F419192

General Info

Members Datasets Scaffolds Average Seq Length
352 223 704 406

Family's Representative Sequence

Representative Sequence 3300049661|Ga0501217_011527|Ga0501217_011527_81_1427
Length 448
Sequence LALKGLPVLNAFGVLRKTANNESADTMSSVEQLLCESEQLLRELTPQVLGTVVRKFHDFAAAEDAVQEASLAAAMQWPIQGLPNNPRAWLTQVAFRRLIDEIRRDSARRTRENELICESAVEPNVDFAPNDDDTLVLLFMCCHPSLTQSSAIALTLRAVGGLTTAEIAHAFLVPEATMAQRISRAKQTIKTSGIPFQLPTLDERTQRLKSVLHVLYLIFNEGYTSSGGSALHRTDLSQEAIRLTRIVRELQPHDTEVAGLMLLTDARRRARTTPEGYLVPLSRQDRKLWNKDQIAEGVALISETLPKGVVGAYQLQAAIAAVHDEAASAEETDWPQILALYDVLQRVSDNPMVKLNGAVAAAMVHGPAKGLQLLEELANDARVANHHRLHAVRAHLLELGGDFVGAIGQYRSAAARTGSLPERNYLLTQAAQLERQVDADQSQKITTD

Samples

Sample ID Description Type Environment
1 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
216 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
217 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
218 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
219 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
220 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
221 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
222 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
223 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0.28
Rhizoplane 2.56
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501217_011527 3300049661 Bacteria 1958
2 MBSR1b_contig_4370539 2162886012 Bacteria 3202
3 Ga0065715_10002017 3300005293 Bacteria 5271
4 Ga0065715_10092808 3300005293 Bacteria 4927
5 Ga0070658_10030950 3300005327 Bacteria 4298
6 Ga0070658_10110823 3300005327 Unclassified 2274
7 Ga0070690_100040342 3300005330 Bacteria 2952
8 Ga0070677_10018955 3300005333 Bacteria 2486
9 Ga0070666_10017251 3300005335 Bacteria 4626
10 Ga0068868_100042346 3300005338 Bacteria 3553
11 Ga0070689_100001023 3300005340 Bacteria 17549
12 Ga0070661_100035652 3300005344 Bacteria 3613
13 Ga0070661_100179679 3300005344 Bacteria 1609
14 Ga0070668_100018752 3300005347 Bacteria 5196
15 Ga0070668_100027600 3300005347 Bacteria 4310
16 Ga0070668_100098133 3300005347 Bacteria 2318
17 Ga0070675_100005951 3300005354 Bacteria 9342
18 Ga0070675_100005983 3300005354 Bacteria 9321
19 Ga0070675_100055276 3300005354 Bacteria 3268
20 Ga0070675_100088046 3300005354 Bacteria 2597
21 Ga0070675_100245920 3300005354 Bacteria 1564
22 Ga0070671_100192201 3300005355 Bacteria 1730
23 Ga0070659_100059483 3300005366 Unclassified 3017
24 Ga0070667_100262182 3300005367 Bacteria 1548
25 Ga0070709_10037024 3300005434 Bacteria 2976
26 Ga0070709_10211231 3300005434 Bacteria 1380
27 Ga0070714_100055694 3300005435 Bacteria 3380
28 Ga0070714_100076823 3300005435 Bacteria 2900
29 Ga0070713_100029452 3300005436 Bacteria 4349
30 Ga0070710_10028592 3300005437 Bacteria 2983
31 Ga0070705_100024589 3300005440 Bacteria 3254
32 Ga0070694_100028056 3300005444 Bacteria 3660
33 Ga0070708_100013611 3300005445 Bacteria 6668
34 Ga0070708_100078120 3300005445 Bacteria 2992
35 Ga0070663_100001258 3300005455 Bacteria 13915
36 Ga0070678_100079160 3300005456 Bacteria 2485
37 Ga0070662_100039475 3300005457 Bacteria 3357
38 Ga0070681_10064541 3300005458 Bacteria 3632
39 Ga0068867_100093426 3300005459 Bacteria 2286
40 Ga0068867_100155936 3300005459 Bacteria 1797
41 Ga0070685_10153774 3300005466 Bacteria 1460
42 Ga0070706_100015959 3300005467 Bacteria 6937
43 Ga0070707_100014674 3300005468 Bacteria 7342
44 Ga0070707_100027038 3300005468 Bacteria 5455
45 Ga0070707_100192960 3300005468 Bacteria 1986
46 Ga0070698_100006047 3300005471 Bacteria 13181
47 Ga0070698_100010557 3300005471 Bacteria 9843
48 Ga0070698_100157214 3300005471 Bacteria 2219
49 Ga0070699_100000820 3300005518 Bacteria 28792
50 Ga0070699_100009500 3300005518 Bacteria 8424
51 Ga0070684_100273635 3300005535 Bacteria 1546
52 Ga0068853_100002451 3300005539 Bacteria 13884
53 Ga0068853_100087004 3300005539 Bacteria 2741
54 Ga0070672_100009720 3300005543 Bacteria 6642
55 Ga0070696_100050289 3300005546 Bacteria 2897
56 Ga0070665_100018993 3300005548 Bacteria 6895
57 Ga0070665_100079725 3300005548 Bacteria 3280
58 Ga0068855_100004052 3300005563 Bacteria 17878
59 Ga0068855_100011953 3300005563 Bacteria 10495
60 Ga0070664_100008288 3300005564 Bacteria 8407
61 Ga0068854_100050876 3300005578 Bacteria 2966
62 Ga0068854_100162495 3300005578 Bacteria 1731
63 Ga0068856_100137812 3300005614 Bacteria 2446
64 Ga0068859_100000208 3300005617 Bacteria 58155
65 Ga0068859_100005657 3300005617 Bacteria 12723
66 Ga0068859_100033691 3300005617 Bacteria 5143
67 Ga0068859_100104663 3300005617 Bacteria 2889
68 Ga0068859_100191682 3300005617 Bacteria 2128
69 Ga0068859_100218536 3300005617 Bacteria 1993
70 Ga0068864_100093009 3300005618 Bacteria 2663
71 Ga0068861_100023028 3300005719 Bacteria 4491
72 Ga0068851_10015110 3300005834 Bacteria 3675
73 Ga0068851_10048888 3300005834 Bacteria 2144
74 Ga0068863_100041068 3300005841 Bacteria 4397
75 Ga0068863_100045063 3300005841 Bacteria 4186
76 Ga0068863_100250104 3300005841 Bacteria 1712
77 Ga0068858_100003576 3300005842 Bacteria 15376
78 Ga0068858_100223247 3300005842 Bacteria 1785
79 Ga0068858_100229907 3300005842 Bacteria 1758
80 Ga0068860_100091154 3300005843 Unclassified 2904
81 Ga0068860_100189096 3300005843 Bacteria 1992
82 Ga0068862_100000404 3300005844 Bacteria 46607
83 Ga0081455_10061232 3300005937 Bacteria 3168
84 Ga0081455_10107301 3300005937 Bacteria 2226
85 Ga0081538_10000492 3300005981 Bacteria 44066
86 Ga0081538_10004336 3300005981 Bacteria 13100
87 Ga0081538_10018639 3300005981 Bacteria 5199
88 Ga0081538_10033929 3300005981 Bacteria 3386
89 Ga0081540_1003092 3300005983 Bacteria 13333
90 Ga0081539_10000667 3300005985 Bacteria 68763
91 Ga0081539_10002573 3300005985 Bacteria 25045
92 Ga0081539_10006915 3300005985 Bacteria 10566
93 Ga0081539_10045621 3300005985 Bacteria 2519
94 Ga0070717_10091824 3300006028 Bacteria 2564
95 Ga0075368_10036653 3300006042 Bacteria 1916
96 Ga0070712_100021202 3300006175 Bacteria 4263
97 Ga0075367_10021721 3300006178 Bacteria 3591
98 Ga0068871_100171231 3300006358 Bacteria 1861
99 Ga0068871_100236195 3300006358 Bacteria 1588
100 Ga0075428_100000121 3300006844 Bacteria 67666
101 Ga0075428_100011286 3300006844 Bacteria 9937
102 Ga0075428_100150352 3300006844 Bacteria 2529
103 Ga0075428_100220184 3300006844 Bacteria 2050
104 Ga0075430_100013546 3300006846 Bacteria 6952
105 Ga0075430_100055910 3300006846 Bacteria 3318
106 Ga0075431_100133175 3300006847 Bacteria 2563
107 Ga0075431_100237105 3300006847 Bacteria 1857
108 Ga0075433_10081313 3300006852 Bacteria 2856
109 Ga0075434_100153692 3300006871 Bacteria 2321
110 Ga0075429_100017320 3300006880 Bacteria 6231
111 Ga0075429_100043028 3300006880 Bacteria 3929
112 Ga0075429_100059795 3300006880 Bacteria 3320
113 Ga0068865_100019158 3300006881 Bacteria 4427
114 Ga0075436_100004214 3300006914 Bacteria 9869
115 Ga0097620_100000208 3300006931 Bacteria 58155
116 Ga0097620_100005657 3300006931 Bacteria 12723
117 Ga0097620_100033692 3300006931 Bacteria 5143
118 Ga0097620_100104662 3300006931 Bacteria 2889
119 Ga0097620_100191679 3300006931 Bacteria 2128
120 Ga0097620_100218534 3300006931 Bacteria 1993
121 Ga0105240_10000616 3300009093 Bacteria 65942
122 Ga0105240_10028476 3300009093 Bacteria 7297
123 Ga0105240_10074713 3300009093 Bacteria 4182
124 Ga0105240_10077589 3300009093 Bacteria 4092
125 Ga0111539_10152466 3300009094 Bacteria 2705
126 Ga0105245_10012694 3300009098 Bacteria 7335
127 Ga0105245_10096568 3300009098 Bacteria 2727
128 Ga0114129_10007714 3300009147 Bacteria 15308
129 Ga0114129_10019246 3300009147 Bacteria 9725
130 Ga0114129_10076413 3300009147 Bacteria 4662
131 Ga0114129_10113334 3300009147 Bacteria 3739
132 Ga0105243_10023556 3300009148 Bacteria 4690
133 Ga0105241_10002015 3300009174 Bacteria 15365
134 Ga0105242_10063752 3300009176 Bacteria 3035
135 Ga0105248_10083085 3300009177 Bacteria 3603
136 Ga0105248_10186994 3300009177 Bacteria 2334
137 Ga0105237_10002565 3300009545 Bacteria 22423
138 Ga0105237_10051158 3300009545 Bacteria 4150
139 Ga0105238_10007412 3300009551 Bacteria 10990
140 Ga0105238_10015893 3300009551 Bacteria 7615
141 Ga0105249_10021866 3300009553 Bacteria 5728
142 Ga0105249_10212961 3300009553 Bacteria 1897
143 Ga0105239_10016001 3300010375 Bacteria 8302
144 Ga0105239_10039913 3300010375 Bacteria 5142
145 Ga0157373_10045306 3300013100 Unclassified 3140
146 Ga0157370_10029156 3300013104 Bacteria 5420
147 Ga0157369_10100577 3300013105 Bacteria 3082
148 Ga0157374_10108281 3300013296 Bacteria 2671
149 Ga0163162_10040194 3300013306 Bacteria 4676
150 Ga0163162_10052368 3300013306 Bacteria 4099
151 Ga0163162_10163559 3300013306 Bacteria 2348
152 Ga0157372_10027760 3300013307 Bacteria 6169
153 Ga0157375_10041097 3300013308 Bacteria 4463
154 Ga0157375_10066454 3300013308 Bacteria 3600
155 Ga0157375_10294985 3300013308 Bacteria 1784
156 Ga0163163_10140090 3300014325 Bacteria 2461
157 Ga0163163_10159721 3300014325 Bacteria 2299
158 Ga0157380_10008191 3300014326 Bacteria 7448
159 Ga0157380_10127956 3300014326 Bacteria 2162
160 Ga0157380_10164031 3300014326 Bacteria 1934
161 Ga0157379_10004565 3300014968 Bacteria 11876
162 Ga0157379_10047907 3300014968 Bacteria 3814
163 Ga0157376_10227983 3300014969 Bacteria 1729
164 Ga0182007_10006064 3300015262 Bacteria 5226
165 Ga0228598_1000594 3300024227 Bacteria 7606
166 Ga0207697_10003278 3300025315 Bacteria 8044
167 Ga0207656_10012657 3300025321 Bacteria 3212
168 Ga0207692_10048884 3300025898 Bacteria 2132
169 Ga0207642_10068931 3300025899 Bacteria 1675
170 Ga0207710_10050682 3300025900 Bacteria 1863
171 Ga0207680_10013193 3300025903 Bacteria 4236
172 Ga0207699_10101250 3300025906 Bacteria 1829
173 Ga0207705_10023641 3300025909 Bacteria 4384
174 Ga0207684_10044710 3300025910 Bacteria 3756
175 Ga0207707_10016690 3300025912 Bacteria 6401
176 Ga0207707_10086750 3300025912 Bacteria 2735
177 Ga0207695_10001989 3300025913 Bacteria 31550
178 Ga0207695_10006367 3300025913 Bacteria 15358
179 Ga0207695_10095606 3300025913 Bacteria 2974
180 Ga0207671_10007538 3300025914 Bacteria 9422
181 Ga0207671_10099030 3300025914 Bacteria 2206
182 Ga0207693_10012308 3300025915 Bacteria 6915
183 Ga0207693_10071116 3300025915 Bacteria 2722
184 Ga0207657_10003218 3300025919 Bacteria 17487
185 Ga0207649_10090967 3300025920 Bacteria 1998
186 Ga0207646_10010444 3300025922 Bacteria 9076
187 Ga0207646_10147172 3300025922 Bacteria 2123
188 Ga0207646_10327702 3300025922 Bacteria 1383
189 Ga0207694_10047073 3300025924 Bacteria 3335
190 Ga0207694_10107606 3300025924 Bacteria 2215
191 Ga0207659_10000634 3300025926 Bacteria 20857
192 Ga0207659_10018613 3300025926 Bacteria 4556
193 Ga0207659_10055408 3300025926 Bacteria 2836
194 Ga0207659_10107289 3300025926 Bacteria 2116
195 Ga0207687_10007191 3300025927 Bacteria 7337
196 Ga0207700_10091747 3300025928 Bacteria 2400
197 Ga0207706_10109926 3300025933 Bacteria 2425
198 Ga0207706_10112469 3300025933 Bacteria 2395
199 Ga0207709_10180086 3300025935 Bacteria 1492
200 Ga0207670_10000025 3300025936 Bacteria 141352
201 Ga0207665_10013395 3300025939 Bacteria 5392
202 Ga0207665_10023799 3300025939 Bacteria 4033
203 Ga0207665_10071086 3300025939 Bacteria 2375
204 Ga0207691_10000805 3300025940 Bacteria 31178
205 Ga0207691_10028642 3300025940 Bacteria 5214
206 Ga0207691_10064026 3300025940 Bacteria 3333
207 Ga0207691_10090451 3300025940 Bacteria 2743
208 Ga0207711_10022764 3300025941 Bacteria 5241
209 Ga0207711_10058292 3300025941 Bacteria 3322
210 Ga0207679_10101420 3300025945 Bacteria 2251
211 Ga0207667_10005103 3300025949 Bacteria 16038
212 Ga0207667_10011403 3300025949 Bacteria 10331
213 Ga0207651_10185376 3300025960 Bacteria 1655
214 Ga0207712_10105354 3300025961 Bacteria 2104
215 Ga0207668_10029346 3300025972 Bacteria 3605
216 Ga0207658_10078797 3300025986 Bacteria 2519
217 Ga0207658_10214945 3300025986 Bacteria 1614
218 Ga0207677_10178861 3300026023 Bacteria 1667
219 Ga0207703_10001196 3300026035 Bacteria 24392
220 Ga0207703_10101822 3300026035 Bacteria 2436
221 Ga0207703_10123246 3300026035 Bacteria 2228
222 Ga0207703_10183553 3300026035 Bacteria 1848
223 Ga0207639_10074851 3300026041 Bacteria 2660
224 Ga0207678_10019826 3300026067 Bacteria 5912
225 Ga0207678_10024091 3300026067 Bacteria 5318
226 Ga0207678_10112335 3300026067 Bacteria 2324
227 Ga0207641_10031141 3300026088 Bacteria 4423
228 Ga0207648_10189821 3300026089 Bacteria 1820
229 Ga0207676_10221116 3300026095 Bacteria 1687
230 Ga0207674_10045076 3300026116 Bacteria 4539
231 Ga0207674_10068957 3300026116 Bacteria 3557
232 Ga0207674_10329802 3300026116 Bacteria 1476
233 Ga0207675_100056073 3300026118 Bacteria 3676
234 Ga0207683_10034569 3300026121 Bacteria 4392
235 Ga0207683_10043659 3300026121 Bacteria 3918
236 Ga0207683_10114570 3300026121 Bacteria 2416
237 Ga0268265_10000297 3300028380 Bacteria 55640
238 Ga0268264_10140997 3300028381 Bacteria 2149
239 Ga0307515_10000018 3300028794 Bacteria 424853
240 Ga0307511_10000145 3300030521 Bacteria 66808
241 Ga0307512_10054959 3300030522 Bacteria 3146
242 Ga0307513_10216370 3300031456 Bacteria 1742
243 Ga0307509_10003077 3300031507 Bacteria 25910
244 Ga0265314_10000064 3300031711 Bacteria 158787
245 Ga0307405_10003318 3300031731 Bacteria 7367
246 Ga0307410_10001925 3300031852 Bacteria 9733
247 Ga0307406_10006633 3300031901 Bacteria 6398
248 Ga0307407_10057970 3300031903 Bacteria 2249
249 Ga0307409_100035666 3300031995 Bacteria 3647
250 Ga0307409_100076209 3300031995 Bacteria 2688
251 Ga0307409_100423672 3300031995 Bacteria 1277
252 Ga0307416_100037400 3300032002 Bacteria 3734
253 Ga0307416_100097240 3300032002 Bacteria 2549
254 Ga0307415_100000072 3300032126 Bacteria 42179
255 Ga0307510_10014663 3300033180 Bacteria 9277
256 Ga0373935_0033698 3300035692 Bacteria 3189
257 Ga0373947_0028247 3300035725 Bacteria 3287
258 Ga0373925_0000366 3300037068 Bacteria 47068
259 Ga0373925_0022613 3300037068 Bacteria 4588
260 Ga0395898_0107363 3300037466 Bacteria 2677
261 Ga0395898_0137410 3300037466 Bacteria 2340
262 Ga0395905_0023673 3300037471 Bacteria 5799
263 Ga0395905_0055820 3300037471 Bacteria 3697
264 Ga0395905_0120174 3300037471 Bacteria 2470
265 Ga0395901_0003228 3300038443 Bacteria 16403
266 Ga0395901_0010950 3300038443 Bacteria 9188
267 Ga0395901_0071037 3300038443 Bacteria 3627
268 Ga0436365_1408212 3300039437 Bacteria 2425
269 Ga0436360_0880056 3300039438 Unclassified 1598
270 Ga0436361_1097729 3300039447 Bacteria 95612
271 Ga0451793_0182703 3300041452 Bacteria 2423
272 Ga0439463_022333 3300042016 Bacteria 1583
273 Ga0466969_0006783 3300044656 Bacteria 6091
274 Ga0466966_0003812 3300044684 Bacteria 9950
275 Ga0466961_0003310 3300044693 Bacteria 10047
276 Ga0466959_0008000 3300045049 Bacteria 7449
277 Ga0495580_0059001 3300046472 Bacteria 2697
278 Ga0495582_0013550 3300046473 Bacteria 4489
279 Ga0495639_0014429 3300046475 Bacteria 3421
280 Ga0495594_0100304 3300046499 Bacteria 1628
281 Ga0495618_0169755 3300046514 Bacteria 1389
282 Ga0495628_0066134 3300046516 Bacteria 2826
283 Ga0495630_0038196 3300046517 Bacteria 3592
284 Ga0495665_0076941 3300046531 Bacteria 1756
285 Ga0495640_0063617 3300046533 Bacteria 2498
286 Ga0495586_0016652 3300046535 Bacteria 3909
287 Ga0495659_0007739 3300046664 Bacteria 3408
288 Ga0495599_0085986 3300046678 Bacteria 1964
289 Ga0495658_0026720 3300046683 Bacteria 3097
290 Ga0495636_0003571 3300047318 Bacteria 6030
291 Ga0495674_0015897 3300047319 Bacteria 7026
292 Ga0495674_0061267 3300047319 Bacteria 3280
293 Ga0495672_0015197 3300047320 Bacteria 5237
294 Ga0495672_0026736 3300047320 Bacteria 3677
295 Ga0495684_0035605 3300047471 Bacteria 3817
296 Ga0495614_0059890 3300048089 Bacteria 1636
297 Ga0496101_0334157 3300048904 Bacteria 1189
298 Ga0496102_0001312 3300048905 Bacteria 22314
299 Ga0496102_0030416 3300048905 Bacteria 4833
300 Ga0496103_0103413 3300048906 Bacteria 1804
301 Ga0496104_0071255 3300048907 Unclassified 3305
302 Ga0496105_0194644 3300048908 Bacteria 1657
303 Ga0496108_0004581 3300048911 Bacteria 11139
304 Ga0496114_0063781 3300048917 Bacteria 3085
305 Ga0496117_0023505 3300048920 Bacteria 4907
306 Ga0496118_0000081 3300048921 Bacteria 188525
307 Ga0496125_0001613 3300048928 Bacteria 31867
308 Ga0501070_0061318 3300049586 Bacteria 3116
309 Ga0501071_0068732 3300049587 Bacteria 2578
310 Ga0501075_0206105 3300049591 Bacteria 1500
311 Ga0501076_0164193 3300049592 Bacteria 1810
312 Ga0501080_0103776 3300049742 Bacteria 2637
313 nmdc:mga06z11_7460_c1 3300050494 Bacteria 4500
314 nmdc:mga05p37_10200_c1 3300050507 Bacteria 11154
315 nmdc:mga05p37_138994_c1 3300050507 Bacteria 2977
316 nmdc:mga05p37_191569_c1 3300050507 Bacteria 2482
317 nmdc:mga05p37_27809_c1 3300050507 Bacteria 6889
318 nmdc:mga05p37_405911_c1 3300050507 Bacteria 1590
319 nmdc:mga05p37_5314_c1 3300050507 Bacteria 9660
320 nmdc:mga09592_19469_c1 3300050508 Bacteria 5573
321 nmdc:mga09592_290247_c1 3300050508 Bacteria 1418
322 nmdc:mga09592_32444_c1 3300050508 Bacteria 4354
323 nmdc:mga09592_812_c1 3300050508 Bacteria 24102
324 nmdc:mga09592_91217_c1 3300050508 Bacteria 2604
325 nmdc:mga0qj67_114_c1 3300050509 Bacteria 52737
326 nmdc:mga0qj67_12903_c1 3300050509 Bacteria 6304
327 nmdc:mga0qj67_218693_c1 3300050509 Bacteria 1546
328 nmdc:mga06r32_178983_c1 3300050510 Bacteria 2106
329 nmdc:mga06r32_236_c1 3300050510 Bacteria 40694
330 nmdc:mga08y16_11523_c1 3300050511 Bacteria 2621
331 nmdc:mga08y16_96386_c1 3300050511 Bacteria 3081
332 nmdc:mga0n895_149897_c1 3300050512 Bacteria 2362
333 nmdc:mga0a205_139637_c1 3300050515 Bacteria 2323
334 Ga0495601_0041966 3300053077 Bacteria 2869
335 Ga0500635_0037213 3300053080 Bacteria 1608
336 Ga0500651_0002782 3300053093 Bacteria 9359
337 Ga0500651_0006325 3300053093 Bacteria 6813
338 Ga0500566_0001629 3300053094 Bacteria 13215
339 Ga0500568_0000336 3300053139 Bacteria 37013
340 Ga0500603_017504 3300053150 Bacteria 1713
341 Ga0501082_0150088 3300060353 Bacteria 2024
342 Ga0501082_0283579 3300060353 Bacteria 1442
343 Ga0530510_0153743 3300061734 Bacteria 1700
344 2676484189 2675903059 Bacteria 8644972
345 2799183828 2799112218 Bacteria 4315149
346 2832009395 2832004796 Bacteria 6538017
347 2866066241 2866065130 Bacteria 6518152
348 2891401350 2891395885 Bacteria 9251614
349 2895429675 2895427314 Bacteria 13147766
350 2915770218 2915768154 Bacteria 8424322
351 8055418887 8055412473 Bacteria 6257500
352 8057572948 8057568493 Bacteria 7221719
353 Ga0501217_011527
354 MBSR1b_contig_4370539
355 Ga0065715_10002017
356 Ga0065715_10092808
357 Ga0070658_10030950
358 Ga0070658_10110823
359 Ga0070690_100040342
360 Ga0070677_10018955
361 Ga0070666_10017251
362 Ga0068868_100042346
363 Ga0070689_100001023
364 Ga0070661_100035652
365 Ga0070661_100179679
366 Ga0070668_100018752
367 Ga0070668_100027600
368 Ga0070668_100098133
369 Ga0070675_100005951
370 Ga0070675_100005983
371 Ga0070675_100055276
372 Ga0070675_100088046
373 Ga0070675_100245920
374 Ga0070671_100192201
375 Ga0070659_100059483
376 Ga0070667_100262182
377 Ga0070709_10037024
378 Ga0070709_10211231
379 Ga0070714_100055694
380 Ga0070714_100076823
381 Ga0070713_100029452
382 Ga0070710_10028592
383 Ga0070705_100024589
384 Ga0070694_100028056
385 Ga0070708_100013611
386 Ga0070708_100078120
387 Ga0070663_100001258
388 Ga0070678_100079160
389 Ga0070662_100039475
390 Ga0070681_10064541
391 Ga0068867_100093426
392 Ga0068867_100155936
393 Ga0070685_10153774
394 Ga0070706_100015959
395 Ga0070707_100014674
396 Ga0070707_100027038
397 Ga0070707_100192960
398 Ga0070698_100006047
399 Ga0070698_100010557
400 Ga0070698_100157214
401 Ga0070699_100000820
402 Ga0070699_100009500
403 Ga0070684_100273635
404 Ga0068853_100002451
405 Ga0068853_100087004
406 Ga0070672_100009720
407 Ga0070696_100050289
408 Ga0070665_100018993
409 Ga0070665_100079725
410 Ga0068855_100004052
411 Ga0068855_100011953
412 Ga0070664_100008288
413 Ga0068854_100050876
414 Ga0068854_100162495
415 Ga0068856_100137812
416 Ga0068859_100000208
417 Ga0068859_100005657
418 Ga0068859_100033691
419 Ga0068859_100104663
420 Ga0068859_100191682
421 Ga0068859_100218536
422 Ga0068864_100093009
423 Ga0068861_100023028
424 Ga0068851_10015110
425 Ga0068851_10048888
426 Ga0068863_100041068
427 Ga0068863_100045063
428 Ga0068863_100250104
429 Ga0068858_100003576
430 Ga0068858_100223247
431 Ga0068858_100229907
432 Ga0068860_100091154
433 Ga0068860_100189096
434 Ga0068862_100000404
435 Ga0081455_10061232
436 Ga0081455_10107301
437 Ga0081538_10000492
438 Ga0081538_10004336
439 Ga0081538_10018639
440 Ga0081538_10033929
441 Ga0081540_1003092
442 Ga0081539_10000667
443 Ga0081539_10002573
444 Ga0081539_10006915
445 Ga0081539_10045621
446 Ga0070717_10091824
447 Ga0075368_10036653
448 Ga0070712_100021202
449 Ga0075367_10021721
450 Ga0068871_100171231
451 Ga0068871_100236195
452 Ga0075428_100000121
453 Ga0075428_100011286
454 Ga0075428_100150352
455 Ga0075428_100220184
456 Ga0075430_100013546
457 Ga0075430_100055910
458 Ga0075431_100133175
459 Ga0075431_100237105
460 Ga0075433_10081313
461 Ga0075434_100153692
462 Ga0075429_100017320
463 Ga0075429_100043028
464 Ga0075429_100059795
465 Ga0068865_100019158
466 Ga0075436_100004214
467 Ga0097620_100000208
468 Ga0097620_100005657
469 Ga0097620_100033692
470 Ga0097620_100104662
471 Ga0097620_100191679
472 Ga0097620_100218534
473 Ga0105240_10000616
474 Ga0105240_10028476
475 Ga0105240_10074713
476 Ga0105240_10077589
477 Ga0111539_10152466
478 Ga0105245_10012694
479 Ga0105245_10096568
480 Ga0114129_10007714
481 Ga0114129_10019246
482 Ga0114129_10076413
483 Ga0114129_10113334
484 Ga0105243_10023556
485 Ga0105241_10002015
486 Ga0105242_10063752
487 Ga0105248_10083085
488 Ga0105248_10186994
489 Ga0105237_10002565
490 Ga0105237_10051158
491 Ga0105238_10007412
492 Ga0105238_10015893
493 Ga0105249_10021866
494 Ga0105249_10212961
495 Ga0105239_10016001
496 Ga0105239_10039913
497 Ga0157373_10045306
498 Ga0157370_10029156
499 Ga0157369_10100577
500 Ga0157374_10108281
501 Ga0163162_10040194
502 Ga0163162_10052368
503 Ga0163162_10163559
504 Ga0157372_10027760
505 Ga0157375_10041097
506 Ga0157375_10066454
507 Ga0157375_10294985
508 Ga0163163_10140090
509 Ga0163163_10159721
510 Ga0157380_10008191
511 Ga0157380_10127956
512 Ga0157380_10164031
513 Ga0157379_10004565
514 Ga0157379_10047907
515 Ga0157376_10227983
516 Ga0182007_10006064
517 Ga0228598_1000594
518 Ga0207697_10003278
519 Ga0207656_10012657
520 Ga0207692_10048884
521 Ga0207642_10068931
522 Ga0207710_10050682
523 Ga0207680_10013193
524 Ga0207699_10101250
525 Ga0207705_10023641
526 Ga0207684_10044710
527 Ga0207707_10016690
528 Ga0207707_10086750
529 Ga0207695_10001989
530 Ga0207695_10006367
531 Ga0207695_10095606
532 Ga0207671_10007538
533 Ga0207671_10099030
534 Ga0207693_10012308
535 Ga0207693_10071116
536 Ga0207657_10003218
537 Ga0207649_10090967
538 Ga0207646_10010444
539 Ga0207646_10147172
540 Ga0207646_10327702
541 Ga0207694_10047073
542 Ga0207694_10107606
543 Ga0207659_10000634
544 Ga0207659_10018613
545 Ga0207659_10055408
546 Ga0207659_10107289
547 Ga0207687_10007191
548 Ga0207700_10091747
549 Ga0207706_10109926
550 Ga0207706_10112469
551 Ga0207709_10180086
552 Ga0207670_10000025
553 Ga0207665_10013395
554 Ga0207665_10023799
555 Ga0207665_10071086
556 Ga0207691_10000805
557 Ga0207691_10028642
558 Ga0207691_10064026
559 Ga0207691_10090451
560 Ga0207711_10022764
561 Ga0207711_10058292
562 Ga0207679_10101420
563 Ga0207667_10005103
564 Ga0207667_10011403
565 Ga0207651_10185376
566 Ga0207712_10105354
567 Ga0207668_10029346
568 Ga0207658_10078797
569 Ga0207658_10214945
570 Ga0207677_10178861
571 Ga0207703_10001196
572 Ga0207703_10101822
573 Ga0207703_10123246
574 Ga0207703_10183553
575 Ga0207639_10074851
576 Ga0207678_10019826
577 Ga0207678_10024091
578 Ga0207678_10112335
579 Ga0207641_10031141
580 Ga0207648_10189821
581 Ga0207676_10221116
582 Ga0207674_10045076
583 Ga0207674_10068957
584 Ga0207674_10329802
585 Ga0207675_100056073
586 Ga0207683_10034569
587 Ga0207683_10043659
588 Ga0207683_10114570
589 Ga0268265_10000297
590 Ga0268264_10140997
591 Ga0307515_10000018
592 Ga0307511_10000145
593 Ga0307512_10054959
594 Ga0307513_10216370
595 Ga0307509_10003077
596 Ga0265314_10000064
597 Ga0307405_10003318
598 Ga0307410_10001925
599 Ga0307406_10006633
600 Ga0307407_10057970
601 Ga0307409_100035666
602 Ga0307409_100076209
603 Ga0307409_100423672
604 Ga0307416_100037400
605 Ga0307416_100097240
606 Ga0307415_100000072
607 Ga0307510_10014663
608 Ga0373935_0033698
609 Ga0373947_0028247
610 Ga0373925_0000366
611 Ga0373925_0022613
612 Ga0395898_0107363
613 Ga0395898_0137410
614 Ga0395905_0023673
615 Ga0395905_0055820
616 Ga0395905_0120174
617 Ga0395901_0003228
618 Ga0395901_0010950
619 Ga0395901_0071037
620 Ga0436365_1408212
621 Ga0436360_0880056
622 Ga0436361_1097729
623 Ga0451793_0182703
624 Ga0439463_022333
625 Ga0466969_0006783
626 Ga0466966_0003812
627 Ga0466961_0003310
628 Ga0466959_0008000
629 Ga0495580_0059001
630 Ga0495582_0013550
631 Ga0495639_0014429
632 Ga0495594_0100304
633 Ga0495618_0169755
634 Ga0495628_0066134
635 Ga0495630_0038196
636 Ga0495665_0076941
637 Ga0495640_0063617
638 Ga0495586_0016652
639 Ga0495659_0007739
640 Ga0495599_0085986
641 Ga0495658_0026720
642 Ga0495636_0003571
643 Ga0495674_0015897
644 Ga0495674_0061267
645 Ga0495672_0015197
646 Ga0495672_0026736
647 Ga0495684_0035605
648 Ga0495614_0059890
649 Ga0496101_0334157
650 Ga0496102_0001312
651 Ga0496102_0030416
652 Ga0496103_0103413
653 Ga0496104_0071255
654 Ga0496105_0194644
655 Ga0496108_0004581
656 Ga0496114_0063781
657 Ga0496117_0023505
658 Ga0496118_0000081
659 Ga0496125_0001613
660 Ga0501070_0061318
661 Ga0501071_0068732
662 Ga0501075_0206105
663 Ga0501076_0164193
664 Ga0501080_0103776
665 nmdc:mga06z11_7460_c1
666 nmdc:mga05p37_10200_c1
667 nmdc:mga05p37_138994_c1
668 nmdc:mga05p37_191569_c1
669 nmdc:mga05p37_27809_c1
670 nmdc:mga05p37_405911_c1
671 nmdc:mga05p37_5314_c1
672 nmdc:mga09592_19469_c1
673 nmdc:mga09592_290247_c1
674 nmdc:mga09592_32444_c1
675 nmdc:mga09592_812_c1
676 nmdc:mga09592_91217_c1
677 nmdc:mga0qj67_114_c1
678 nmdc:mga0qj67_12903_c1
679 nmdc:mga0qj67_218693_c1
680 nmdc:mga06r32_178983_c1
681 nmdc:mga06r32_236_c1
682 nmdc:mga08y16_11523_c1
683 nmdc:mga08y16_96386_c1
684 nmdc:mga0n895_149897_c1
685 nmdc:mga0a205_139637_c1
686 Ga0495601_0041966
687 Ga0500635_0037213
688 Ga0500651_0002782
689 Ga0500651_0006325
690 Ga0500566_0001629
691 Ga0500568_0000336
692 Ga0500603_017504
693 Ga0501082_0150088
694 Ga0501082_0283579
695 Ga0530510_0153743
696 2676484189
697 2799183828
698 2832009395
699 2866066241
700 2891401350
701 2895429675
702 2915770218
703 8055418887
704 8057572948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20239

DUF6596

Family of unknown function (DUF6596)

207

305

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

137

189

0.94

PF04542

Sigma70_r2

Sigma-70 region 2

40

108

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.879 112 167
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.8503 112 167
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8418 111 164
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8301 110 167
3hug-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8265 110 167
ID Description Score Start End Superfamily
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8503 112 167 1.10.10.10
af_Q9V3X5_795_872_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8317 344 413 1.25.40.10
af_Q8C1F5_289_370_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8316 332 410 1.25.40.10
af_M0RBH7_295_374_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8298 337 413 1.25.40.10
af_A0A1D6HKP2_180_283_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8235 328 408 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7Y5JWR8-F1-model_v4 RNA polymerase sigma factor 0.9901 109 410 GO:0003677
GO:0006352
GO:0016987
AF-A0A4V2Y1D2-F1-model_v4 DUF6596 domain-containing protein 0.9884 217 411
AF-A0A7Y5JWR8-F1-model_v4 RNA polymerase sigma factor 0.9836 109 410 GO:0003677
GO:0006352
GO:0016987
AF-W7V968-F1-model_v4 deleted 0.9832 240 413
AF-A0A0K8PHD4-F1-model_v4 RNA polymerase ECF-subfamily sigma factor 0.9813 240 413

Map