F419335

General Info

Members Datasets Scaffolds Average Seq Length
353 286 706 202

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100005467|Ga0068862_10000546710
Length 235
Sequence MSVPGAPGLPRAALPCYLRGPHKPCDTAMKVGPFNLRRLTRAQLPHDTVALARFLLGKVVVRAVDDGWLAGRIVETEAYIQGDAACHAFNGLTPRNRSLFLKHGHAYVYLAYGTAWMLNVSSEAEGVGSGVLIRALEPMVGMDAMVRNRGTDKPRDLLRGPGRIAQALRIDRALDGLDLTRDKRLWLGLEAATGSTSPAKIGVSTRIGLTKDAHRPLRFFLKGNRYVSGPAALNR

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
146 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
147 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
151 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
158 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
162 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
163 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
164 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
165 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
166 2512875024
167 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
168 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
169 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
170 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
171 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
172 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
173 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
174 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
175 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
176 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
177 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
178 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
179 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
180 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
181 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
182 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
183 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
184 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
185 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
186 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
187 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
188 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
189 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
190 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
191 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
192 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
193 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
194 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
195 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
196 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
197 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
198 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
199 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
200 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
201 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
202 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
203 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
204 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
205 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
206 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
207 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
208 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
209 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
210 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
211 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
212 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
213 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
214 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
215 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
216 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
217 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
218 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
219 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
220 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
221 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
222 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
223 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
224 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
225 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
226 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
227 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
228 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
229 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
230 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
231 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
232 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
233 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
234 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
235 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
236 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
237 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
238 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
239 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
240 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
241 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
242 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
243 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
244 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
245 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
246 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
247 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
248 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
249 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
250 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
251 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
252 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
253 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
254 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
255 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
256 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
257 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
258 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
259 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
260 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
261 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
262 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
263 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
264 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
265 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
266 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
267 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
268 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
269 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
270 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
271 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
272 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
273 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
274 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
275 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
276 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
277 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
278 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
279 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
280 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
281 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
282 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
283 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
284 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
285 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
286 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.02
Metatranscriptomes 0
Isolates 35.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.45
Nodule 32.29
Rhizoplane 3.12
Rhizosphere 42.78
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100005467 3300005844 Bacteria 10619
2 JGI25153J46596_10000019 3300003215 Bacteria 260291
3 Ga0055542_1001090 3300003762 Bacteria 16498
4 Ga0055529_1003576 3300003763 Bacteria 2542
5 Ga0055531_10009724 3300003794 Bacteria 4882
6 Ga0070658_10386629 3300005327 Bacteria 1201
7 Ga0070676_10097356 3300005328 Bacteria 1812
8 Ga0068868_101108966 3300005338 Bacteria 728
9 Ga0070660_100458780 3300005339 Bacteria 1058
10 Ga0070668_100180318 3300005347 Bacteria 1725
11 Ga0070675_100442156 3300005354 Bacteria 1165
12 Ga0070711_100417218 3300005439 Bacteria 1093
13 Ga0070678_100072779 3300005456 Bacteria 2578
14 Ga0070681_10348917 3300005458 Bacteria 1390
15 Ga0068867_100084434 3300005459 Bacteria 2399
16 Ga0070672_100631009 3300005543 Bacteria 935
17 Ga0070693_100265649 3300005547 Bacteria 1143
18 Ga0070665_100298468 3300005548 Bacteria 1614
19 Ga0070665_100442100 3300005548 Bacteria 1310
20 Ga0068855_100008020 3300005563 Bacteria 12754
21 Ga0068855_100094773 3300005563 Bacteria 3441
22 Ga0068856_100455027 3300005614 Bacteria 1301
23 Ga0068856_100745082 3300005614 Bacteria 1000
24 Ga0070717_10666251 3300006028 Bacteria 945
25 Ga0075365_10019462 3300006038 Bacteria 4191
26 Ga0075364_10008406 3300006051 Bacteria 6169
27 Ga0075364_10075536 3300006051 Bacteria 2223
28 Ga0075367_10177034 3300006178 Bacteria 1329
29 Ga0097621_100006620 3300006237 Bacteria 8231
30 Ga0075370_10030365 3300006353 Bacteria 3015
31 Ga0075370_10477473 3300006353 Bacteria 751
32 Ga0068871_100000287 3300006358 Bacteria 35135
33 Ga0068865_100007265 3300006881 Bacteria 6806
34 Ga0105240_10005826 3300009093 Bacteria 18275
35 Ga0105240_10017650 3300009093 Bacteria 9609
36 Ga0105240_10484487 3300009093 Bacteria 1378
37 Ga0105243_10153226 3300009148 Bacteria 1979
38 Ga0105241_10106767 3300009174 Bacteria 2235
39 Ga0105242_10014984 3300009176 Bacteria 6011
40 Ga0105248_10500121 3300009177 Bacteria 1370
41 Ga0105237_10154904 3300009545 Bacteria 2288
42 Ga0105238_10077686 3300009551 Bacteria 3310
43 Ga0105238_10201577 3300009551 Bacteria 1965
44 Ga0105238_10630831 3300009551 Bacteria 1081
45 Ga0105239_10163814 3300010375 Bacteria 2486
46 Ga0105239_10377146 3300010375 Bacteria 1603
47 Ga0105239_11587017 3300010375 Bacteria 757
48 Ga0157370_10636503 3300013104 Bacteria 975
49 Ga0157369_10263171 3300013105 Bacteria 1798
50 Ga0157374_10184147 3300013296 Bacteria 2041
51 Ga0157374_10690688 3300013296 Bacteria 1033
52 Ga0157374_10981497 3300013296 Bacteria 864
53 Ga0157378_10109169 3300013297 Bacteria 2534
54 Ga0157378_10185742 3300013297 Bacteria 1958
55 Ga0157378_10189692 3300013297 Bacteria 1938
56 Ga0157378_10669678 3300013297 Unclassified 1055
57 Ga0163162_10097738 3300013306 Bacteria 3024
58 Ga0163162_11148087 3300013306 Bacteria 881
59 Ga0157375_10089267 3300013308 Bacteria 3138
60 Ga0157375_11350221 3300013308 Bacteria 839
61 Ga0163163_10085274 3300014325 Bacteria 3166
62 Ga0157376_10113255 3300014969 Bacteria 2391
63 Ga0163161_10023826 3300017792 Bacteria 4320
64 Ga0213876_10085329 3300021384 Bacteria 1671
65 Ga0213875_10019919 3300021388 Bacteria 3222
66 Ga0209148_1000212 3300025254 Bacteria 101454
67 Ga0209233_1001226 3300025261 Bacteria 10320
68 Ga0209455_1000346 3300025272 Bacteria 43799
69 Ga0209758_1000028 3300025297 Bacteria 530102
70 Ga0209050_1025463 3300025298 Bacteria 2009
71 Ga0209257_1000688 3300025304 Bacteria 52564
72 Ga0207645_10067172 3300025907 Bacteria 2292
73 Ga0207705_10174924 3300025909 Bacteria 1618
74 Ga0207705_10409710 3300025909 Bacteria 1049
75 Ga0207654_10080308 3300025911 Bacteria 1961
76 Ga0207695_10026936 3300025913 Bacteria 6407
77 Ga0207695_10308566 3300025913 Bacteria 1472
78 Ga0207657_10103453 3300025919 Bacteria 2360
79 Ga0207657_10206785 3300025919 Bacteria 1577
80 Ga0207694_10020268 3300025924 Bacteria 5028
81 Ga0207694_10189871 3300025924 Bacteria 1668
82 Ga0207686_10028275 3300025934 Bacteria 3294
83 Ga0207709_10188013 3300025935 Bacteria 1464
84 Ga0207709_10526616 3300025935 Bacteria 926
85 Ga0207691_10362046 3300025940 Bacteria 1240
86 Ga0207667_10000429 3300025949 Bacteria 56506
87 Ga0207667_10055411 3300025949 Bacteria 4168
88 Ga0207639_10031643 3300026041 Bacteria 3889
89 Ga0207639_10279724 3300026041 Bacteria 1467
90 Ga0207702_10101401 3300026078 Bacteria 2542
91 Ga0207702_10778523 3300026078 Bacteria 945
92 Ga0207702_10781854 3300026078 Bacteria 943
93 Ga0207648_10118464 3300026089 Bacteria 2327
94 Ga0207674_10283959 3300026116 Bacteria 1603
95 Ga0207674_10942261 3300026116 Bacteria 832
96 Ga0207698_10414054 3300026142 Bacteria 1291
97 Ga0268266_10315760 3300028379 Bacteria 1461
98 Ga0268265_10056785 3300028380 Bacteria 2980
99 Ga0307515_10170863 3300028794 Bacteria 2168
100 Ga0265338_10014619 3300028800 Bacteria 8711
101 Ga0265325_10066370 3300031241 Bacteria 1819
102 Ga0265331_10150046 3300031250 Bacteria 1059
103 Ga0265327_10024126 3300031251 Bacteria 3582
104 Ga0307508_10029723 3300031616 Bacteria 4939
105 Ga0265314_10204370 3300031711 Bacteria 1165
106 Ga0307412_10133138 3300031911 Bacteria 1809
107 Ga0373943_0220242 3300035170 Bacteria 1057
108 Ga0373924_0108896 3300035410 Bacteria 1196
109 Ga0373927_0021420 3300035695 Bacteria 4237
110 Ga0373937_0254090 3300036401 Bacteria 1657
111 Ga0373925_0168922 3300037068 Bacteria 1726
112 Ga0436364_0258581 3300037853 Bacteria 2196
113 Ga0436364_0360454 3300037853 Bacteria 27225
114 Ga0436365_0417623 3300039437 Bacteria 2206
115 Ga0436365_0527818 3300039437 Bacteria 2273
116 Ga0436360_0490156 3300039438 Bacteria 1831
117 Ga0436360_1132164 3300039438 Bacteria 1087
118 Ga0436361_0236301 3300039447 Bacteria 1986
119 Ga0436361_0388201 3300039447 Bacteria 2842
120 Ga0495638_0075586 3300046460 Bacteria 2053
121 Ga0495638_0260446 3300046460 Bacteria 951
122 Ga0495608_0174323 3300046511 Bacteria 1363
123 Ga0495643_0096556 3300046522 Bacteria 1519
124 Ga0495665_0399531 3300046531 Bacteria 697
125 Ga0495625_0008106 3300046660 Bacteria 9004
126 Ga0495658_0000646 3300046683 Bacteria 18837
127 Ga0495613_0289025 3300046689 Bacteria 1137
128 Ga0495670_0215135 3300046691 Bacteria 1020
129 Ga0495581_0074955 3300047315 Bacteria 1958
130 Ga0495687_090339 3300047443 Bacteria 1174
131 Ga0495675_0472479 3300047444 Bacteria 723
132 Ga0495684_0085808 3300047471 Bacteria 2387
133 Ga0495686_0052847 3300047472 Bacteria 2546
134 Ga0495686_0065896 3300047472 Bacteria 2239
135 Ga0496102_0145974 3300048905 Bacteria 2221
136 Ga0496104_0009149 3300048907 Bacteria 8807
137 Ga0496105_0060235 3300048908 Bacteria 3132
138 Ga0496105_0687028 3300048908 Bacteria 787
139 Ga0496109_0676772 3300048912 Bacteria 969
140 Ga0496110_1133324 3300048913 Bacteria 691
141 Ga0496111_0120007 3300048914 Bacteria 1942
142 Ga0496112_0189687 3300048915 Bacteria 2018
143 Ga0496114_0549067 3300048917 Bacteria 1021
144 Ga0496115_0609134 3300048918 Bacteria 867
145 Ga0496115_0825887 3300048918 Bacteria 720
146 Ga0496118_0160136 3300048921 Bacteria 1393
147 Ga0496119_0000247 3300048922 Bacteria 76340
148 Ga0496119_0134883 3300048922 Bacteria 1340
149 Ga0496120_0009305 3300048923 Bacteria 6987
150 Ga0496121_0101217 3300048924 Bacteria 2223
151 Ga0501032_0365403 3300049569 Bacteria 929
152 Ga0501034_0269009 3300049571 Bacteria 1646
153 Ga0501036_0418454 3300049572 Unclassified 1117
154 Ga0501037_0108119 3300049573 Bacteria 2004
155 Ga0501038_0128971 3300049574 Bacteria 2079
156 Ga0501038_0132345 3300049574 Bacteria 2046
157 Ga0501043_0165446 3300049579 Bacteria 1727
158 Ga0501047_0006986 3300049581 Bacteria 10600
159 Ga0501047_0012272 3300049581 Bacteria 8108
160 Ga0501047_0218771 3300049581 Bacteria 1761
161 Ga0501047_0270965 3300049581 Bacteria 1544
162 Ga0501047_0521015 3300049581 Bacteria 1015
163 Ga0501067_0097395 3300049583 Bacteria 1634
164 Ga0501067_0151493 3300049583 Bacteria 1292
165 Ga0501068_0012242 3300049584 Bacteria 4853
166 Ga0501068_0151130 3300049584 Bacteria 1459
167 Ga0501069_0089833 3300049585 Bacteria 1737
168 Ga0501070_0153594 3300049586 Bacteria 1899
169 Ga0501070_0156179 3300049586 Bacteria 1881
170 Ga0501072_0157052 3300049588 Bacteria 1814
171 Ga0501073_0049137 3300049589 Bacteria 2958
172 Ga0501073_0050747 3300049589 Bacteria 2906
173 Ga0501073_0081024 3300049589 Bacteria 2257
174 Ga0501080_0096376 3300049742 Bacteria 2746
175 Ga0501080_0134156 3300049742 Bacteria 2292
176 Ga0501080_0191505 3300049742 Bacteria 1879
177 Ga0501080_0320377 3300049742 Bacteria 1404
178 Ga0501083_0014473 3300049744 Bacteria 5516
179 Ga0501083_0033110 3300049744 Bacteria 3540
180 Ga0501035_0517749 3300049822 Bacteria 980
181 Ga0501035_0621448 3300049822 Unclassified 878
182 Ga0501044_0002303 3300049823 Bacteria 21760
183 Ga0501044_0097977 3300049823 Bacteria 2952
184 Ga0501044_0131283 3300049823 Bacteria 2499
185 Ga0501044_0146292 3300049823 Bacteria 2348
186 Ga0501044_0175462 3300049823 Bacteria 2112
187 Ga0501044_0215605 3300049823 Bacteria 1872
188 nmdc:mga03n38_15115_c1 3300050490 Bacteria 2974
189 nmdc:mga00v17_72278_c1 3300050491 Bacteria 2140
190 nmdc:mga0yw44_52903_c1 3300050492 Bacteria 2464
191 nmdc:mga06z11_106905_c1 3300050494 Bacteria 1543
192 nmdc:mga06z11_198957_c1 3300050494 Bacteria 1163
193 nmdc:mga07m45_232912_c1 3300050496 Bacteria 1072
194 nmdc:mga0sz30_131470_c1 3300050516 Bacteria 1103
195 Ga0495619_0649419 3300053085 Bacteria 720
196 Ga0500578_0033481 3300053086 Bacteria 3302
197 Ga0500644_0042289 3300053088 Bacteria 1518
198 Ga0500583_0114626 3300053092 Bacteria 1330
199 Ga0500651_0235994 3300053093 Bacteria 1068
200 Ga0500566_0028584 3300053094 Bacteria 3258
201 Ga0500650_0089904 3300053098 Bacteria 1437
202 Ga0500650_0100504 3300053098 Bacteria 1353
203 Ga0500562_023446 3300053108 Bacteria 1611
204 Ga0500595_000277 3300053119 Bacteria 33985
205 Ga0500595_024632 3300053119 Bacteria 2098
206 Ga0500597_205650 3300053120 Bacteria 825
207 Ga0500642_0001772 3300053130 Bacteria 6224
208 Ga0500658_0176295 3300053134 Bacteria 972
209 Ga0500568_0015475 3300053139 Bacteria 3414
210 Ga0500577_0007388 3300053142 Bacteria 3079
211 Ga0500577_0018251 3300053142 Bacteria 2252
212 Ga0500585_006866 3300053144 Bacteria 3059
213 Ga0500588_0002462 3300053146 Bacteria 3769
214 Ga0500603_050110 3300053150 Bacteria 1140
215 Ga0500604_0001133 3300053151 Bacteria 7397
216 Ga0500604_0008301 3300053151 Bacteria 2753
217 Ga0500604_0106445 3300053151 Bacteria 928
218 Ga0500616_0008785 3300053153 Bacteria 6222
219 Ga0500627_0065257 3300053158 Bacteria 1606
220 Ga0500627_0085656 3300053158 Bacteria 1407
221 Ga0500611_011057 3300053727 Bacteria 1481
222 Ga0500611_024924 3300053727 Bacteria 1180
223 Ga0500609_001196 3300053731 Bacteria 3853
224 Ga0501084_0170652 3300054114 Bacteria 1836
225 Ga0501082_0015983 3300060353 Bacteria 6455
226 Ga0501082_0145007 3300060353 Bacteria 2061
227 2503198836 2503198000 Bacteria 6884444
228 2509118748 2508501123 Bacteria 6283661
229 2509368844 2509276018 Bacteria 6910194
230 2510315168 2510065059 Bacteria 6847884
231 2512933772 2512875016 Bacteria 6529530
232 2512961940 2512875024 Bacteria 7195110
233 2514038908 2513237164 Bacteria 7563725
234 2643985893 2643221595 Bacteria 6565519
235 2644154385 2643221627 Bacteria 6761570
236 2756675176 2756170246 Bacteria 7451806
237 2792747322 2791355123 Bacteria 8049106
238 2844003330 2844002411 Bacteria 7168230
239 2844010912 2844009547 Bacteria 6728125
240 2856332417 2856328259 Bacteria 6528202
241 2856340341 2856334872 Bacteria 7037011
242 2857375630 2857367948 Bacteria 6965560
243 2857507860 2857504554 Bacteria 5369913
244 2869172369 2869169390 Bacteria 6659796
245 2869235048 2869234852 Bacteria 6654993
246 2869244647 2869242130 Bacteria 6609239
247 2869249754 2869249662 Bacteria 6868783
248 2869261565 2869256925 Bacteria 6981691
249 2869267870 2869264136 Bacteria 6880765
250 2869277693 2869271264 Bacteria 6908218
251 2869284869 2869278585 Bacteria 7077053
252 2871457146 2871451962 Bacteria 7336357
253 2871462859 2871459585 Bacteria 6866887
254 2871471521 2871466892 Bacteria 6923287
255 2871487039 2871481445 Bacteria 6700002
256 2874112916 2874109183 Bacteria 6517025
257 2874117566 2874116593 Bacteria 6674494
258 2874133868 2874131515 Bacteria 6820270
259 2874166027 2874162495 Bacteria 6174670
260 2874169998 2874168670 Bacteria 8062617
261 2874173358 2874168670 Bacteria 8062617
262 2876363973 2876363079 Bacteria 6544991
263 2876389974 2876386047 Bacteria 6698674
264 2876404472 2876399893 Bacteria 6927900
265 2876410239 2876406927 Bacteria 6191900
266 2876424694 2876420981 Bacteria 6687741
267 2878737026 2878730984 Bacteria 6380721
268 2878741122 2878738818 Bacteria 7136951
269 2878776474 2878774303 Bacteria 6108671
270 2878786280 2878781027 Bacteria 6834456
271 2903453927 2903448605 Bacteria 7357801
272 2903519755 2903513507 Bacteria 6344008
273 2903525868 2903521522 Bacteria 6525694
274 2903532586 2903528002 Bacteria 6586099
275 2906369255 2906363423 Bacteria 6856682
276 2906371243 2906370794 Bacteria 6881062
277 2906384870 2906378014 Bacteria 6911440
278 2906389878 2906386501 Bacteria 5977019
279 2906395211 2906393657 Bacteria 6790866
280 2906402216 2906401398 Bacteria 6693206
281 2906410484 2906408224 Bacteria 6162342
282 2906433090 2906427513 Bacteria 6375796
283 2922154145 2922151315 Bacteria 6902399
284 2922175582 2922172374 Bacteria 6167644
285 2922181066 2922178524 Bacteria 6025201
286 2924711966 2924710171 Bacteria 6752351
287 2924738514 2924733363 Bacteria 7574837
288 2924742638 2924741084 Bacteria 6661321
289 2924752886 2924748358 Bacteria 6154725
290 2924778723 2924776078 Bacteria 7492003
291 2937850181 2937848649 Bacteria 6983481
292 2937864903 2937861824 Bacteria 6660327
293 2937876003 2937868953 Bacteria 6639878
294 2937980714 2937980651 Bacteria 6517427
295 2958038167 2958034702 Bacteria 6989922
296 2958042250 2958041894 Bacteria 13082850
297 2958071030 2958064165 Bacteria 7158582
298 2958085653 2958084443 Bacteria 7312792
299 2958109340 2958108152 Bacteria 6681128
300 2958129948 2958122699 Bacteria 7280457
301 2958141890 2958137437 Bacteria 6050276
302 2958145695 2958144490 Bacteria 6677056
303 2958164108 2958158011 Bacteria 6058449
304 2961141580 2961136820 Bacteria 6775228
305 2961187655 2961183825 Bacteria 6688536
306 2963645431 2963644680 Bacteria 6530403
307 2965029865 2965025482 Bacteria 6532201
308 2965039916 2965032056 Bacteria 6887443
309 2965046171 2965040258 Bacteria 6855979
310 2965054182 2965047637 Bacteria 6623551
311 2965093015 2965089291 Bacteria 6866420
312 2965107608 2965102966 Bacteria 6800987
313 2965117579 2965110997 Bacteria 6693150
314 2968017355 2968016561 Bacteria 7022047
315 2968089653 2968083720 Bacteria 7351627
316 2968146787 2968138860 Bacteria 6605449
317 2970470714 2970469710 Bacteria 6969209
318 2970492862 2970489779 Bacteria 6517260
319 2970510750 2970510686 Bacteria 7006402
320 2970534930 2970532167 Bacteria 6553173
321 2970553165 2970547951 Bacteria 6931819
322 2970599480 2970593180 Bacteria 7073582
323 2970622407 2970619444 Bacteria 6986144
324 2970632083 2970627176 Bacteria 6680862
325 2977854424 2977851361 Bacteria 6694324
326 2977874508 2977872689 Bacteria 7270173
327 2977903619 2977898635 Bacteria 6675551
328 2977910790 2977907340 Bacteria 6577984
329 2977920932 2977915119 Bacteria 6829656
330 2977924652 2977922695 Bacteria 6956781
331 2977938725 2977935797 Bacteria 6252826
332 2977953689 2977950692 Bacteria 6893264
333 2977962176 2977957713 Bacteria 6877875
334 2977986968 2977986579 Bacteria 6581278
335 2979769438 2979764755 Bacteria 6610066
336 2979778784 2979772303 Bacteria 6618277
337 2979799475 2979793036 Bacteria 6808957
338 2987651040 2987645492 Bacteria 6117018
339 2987673914 2987673487 Bacteria 6884027
340 3000137485 3000135777 Bacteria 6891109
341 3004200364 3004195979 Bacteria 6776956
342 3004216869 3004211236 Bacteria 7417683
343 3004225537 3004218560 Bacteria 7421728
344 3004237239 3004232784 Bacteria 6662140
345 3004240614 3004239961 Bacteria 6892290
346 3004255543 3004248173 Bacteria 6563236
347 3004272087 3004268573 Bacteria 7043476
348 637076885 637000159 Bacteria 7596297
349 649870663 649633066 Bacteria 6690028
350 8004303151 8004300914 Bacteria 6132239
351 8004313663 8004312739 Bacteria 7444653
352 8004363562 8004361976 Bacteria 6858373
353 8004734768 8004727605 Bacteria 6643904
354 Ga0068862_100005467
355 JGI25153J46596_10000019
356 Ga0055542_1001090
357 Ga0055529_1003576
358 Ga0055531_10009724
359 Ga0070658_10386629
360 Ga0070676_10097356
361 Ga0068868_101108966
362 Ga0070660_100458780
363 Ga0070668_100180318
364 Ga0070675_100442156
365 Ga0070711_100417218
366 Ga0070678_100072779
367 Ga0070681_10348917
368 Ga0068867_100084434
369 Ga0070672_100631009
370 Ga0070693_100265649
371 Ga0070665_100298468
372 Ga0070665_100442100
373 Ga0068855_100008020
374 Ga0068855_100094773
375 Ga0068856_100455027
376 Ga0068856_100745082
377 Ga0070717_10666251
378 Ga0075365_10019462
379 Ga0075364_10008406
380 Ga0075364_10075536
381 Ga0075367_10177034
382 Ga0097621_100006620
383 Ga0075370_10030365
384 Ga0075370_10477473
385 Ga0068871_100000287
386 Ga0068865_100007265
387 Ga0105240_10005826
388 Ga0105240_10017650
389 Ga0105240_10484487
390 Ga0105243_10153226
391 Ga0105241_10106767
392 Ga0105242_10014984
393 Ga0105248_10500121
394 Ga0105237_10154904
395 Ga0105238_10077686
396 Ga0105238_10201577
397 Ga0105238_10630831
398 Ga0105239_10163814
399 Ga0105239_10377146
400 Ga0105239_11587017
401 Ga0157370_10636503
402 Ga0157369_10263171
403 Ga0157374_10184147
404 Ga0157374_10690688
405 Ga0157374_10981497
406 Ga0157378_10109169
407 Ga0157378_10185742
408 Ga0157378_10189692
409 Ga0157378_10669678
410 Ga0163162_10097738
411 Ga0163162_11148087
412 Ga0157375_10089267
413 Ga0157375_11350221
414 Ga0163163_10085274
415 Ga0157376_10113255
416 Ga0163161_10023826
417 Ga0213876_10085329
418 Ga0213875_10019919
419 Ga0209148_1000212
420 Ga0209233_1001226
421 Ga0209455_1000346
422 Ga0209758_1000028
423 Ga0209050_1025463
424 Ga0209257_1000688
425 Ga0207645_10067172
426 Ga0207705_10174924
427 Ga0207705_10409710
428 Ga0207654_10080308
429 Ga0207695_10026936
430 Ga0207695_10308566
431 Ga0207657_10103453
432 Ga0207657_10206785
433 Ga0207694_10020268
434 Ga0207694_10189871
435 Ga0207686_10028275
436 Ga0207709_10188013
437 Ga0207709_10526616
438 Ga0207691_10362046
439 Ga0207667_10000429
440 Ga0207667_10055411
441 Ga0207639_10031643
442 Ga0207639_10279724
443 Ga0207702_10101401
444 Ga0207702_10778523
445 Ga0207702_10781854
446 Ga0207648_10118464
447 Ga0207674_10283959
448 Ga0207674_10942261
449 Ga0207698_10414054
450 Ga0268266_10315760
451 Ga0268265_10056785
452 Ga0307515_10170863
453 Ga0265338_10014619
454 Ga0265325_10066370
455 Ga0265331_10150046
456 Ga0265327_10024126
457 Ga0307508_10029723
458 Ga0265314_10204370
459 Ga0307412_10133138
460 Ga0373943_0220242
461 Ga0373924_0108896
462 Ga0373927_0021420
463 Ga0373937_0254090
464 Ga0373925_0168922
465 Ga0436364_0258581
466 Ga0436364_0360454
467 Ga0436365_0417623
468 Ga0436365_0527818
469 Ga0436360_0490156
470 Ga0436360_1132164
471 Ga0436361_0236301
472 Ga0436361_0388201
473 Ga0495638_0075586
474 Ga0495638_0260446
475 Ga0495608_0174323
476 Ga0495643_0096556
477 Ga0495665_0399531
478 Ga0495625_0008106
479 Ga0495658_0000646
480 Ga0495613_0289025
481 Ga0495670_0215135
482 Ga0495581_0074955
483 Ga0495687_090339
484 Ga0495675_0472479
485 Ga0495684_0085808
486 Ga0495686_0052847
487 Ga0495686_0065896
488 Ga0496102_0145974
489 Ga0496104_0009149
490 Ga0496105_0060235
491 Ga0496105_0687028
492 Ga0496109_0676772
493 Ga0496110_1133324
494 Ga0496111_0120007
495 Ga0496112_0189687
496 Ga0496114_0549067
497 Ga0496115_0609134
498 Ga0496115_0825887
499 Ga0496118_0160136
500 Ga0496119_0000247
501 Ga0496119_0134883
502 Ga0496120_0009305
503 Ga0496121_0101217
504 Ga0501032_0365403
505 Ga0501034_0269009
506 Ga0501036_0418454
507 Ga0501037_0108119
508 Ga0501038_0128971
509 Ga0501038_0132345
510 Ga0501043_0165446
511 Ga0501047_0006986
512 Ga0501047_0012272
513 Ga0501047_0218771
514 Ga0501047_0270965
515 Ga0501047_0521015
516 Ga0501067_0097395
517 Ga0501067_0151493
518 Ga0501068_0012242
519 Ga0501068_0151130
520 Ga0501069_0089833
521 Ga0501070_0153594
522 Ga0501070_0156179
523 Ga0501072_0157052
524 Ga0501073_0049137
525 Ga0501073_0050747
526 Ga0501073_0081024
527 Ga0501080_0096376
528 Ga0501080_0134156
529 Ga0501080_0191505
530 Ga0501080_0320377
531 Ga0501083_0014473
532 Ga0501083_0033110
533 Ga0501035_0517749
534 Ga0501035_0621448
535 Ga0501044_0002303
536 Ga0501044_0097977
537 Ga0501044_0131283
538 Ga0501044_0146292
539 Ga0501044_0175462
540 Ga0501044_0215605
541 nmdc:mga03n38_15115_c1
542 nmdc:mga00v17_72278_c1
543 nmdc:mga0yw44_52903_c1
544 nmdc:mga06z11_106905_c1
545 nmdc:mga06z11_198957_c1
546 nmdc:mga07m45_232912_c1
547 nmdc:mga0sz30_131470_c1
548 Ga0495619_0649419
549 Ga0500578_0033481
550 Ga0500644_0042289
551 Ga0500583_0114626
552 Ga0500651_0235994
553 Ga0500566_0028584
554 Ga0500650_0089904
555 Ga0500650_0100504
556 Ga0500562_023446
557 Ga0500595_000277
558 Ga0500595_024632
559 Ga0500597_205650
560 Ga0500642_0001772
561 Ga0500658_0176295
562 Ga0500568_0015475
563 Ga0500577_0007388
564 Ga0500577_0018251
565 Ga0500585_006866
566 Ga0500588_0002462
567 Ga0500603_050110
568 Ga0500604_0001133
569 Ga0500604_0008301
570 Ga0500604_0106445
571 Ga0500616_0008785
572 Ga0500627_0065257
573 Ga0500627_0085656
574 Ga0500611_011057
575 Ga0500611_024924
576 Ga0500609_001196
577 Ga0501084_0170652
578 Ga0501082_0015983
579 Ga0501082_0145007
580 2503198836
581 2509118748
582 2509368844
583 2510315168
584 2512933772
585 2512961940
586 2514038908
587 2643985893
588 2644154385
589 2756675176
590 2792747322
591 2844003330
592 2844010912
593 2856332417
594 2856340341
595 2857375630
596 2857507860
597 2869172369
598 2869235048
599 2869244647
600 2869249754
601 2869261565
602 2869267870
603 2869277693
604 2869284869
605 2871457146
606 2871462859
607 2871471521
608 2871487039
609 2874112916
610 2874117566
611 2874133868
612 2874166027
613 2874169998
614 2874173358
615 2876363973
616 2876389974
617 2876404472
618 2876410239
619 2876424694
620 2878737026
621 2878741122
622 2878776474
623 2878786280
624 2903453927
625 2903519755
626 2903525868
627 2903532586
628 2906369255
629 2906371243
630 2906384870
631 2906389878
632 2906395211
633 2906402216
634 2906410484
635 2906433090
636 2922154145
637 2922175582
638 2922181066
639 2924711966
640 2924738514
641 2924742638
642 2924752886
643 2924778723
644 2937850181
645 2937864903
646 2937876003
647 2937980714
648 2958038167
649 2958042250
650 2958071030
651 2958085653
652 2958109340
653 2958129948
654 2958141890
655 2958145695
656 2958164108
657 2961141580
658 2961187655
659 2963645431
660 2965029865
661 2965039916
662 2965046171
663 2965054182
664 2965093015
665 2965107608
666 2965117579
667 2968017355
668 2968089653
669 2968146787
670 2970470714
671 2970492862
672 2970510750
673 2970534930
674 2970553165
675 2970599480
676 2970622407
677 2970632083
678 2977854424
679 2977874508
680 2977903619
681 2977910790
682 2977920932
683 2977924652
684 2977938725
685 2977953689
686 2977962176
687 2977986968
688 2979769438
689 2979778784
690 2979799475
691 2987651040
692 2987673914
693 3000137485
694 3004200364
695 3004216869
696 3004225537
697 3004237239
698 3004240614
699 3004255543
700 3004272087
701 637076885
702 649870663
703 8004303151
704 8004313663
705 8004363562
706 8004734768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02245

Pur_DNA_glyco

Methylpurine-DNA glycosylase (MPG)

42

225

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bnk-assembly1.cif.gz_A human 3-methyladenine dna glycosylase complexed to dna 0.9217 10 203
3uby-assembly1.cif.gz_B-1 crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna 0.9181 6 203
1f6o-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with dna 0.9155 10 206
3uby-assembly1.cif.gz_A crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna 0.9136 4 203
3qi5-assembly2.cif.gz_B crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.9081 4 208
ID Description Score Start End Superfamily
3ubyB00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9181 6 203 3.10.300.10
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9151 10 206 3.10.300.10
af_Q2FVS1_1_195_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9144 16 201 3.10.300.10
af_P9WJP7_1_198_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9104 11 202 3.10.300.10
3ubyB00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9033 6 203 3.10.300.10
ID Description Score Start End GO Terms
AF-A0A2P7P289-F1-model_v4 deleted 0.9933 64 152
AF-A0A5R2MZC9-F1-model_v4 3-methyladenine DNA glycosylase 0.9924 16 124 GO:0003677
GO:0003905
GO:0006284
AF-A0A352NHM6-F1-model_v4 DNA-3-methyladenine glycosylase 0.9831 11 160 GO:0003677
GO:0003905
GO:0006284
AF-A0A2P7P289-F1-model_v4 deleted 0.9824 64 152
AF-A0A7V5ZE74-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9777 10 203 GO:0003677
GO:0003905
GO:0006284

Map