ga0307416_101247978 3300032002 Unclassified 849
238 Ga0307416_101353220 3300032002 Bacteria 818
239 Ga0316214_1032752 3300033545 Bacteria 739
240 Ga0373938_0134316 3300034957 Bacteria 648
241 Ga0373936_0131356 3300035113 Bacteria 1076
242 Ga0373933_0896842 3300035724 Bacteria 584
243 Ga0373937_0022488 3300036401 Bacteria 5670
244 Ga0373937_1207615 3300036401 Bacteria 705
245 Ga0395899_0023889 3300037312 Bacteria 4626
246 Ga0395899_0089045 3300037312 Bacteria 2239
247 Ga0395900_0212632 3300037418 Bacteria 1952
248 Ga0395900_0221805 3300037418 Bacteria 1905
249 Ga0395900_0282494 3300037418 Bacteria 1651
250 Ga0395900_0512794 3300037418 Bacteria 1148
251 Ga0395900_1061285 3300037418 Bacteria 728
252 Ga0395898_0018663 3300037466 Bacteria 7071
253 Ga0395898_0038545 3300037466 Bacteria 4735
254 Ga0395905_0403834 3300037471 Bacteria 1261
255 Ga0436364_0129083 3300037853 Bacteria 57317
256 Ga0436364_0164468 3300037853 Bacteria 4710
257 Ga0436364_0273345 3300037853 Bacteria 2794207
258 Ga0436364_0683699 3300037853 Bacteria 3608
259 Ga0436364_1373059 3300037853 Bacteria 7126
260 Ga0395901_0013250 3300038443 Bacteria 8372
261 Ga0395901_0115857 3300038443 Bacteria 2815
262 Ga0400484_29468 3300038725 Bacteria 5055
263 Ga0400490_37512 3300038726 Bacteria 5366
264 Ga0436365_0066450 3300039437 Bacteria 14032
265 Ga0436365_0687864 3300039437 Bacteria 8538
266 Ga0436360_0619315 3300039438 Unclassified 838
267 Ga0436360_0659255 3300039438 Bacteria 1369
268 Ga0436360_0783740 3300039438 Bacteria 951
269 Ga0436360_1053302 3300039438 Bacteria 726
270 Ga0436360_1344316 3300039438 Bacteria 2052
271 Ga0436360_1346545 3300039438 Bacteria 909
272 Ga0436361_0067874 3300039447 Bacteria 760
273 Ga0436361_0407836 3300039447 Bacteria 1958
274 Ga0436361_0529418 3300039447 Bacteria 24716
275 Ga0436361_0612189 3300039447 Bacteria 4630
276 Ga0436361_0624807 3300039447 Bacteria 1690
277 Ga0436361_0651334 3300039447 Bacteria 20505
278 Ga0436361_0758369 3300039447 Bacteria 851
279 Ga0436363_0044671 3300039450 Bacteria 1607
280 Ga0436363_0158779 3300039450 Bacteria 3449
281 Ga0436363_0688063 3300039450 Bacteria 871
282 Ga0436363_1151863 3300039450 Bacteria 542
283 Ga0436363_1665051 3300039450 Bacteria 859
284 Ga0436362_0124114 3300039453 Bacteria 714
285 Ga0436362_0205617 3300039453 Bacteria 1064
286 Ga0436362_0252736 3300039453 Bacteria 823
287 Ga0436362_0790521 3300039453 Bacteria 1144
288 Ga0436362_1085551 3300039453 Bacteria 1812
289 Ga0466961_0628678 3300044693 Bacteria 645
290 Ga0466963_0064196 3300044694 Bacteria 2459
291 Ga0466968_0033865 3300044735 Bacteria 2130
292 Ga0466957_0142848 3300044842 Bacteria 1543
293 Ga0466957_0747627 3300044842 Bacteria 692
294 Ga0466957_1051086 3300044842 Bacteria 586
295 Ga0466967_1916281 3300045976 Unclassified 589
296 Ga0495592_0733778 3300046454 Bacteria 592
297 Ga0495651_0244126 3300046462 Bacteria 1230
298 Ga0495580_0120654 3300046472 Bacteria 1820
299 Ga0495652_0273632 3300046529 Bacteria 1240
300 Ga0495587_0091088 3300046536 Bacteria 1762
301 Ga0495645_0563381 3300046543 Bacteria 705
302 Ga0495599_0340288 3300046678 Bacteria 901
303 Ga0495669_0133486 3300046684 Bacteria 1169
304 Ga0496116_0282017 3300048919 Bacteria 804
305 Ga0496126_0001865 3300048929 Bacteria 30699
306 Ga0501292_065672 3300049515 Unclassified 666
307 Ga0501032_0045589 3300049569 Bacteria 2965
308 Ga0501033_0105447 3300049570 Bacteria 2054
309 Ga0501033_0834869 3300049570 Bacteria 622
310 Ga0501034_0201204 3300049571 Bacteria 1950
311 Ga0501034_1001848 3300049571 Bacteria 719
312 Ga0501036_0048300 3300049572 Bacteria 3603
313 Ga0501037_0176378 3300049573 Bacteria 1518
314 Ga0501038_0065473 3300049574 Bacteria 3096
315 Ga0501038_1094406 3300049574 Bacteria 582
316 Ga0501039_0426816 3300049575 Bacteria 1041
317 Ga0501040_0569834 3300049576 Bacteria 817
318 Ga0501043_0104860 3300049579 Bacteria 2222
319 Ga0501043_0122813 3300049579 Bacteria 2037
320 Ga0501046_0014613 3300049580 Bacteria 6616
321 Ga0501047_0003368 3300049581 Bacteria 15134
322 Ga0501047_0036090 3300049581 Bacteria 4776
323 Ga0501047_0390064 3300049581 Bacteria 1226
324 Ga0501047_0660729 3300049581 Bacteria 864
325 Ga0501047_0857306 3300049581 Bacteria 722
326 Ga0501048_0139196 3300049582 Bacteria 1716
327 Ga0501048_0489576 3300049582 Bacteria 882
328 Ga0501067_0006765 3300049583 Bacteria 6359
329 Ga0501069_0009909 3300049585 Bacteria 5038
330 Ga0501070_0003697 3300049586 Bacteria 13227
331 Ga0501073_0005587 3300049589 Bacteria 9406
332 Ga0501073_0013272 3300049589 Bacteria 6003
333 Ga0501074_0291336 3300049590 Bacteria 1160
334 Ga0501077_0350757 3300049593 Bacteria 942
335 Ga0501249_042534 3300049679 Bacteria 1033
336 Ga0501080_0006778 3300049742 Bacteria 10320
337 Ga0501080_0255091 3300049742 Bacteria 1599
338 Ga0501080_0889038 3300049742 Bacteria 777
339 Ga0501035_0003918 3300049822 Bacteria 14193
340 Ga0501035_0177381 3300049822 Bacteria 1837
341 Ga0501035_0562315 3300049822 Bacteria 933
342 Ga0501044_0011957 3300049823 Bacteria 9406
343 Ga0501044_0020413 3300049823 Bacteria 7074
344 Ga0501044_0221860 3300049823 Bacteria 1841
345 Ga0501045_0131932 3300049824 Bacteria 1857
346 nmdc:mga08x19_214308_c1 3300050514 Bacteria 1322
347 nmdc:mga0a205_539014_c1 3300050515 Bacteria 1023
348 Ga0500595_066270 3300053119 Bacteria 1080
349 Ga0500619_029130 3300053154 Bacteria 1668
350 Ga0500622_0090948 3300053156 Bacteria 1514
351 Ga0501084_0021074 3300054114 Bacteria 5436
352 Ga0501082_0032928 3300060353 Bacteria 4470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10020117 Ga0265340_100201173 107
2 3300031344 Ga0265316_10655082 Ga0265316_106550821 107
3 3300005327 Ga0070658_10859544 Ga0070658_108595441 109
4 3300005339 Ga0070660_100105286 Ga0070660_1001052863 109
5 3300005366 Ga0070659_101515750 Ga0070659_1015157502 109
6 3300005458 Ga0070681_10130151 Ga0070681_101301512 109
7 3300005530 Ga0070679_100009848 Ga0070679_1000098486 109
8 3300005530 Ga0070679_100698863 Ga0070679_1006988632 109
9 3300005548 Ga0070665_100000381 Ga0070665_10000038156 109
10 3300005614 Ga0068856_100077766 Ga0068856_1000777663 109
11 3300009093 Ga0105240_10381695 Ga0105240_103816952 109
12 3300013105 Ga0157369_10594582 Ga0157369_105945822 109
13 3300025913 Ga0207695_10276544 Ga0207695_102765442 109
14 3300025913 Ga0207695_10376682 Ga0207695_103766822 109
15 3300025917 Ga0207660_10040748 Ga0207660_100407483 109
16 3300025919 Ga0207657_10198489 Ga0207657_101984892 109
17 3300025921 Ga0207652_10011076 Ga0207652_100110766 109
18 3300025932 Ga0207690_11188123 Ga0207690_111881232 109
19 3300026078 Ga0207702_10121659 Ga0207702_101216591 109
20 3300028379 Ga0268266_10000900 Ga0268266_1000090016 109
21 3300038443 Ga0395901_0115857 Ga0395901_0115857_409_783 109
22 3300049581 Ga0501047_0857306 Ga0501047_0857306_326_700 109
23 3300049589 Ga0501073_0013272 Ga0501073_0013272_1937_2311 109
24 3300049742 Ga0501080_0889038 Ga0501080_0889038_22_396 109
25 3300009545 Ga0105237_11435678 Ga0105237_114356781 110
26 3300044842 Ga0466957_0142848 Ga0466957_0142848_1029_1403 110
27 3300045976 Ga0466967_1916281 Ga0466967_1916281_164_538 110
28 3300049582 Ga0501048_0489576 Ga0501048_0489576_341_715 111
29 3300005563 Ga0068855_100116080 Ga0068855_1001160803 113
30 3300009093 Ga0105240_10294583 Ga0105240_102945832 113
31 3300013104 Ga0157370_10229203 Ga0157370_102292032 113
32 3300025913 Ga0207695_10270497 Ga0207695_102704972 114
33 3300025949 Ga0207667_10113728 Ga0207667_101137283 114
34 3300031250 Ga0265331_10063903 Ga0265331_100639032 114
35 3300031344 Ga0265316_10113840 Ga0265316_101138402 114
36 3300031711 Ga0265314_10026248 Ga0265314_100262482 114
37 3300031712 Ga0265342_10046922 Ga0265342_100469223 114
38 3300026089 Ga0207648_10592736 Ga0207648_105927362 120
39 3300046684 Ga0495669_0133486 Ga0495669_0133486_473_850 121
40 3300053156 Ga0500622_0090948 Ga0500622_0090948_390_755 121
41 3300009177 Ga0105248_11236351 Ga0105248_112363512 122
42 3300021361 Ga0213872_10001920 Ga0213872_100019203 122
43 3300021361 Ga0213872_10013123 Ga0213872_100131233 122
44 3300021361 Ga0213872_10016636 Ga0213872_100166362 122
45 3300021388 Ga0213875_10000001 Ga0213875_100000012052 122
46 3300028017 Ga0265356_1000881 Ga0265356_10008812 122
47 3300028023 Ga0265357_1038151 Ga0265357_10381512 122
48 3300036401 Ga0373937_0022488 Ga0373937_0022488_2356_2733 122
49 3300037853 Ga0436364_0273345 Ga0436364_0273345_2152953_2153333 122
50 3300039438 Ga0436360_0619315 Ga0436360_0619315_362_742 122
51 3300039438 Ga0436360_0783740 Ga0436360_0783740_337_717 122
52 3300039438 Ga0436360_1346545 Ga0436360_1346545_133_513 122
53 3300039447 Ga0436361_0407836 Ga0436361_0407836_1233_1613 122
54 3300039447 Ga0436361_0529418 Ga0436361_0529418_3125_3505 122
55 3300039447 Ga0436361_0612189 Ga0436361_0612189_3121_3501 122
56 3300039447 Ga0436361_0651334 Ga0436361_0651334_17000_17380 122
57 3300039447 Ga0436361_0758369 Ga0436361_0758369_37_417 122
58 3300039453 Ga0436362_0252736 Ga0436362_0252736_16_396 122
59 3300046462 Ga0495651_0244126 Ga0495651_0244126_179_556 122
60 iso_pu_bacteria 2671180694 2673818146 122
61 3300001990 JGI24737J22298_10079663 JGI24737J22298_100796631 123
62 3300003320 rootH2_10034013 rootH2_100340135 123
63 3300003320 rootH2_10049147 rootH2_100491472 123
64 3300003659 JGI25404J52841_10045260 JGI25404J52841_100452601 123
65 3300005327 Ga0070658_10028394 Ga0070658_100283944 123
66 3300005327 Ga0070658_10647647 Ga0070658_106476471 123
67 3300005327 Ga0070658_11938034 Ga0070658_119380341 123
68 3300005328 Ga0070676_10207196 Ga0070676_102071962 123
69 3300005329 Ga0070683_100258705 Ga0070683_1002587051 123
70 3300005335 Ga0070666_10000705 Ga0070666_100007052 123
71 3300005339 Ga0070660_100406179 Ga0070660_1004061792 123
72 3300005344 Ga0070661_100161059 Ga0070661_1001610592 123
73 3300005344 Ga0070661_100495308 Ga0070661_1004953081 123
74 3300005345 Ga0070692_10221269 Ga0070692_102212692 123
75 3300005347 Ga0070668_100899517 Ga0070668_1008995172 123
76 3300005366 Ga0070659_100021006 Ga0070659_1000210065 123
77 3300005367 Ga0070667_100701365 Ga0070667_1007013652 123
78 3300005367 Ga0070667_100976192 Ga0070667_1009761922 123
79 3300005434 Ga0070709_10073792 Ga0070709_100737922 123
80 3300005441 Ga0070700_100622107 Ga0070700_1006221072 123
81 3300005455 Ga0070663_100060865 Ga0070663_1000608654 123
82 3300005458 Ga0070681_10000001 Ga0070681_10000001444 123
83 3300005518 Ga0070699_100665927 Ga0070699_1006659271 123
84 3300005530 Ga0070679_100000032 Ga0070679_10000003257 123
85 3300005530 Ga0070679_100038619 Ga0070679_1000386193 123
86 3300005535 Ga0070684_100117901 Ga0070684_1001179013 123
87 3300005535 Ga0070684_101723214 Ga0070684_1017232141 123
88 3300005539 Ga0068853_100126789 Ga0068853_1001267894 123
89 3300005539 Ga0068853_100400884 Ga0068853_1004008842 123
90 3300005539 Ga0068853_100502350 Ga0068853_1005023502 123
91 3300005539 Ga0068853_101397632 Ga0068853_1013976322 123
92 3300005545 Ga0070695_100179723 Ga0070695_1001797232 123
93 3300005546 Ga0070696_100730805 Ga0070696_1007308052 123
94 3300005547 Ga0070693_100037018 Ga0070693_1000370182 123
95 3300005547 Ga0070693_100048452 Ga0070693_1000484522 123
96 3300005548 Ga0070665_100545939 Ga0070665_1005459392 123
97 3300005548 Ga0070665_100949257 Ga0070665_1009492572 123
98 3300005548 Ga0070665_101577468 Ga0070665_1015774682 123
99 3300005563 Ga0068855_100025194 Ga0068855_1000251945 123
100 3300005563 Ga0068855_100111856 Ga0068855_1001118562 123
101 3300005563 Ga0068855_100696505 Ga0068855_1006965052 123
102 3300005563 Ga0068855_101806067 Ga0068855_1018060671 123
103 3300005563 Ga0068855_102188306 Ga0068855_1021883062 123
104 3300005564 Ga0070664_100157563 Ga0070664_1001575632 123
105 3300005577 Ga0068857_100005550 Ga0068857_1000055507 123
106 3300005578 Ga0068854_100018528 Ga0068854_1000185283 123
107 3300005578 Ga0068854_100051259 Ga0068854_1000512594 123
108 3300005614 Ga0068856_100013166 Ga0068856_1000131665 123
109 3300005614 Ga0068856_100256924 Ga0068856_1002569242 123
110 3300005614 Ga0068856_100367302 Ga0068856_1003673022 123
111 3300005614 Ga0068856_102232657 Ga0068856_1022326571 123
112 3300005616 Ga0068852_100053541 Ga0068852_1000535414 123
113 3300005616 Ga0068852_100081170 Ga0068852_1000811703 123
114 3300005616 Ga0068852_100101397 Ga0068852_1001013974 123
115 3300005616 Ga0068852_100210532 Ga0068852_1002105322 123
116 3300005616 Ga0068852_100456611 Ga0068852_1004566112 123
117 3300005834 Ga0068851_10479681 Ga0068851_104796812 123
118 3300005842 Ga0068858_100008493 Ga0068858_1000084933 123
119 3300005843 Ga0068860_100927761 Ga0068860_1009277612 123
120 3300005983 Ga0081540_1002200 Ga0081540_100220019 123
121 3300006844 Ga0075428_100022647 Ga0075428_1000226479 123
122 3300006852 Ga0075433_10131881 Ga0075433_101318813 123
123 3300006914 Ga0075436_100021021 Ga0075436_1000210211 123
124 3300009093 Ga0105240_10004317 Ga0105240_1000431719 123
125 3300009093 Ga0105240_10020072 Ga0105240_100200723 123
126 3300009093 Ga0105240_10064329 Ga0105240_100643296 123
127 3300009093 Ga0105240_10073829 Ga0105240_100738293 123
128 3300009093 Ga0105240_10076267 Ga0105240_100762673 123
129 3300009093 Ga0105240_10157366 Ga0105240_101573662 123
130 3300009093 Ga0105240_10330596 Ga0105240_103305962 123
131 3300009093 Ga0105240_10782685 Ga0105240_107826852 123
132 3300009174 Ga0105241_10047631 Ga0105241_100476312 123
133 3300009174 Ga0105241_10221007 Ga0105241_102210072 123
134 3300009174 Ga0105241_11580875 Ga0105241_115808751 123
135 3300009174 Ga0105241_12676714 Ga0105241_126767142 123
136 3300009177 Ga0105248_10000005 Ga0105248_10000005579 123
137 3300009177 Ga0105248_10575043 Ga0105248_105750432 123
138 3300009177 Ga0105248_12148750 Ga0105248_121487502 123
139 3300009545 Ga0105237_10294619 Ga0105237_102946192 123
140 3300009545 Ga0105237_10491106 Ga0105237_104911062 123
141 3300009551 Ga0105238_10023221 Ga0105238_100232214 123
142 3300009551 Ga0105238_10310199 Ga0105238_103101992 123
143 3300010375 Ga0105239_10036584 Ga0105239_100365843 123
144 3300010375 Ga0105239_10109369 Ga0105239_101093692 123
145 3300010375 Ga0105239_10127180 Ga0105239_101271803 123
146 3300010375 Ga0105239_10153678 Ga0105239_101536783 123
147 3300010375 Ga0105239_10187100 Ga0105239_101871002 123
148 3300010375 Ga0105239_11556111 Ga0105239_115561112 123
149 3300013100 Ga0157373_10249629 Ga0157373_102496292 123
150 3300013102 Ga0157371_10546530 Ga0157371_105465302 123
151 3300013102 Ga0157371_10904707 Ga0157371_109047072 123
152 3300013104 Ga0157370_10716427 Ga0157370_107164272 123
153 3300013104 Ga0157370_11654020 Ga0157370_116540201 123
154 3300013105 Ga0157369_10020412 Ga0157369_100204123 123
155 3300013105 Ga0157369_10093655 Ga0157369_100936552 123
156 3300013105 Ga0157369_10246958 Ga0157369_102469583 123
157 3300013105 Ga0157369_10436875 Ga0157369_104368752 123
158 3300013105 Ga0157369_11265105 Ga0157369_112651052 123
159 3300013296 Ga0157374_10272893 Ga0157374_102728932 123
160 3300013307 Ga0157372_10051447 Ga0157372_100514474 123
161 3300013307 Ga0157372_10285030 Ga0157372_102850302 123
162 3300013307 Ga0157372_10458335 Ga0157372_104583352 123
163 3300013308 Ga0157375_13171311 Ga0157375_131713112 123
164 3300014325 Ga0163163_10087620 Ga0163163_100876202 123
165 3300014968 Ga0157379_10004979 Ga0157379_100049799 123
166 3300014969 Ga0157376_10608443 Ga0157376_106084432 123
167 3300021361 Ga0213872_10321654 Ga0213872_103216541 123
168 3300021377 Ga0213874_10019750 Ga0213874_100197502 123
169 3300021377 Ga0213874_10231645 Ga0213874_102316452 123
170 3300021384 Ga0213876_10000785 Ga0213876_100007857 123
171 3300021384 Ga0213876_10541657 Ga0213876_105416572 123
172 3300021388 Ga0213875_10001207 Ga0213875_100012075 123
173 3300021388 Ga0213875_10006216 Ga0213875_100062166 123
174 3300021388 Ga0213875_10008758 Ga0213875_100087583 123
175 3300021441 Ga0213871_10029332 Ga0213871_100293322 123
176 3300025906 Ga0207699_10137951 Ga0207699_101379511 123
177 3300025909 Ga0207705_10000101 Ga0207705_1000010179 123
178 3300025909 Ga0207705_10160541 Ga0207705_101605412 123
179 3300025911 Ga0207654_10040633 Ga0207654_100406332 123
180 3300025911 Ga0207654_10231412 Ga0207654_102314121 123
181 3300025911 Ga0207654_10306674 Ga0207654_103066742 123
182 3300025911 Ga0207654_10400419 Ga0207654_104004192 123
183 3300025911 Ga0207654_10727050 Ga0207654_107270502 123
184 3300025911 Ga0207654_11068170 Ga0207654_110681702 123
185 3300025912 Ga0207707_10000001 Ga0207707_10000001130 123
186 3300025913 Ga0207695_10002104 Ga0207695_100021042 123
187 3300025913 Ga0207695_10014491 Ga0207695_100144912 123
188 3300025913 Ga0207695_10025998 Ga0207695_100259984 123
189 3300025913 Ga0207695_10080400 Ga0207695_100804003 123
190 3300025913 Ga0207695_10089071 Ga0207695_100890712 123
191 3300025913 Ga0207695_10434736 Ga0207695_104347362 123
192 3300025913 Ga0207695_10440345 Ga0207695_104403451 123
193 3300025914 Ga0207671_10398262 Ga0207671_103982622 123
194 3300025914 Ga0207671_11268291 Ga0207671_112682911 123
195 3300025915 Ga0207693_10114415 Ga0207693_101144152 123
196 3300025917 Ga0207660_10000280 Ga0207660_1000028030 123
197 3300025917 Ga0207660_10071727 Ga0207660_100717273 123
198 3300025919 Ga0207657_10049230 Ga0207657_100492302 123
199 3300025920 Ga0207649_10202373 Ga0207649_102023732 123
200 3300025920 Ga0207649_10915745 Ga0207649_109157452 123
201 3300025921 Ga0207652_10000722 Ga0207652_1000072217 123
202 3300025921 Ga0207652_10154548 Ga0207652_101545483 123
203 3300025924 Ga0207694_10005311 Ga0207694_100053112 123
204 3300025924 Ga0207694_10035915 Ga0207694_100359153 123
205 3300025929 Ga0207664_10003018 Ga0207664_100030183 123
206 3300025929 Ga0207664_10528177 Ga0207664_105281772 123
207 3300025932 Ga0207690_10005032 Ga0207690_100050327 123
208 3300025941 Ga0207711_10000002 Ga0207711_10000002577 123
209 3300025941 Ga0207711_10477233 Ga0207711_104772332 123
210 3300025945 Ga0207679_10149173 Ga0207679_101491732 123
211 3300025949 Ga0207667_10008750 Ga0207667_1000875012 123
212 3300025949 Ga0207667_10049835 Ga0207667_100498353 123
213 3300025949 Ga0207667_10205452 Ga0207667_102054522 123
214 3300025981 Ga0207640_10005210 Ga0207640_100052102 123
215 3300025981 Ga0207640_10007820 Ga0207640_100078206 123
216 3300025981 Ga0207640_11658151 Ga0207640_116581512 123
217 3300026035 Ga0207703_10006047 Ga0207703_1000604710 123
218 3300026041 Ga0207639_10299644 Ga0207639_102996442 123
219 3300026041 Ga0207639_11790332 Ga0207639_117903322 123
220 3300026041 Ga0207639_12231634 Ga0207639_122316341 123
221 3300026067 Ga0207678_10059344 Ga0207678_100593442 123
222 3300026078 Ga0207702_10008840 Ga0207702_100088402 123
223 3300026078 Ga0207702_10081309 Ga0207702_100813094 123
224 3300026078 Ga0207702_10105336 Ga0207702_101053362 123
225 3300026078 Ga0207702_10304215 Ga0207702_103042152 123
226 3300026078 Ga0207702_10475651 Ga0207702_104756512 123
227 3300026116 Ga0207674_10000261 Ga0207674_1000026112 123
228 3300026116 Ga0207674_10045284 Ga0207674_100452842 123
229 3300026116 Ga0207674_10125854 Ga0207674_101258543 123
230 3300026142 Ga0207698_10030262 Ga0207698_100302622 123
231 3300026142 Ga0207698_10050690 Ga0207698_100506903 123
232 3300026142 Ga0207698_10216380 Ga0207698_102163802 123
233 3300026142 Ga0207698_10241903 Ga0207698_102419032 123
234 3300028379 Ga0268266_10007047 Ga0268266_100070473 123
235 3300028379 Ga0268266_10184279 Ga0268266_101842792 123
236 3300028379 Ga0268266_10364888 Ga0268266_103648882 123
237 3300028381 Ga0268264_10772504 Ga0268264_107725041 123
238 3300028800 Ga0265338_10010999 Ga0265338_100109992 123
239 3300028800 Ga0265338_10051209 Ga0265338_100512093 123
240 3300031235 Ga0265330_10067416 Ga0265330_100674162 123
241 3300031240 Ga0265320_10001113 Ga0265320_1000111318 123
242 3300031241 Ga0265325_10000642 Ga0265325_1000064216 123
243 3300031241 Ga0265325_10020513 Ga0265325_100205133 123
244 3300031241 Ga0265325_10061112 Ga0265325_100611122 123
245 3300031247 Ga0265340_10006802 Ga0265340_100068023 123
246 3300031247 Ga0265340_10229775 Ga0265340_102297752 123
247 3300031249 Ga0265339_10002646 Ga0265339_1000264611 123
248 3300031249 Ga0265339_10160369 Ga0265339_101603692 123
249 3300031250 Ga0265331_10248664 Ga0265331_102486642 123
250 3300031344 Ga0265316_10013102 Ga0265316_100131022 123
251 3300031344 Ga0265316_10624474 Ga0265316_106244742 123
252 3300031595 Ga0265313_10002994 Ga0265313_1000299411 123
253 3300031595 Ga0265313_10332176 Ga0265313_103321762 123
254 3300031711 Ga0265314_10238585 Ga0265314_102385851 123
255 3300031711 Ga0265314_10441495 Ga0265314_104414951 123
256 3300031712 Ga0265342_10043060 Ga0265342_100430603 123
257 3300031901 Ga0307406_10248388 Ga0307406_102483882 123
258 3300031911 Ga0307412_10136408 Ga0307412_101364081 123
259 3300032002 Ga0307416_101247978 Ga0307416_1012479782 123
260 3300032002 Ga0307416_101353220 Ga0307416_1013532202 123
261 3300033545 Ga0316214_1032752 Ga0316214_10327521 123
262 3300034957 Ga0373938_0134316 Ga0373938_0134316_226_600 123
263 3300035113 Ga0373936_0131356 Ga0373936_0131356_465_839 123
264 3300035724 Ga0373933_0896842 Ga0373933_0896842_195_569 123
265 3300036401 Ga0373937_1207615 Ga0373937_1207615_286_660 123
266 3300037312 Ga0395899_0023889 Ga0395899_0023889_678_1052 123
267 3300037312 Ga0395899_0089045 Ga0395899_0089045_223_594 123
268 3300037418 Ga0395900_0212632 Ga0395900_0212632_348_719 123
269 3300037418 Ga0395900_0221805 Ga0395900_0221805_1429_1800 123
270 3300037418 Ga0395900_0282494 Ga0395900_0282494_171_545 123
271 3300037418 Ga0395900_0512794 Ga0395900_0512794_35_412 123
272 3300037418 Ga0395900_1061285 Ga0395900_1061285_234_605 123
273 3300037466 Ga0395898_0018663 Ga0395898_0018663_609_980 123
274 3300037466 Ga0395898_0038545 Ga0395898_0038545_1872_2243 123
275 3300037471 Ga0395905_0403834 Ga0395905_0403834_606_977 123
276 3300037853 Ga0436364_0129083 Ga0436364_0129083_50378_50767 123
277 3300037853 Ga0436364_0164468 Ga0436364_0164468_780_1166 123
278 3300037853 Ga0436364_0683699 Ga0436364_0683699_2927_3316 123
279 3300037853 Ga0436364_1373059 Ga0436364_1373059_4771_5160 123
280 3300038443 Ga0395901_0013250 Ga0395901_0013250_1591_1965 123
281 3300038725 Ga0400484_29468 Ga0400484_29468_1533_1928 123
282 3300038726 Ga0400490_37512 Ga0400490_37512_1673_2068 123
283 3300039437 Ga0436365_0066450 Ga0436365_0066450_6208_6582 123
284 3300039437 Ga0436365_0687864 Ga0436365_0687864_7963_8337 123
285 3300039438 Ga0436360_0659255 Ga0436360_0659255_548_934 123
286 3300039438 Ga0436360_1053302 Ga0436360_1053302_172_555 123
287 3300039438 Ga0436360_1344316 Ga0436360_1344316_208_642 123
288 3300039447 Ga0436361_0067874 Ga0436361_0067874_12_398 123
289 3300039447 Ga0436361_0624807 Ga0436361_0624807_256_642 123
290 3300039450 Ga0436363_0044671 Ga0436363_0044671_773_1159 123
291 3300039450 Ga0436363_0158779 Ga0436363_0158779_2820_3194 123
292 3300039450 Ga0436363_0688063 Ga0436363_0688063_234_617 123
293 3300039450 Ga0436363_1151863 Ga0436363_1151863_103_492 123
294 3300039450 Ga0436363_1665051 Ga0436363_1665051_163_546 123
295 3300039453 Ga0436362_0124114 Ga0436362_0124114_29_412 123
296 3300039453 Ga0436362_0205617 Ga0436362_0205617_622_1011 123
297 3300039453 Ga0436362_0790521 Ga0436362_0790521_674_1060 123
298 3300039453 Ga0436362_1085551 Ga0436362_1085551_81_467 123
299 3300044693 Ga0466961_0628678 Ga0466961_0628678_168_542 123
300 3300044694 Ga0466963_0064196 Ga0466963_0064196_1162_1533 123
301 3300044735 Ga0466968_0033865 Ga0466968_0033865_1627_2010 123
302 3300044842 Ga0466957_0747627 Ga0466957_0747627_121_504 123
303 3300044842 Ga0466957_1051086 Ga0466957_1051086_200_571 123
304 3300046454 Ga0495592_0733778 Ga0495592_0733778_62_436 123
305 3300046472 Ga0495580_0120654 Ga0495580_0120654_970_1344 123
306 3300046529 Ga0495652_0273632 Ga0495652_0273632_312_686 123
307 3300046536 Ga0495587_0091088 Ga0495587_0091088_604_978 123
308 3300046543 Ga0495645_0563381 Ga0495645_0563381_77_451 123
309 3300046678 Ga0495599_0340288 Ga0495599_0340288_105_479 123
310 3300048919 Ga0496116_0282017 Ga0496116_0282017_237_722 123
311 3300048929 Ga0496126_0001865 Ga0496126_0001865_13001_13375 123
312 3300049515 Ga0501292_065672 Ga0501292_065672_134_523 123
313 3300049569 Ga0501032_0045589 Ga0501032_0045589_218_592 123
314 3300049570 Ga0501033_0105447 Ga0501033_0105447_1430_1804 123
315 3300049570 Ga0501033_0834869 Ga0501033_0834869_20_394 123
316 3300049571 Ga0501034_0201204 Ga0501034_0201204_142_516 123
317 3300049571 Ga0501034_1001848 Ga0501034_1001848_96_470 123
318 3300049572 Ga0501036_0048300 Ga0501036_0048300_2246_2620 123
319 3300049573 Ga0501037_0176378 Ga0501037_0176378_416_790 123
320 3300049574 Ga0501038_0065473 Ga0501038_0065473_34_408 123
321 3300049574 Ga0501038_1094406 Ga0501038_1094406_141_515 123
322 3300049575 Ga0501039_0426816 Ga0501039_0426816_108_503 123
323 3300049576 Ga0501040_0569834 Ga0501040_0569834_234_629 123
324 3300049579 Ga0501043_0104860 Ga0501043_0104860_1284_1658 123
325 3300049579 Ga0501043_0122813 Ga0501043_0122813_161_535 123
326 3300049580 Ga0501046_0014613 Ga0501046_0014613_2195_2590 123
327 3300049581 Ga0501047_0003368 Ga0501047_0003368_4611_4985 123
328 3300049581 Ga0501047_0036090 Ga0501047_0036090_4000_4374 123
329 3300049581 Ga0501047_0390064 Ga0501047_0390064_837_1211 123
330 3300049581 Ga0501047_0660729 Ga0501047_0660729_423_797 123
331 3300049582 Ga0501048_0139196 Ga0501048_0139196_41_436 123
332 3300049583 Ga0501067_0006765 Ga0501067_0006765_3741_4115 123
333 3300049585 Ga0501069_0009909 Ga0501069_0009909_271_645 123
334 3300049586 Ga0501070_0003697 Ga0501070_0003697_6349_6723 123
335 3300049589 Ga0501073_0005587 Ga0501073_0005587_3857_4231 123
336 3300049590 Ga0501074_0291336 Ga0501074_0291336_552_947 123
337 3300049593 Ga0501077_0350757 Ga0501077_0350757_548_925 123
338 3300049679 Ga0501249_042534 Ga0501249_042534_25_414 123
339 3300049742 Ga0501080_0006778 Ga0501080_0006778_1132_1506 123
340 3300049742 Ga0501080_0255091 Ga0501080_0255091_194_568 123
341 3300049822 Ga0501035_0003918 Ga0501035_0003918_4131_4505 123
342 3300049822 Ga0501035_0177381 Ga0501035_0177381_1324_1698 123
343 3300049822 Ga0501035_0562315 Ga0501035_0562315_341_715 123
344 3300049823 Ga0501044_0011957 Ga0501044_0011957_5176_5550 123
345 3300049823 Ga0501044_0020413 Ga0501044_0020413_5938_6312 123
346 3300049823 Ga0501044_0221860 Ga0501044_0221860_10_384 123
347 3300049824 Ga0501045_0131932 Ga0501045_0131932_68_463 123
348 3300050514 nmdc:mga08x19_214308_c1 nmdc:mga08x19_214308_c1_126_527 123
349 3300050515 nmdc:mga0a205_539014_c1 nmdc:mga0a205_539014_c1_294_695 123
350 3300053119 Ga0500595_066270 Ga0500595_066270_478_852 123
351 3300053154 Ga0500619_029130 Ga0500619_029130_261_635 123
352 3300054114 Ga0501084_0021074 Ga0501084_0021074_2975_3349 123
353 3300060353 Ga0501082_0032928 Ga0501082_0032928_2730_3104 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

24

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9923 2 121
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9786 1 122
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9703 2 122
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9631 1 122
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9626 2 122
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9894 3 119 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.979 1 122 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9768 2 120 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9764 2 120 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9736 1 123 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A0Q6L2U3-F1-model_v4 Glycine cleavage system H protein 0.9975 3 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A0N0KIH5-F1-model_v4 Glycine cleavage system H protein 0.9962 1 118 GO:0005829
GO:0005960
GO:0019464
AF-A0A853FS71-F1-model_v4 Glycine cleavage system H protein 0.9959 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A432VJA8-F1-model_v4 Glycine cleavage system H protein 0.9955 1 123 GO:0005737
GO:0005960
GO:0019464
AF-A0A7C9KXR7-F1-model_v4 Glycine cleavage system H protein 0.9951 1 123 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map