F419026

General Info

Members Datasets Scaffolds Average Seq Length
352 184 346 228

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10107468|Ga0163163_101074683
Length 247
Sequence LKIKARLNWRAFLYPAMIDDAPMDAPELDDLDDLVRRVDPDRWLSSRFVGDAHARADVLAIYAYDHELARAPRVTSNPLMGEIRLTWWREALDEIFEGRPVRAHPTAQALADVVLRRGLAREPLETMIDARYRELDPTPMRENELLDWARDTGGLAAQVAAQILDPASDAKLALAGGAAWALGKKLADRPDLRPTFLRVIHAARGASRALSVAAFPAVAHAALAGRPSKNDFSRRLRLTVAVARGKI

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221642 Caulobacter sp. Root343 Isolate Unclassified
4 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
5 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
6 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.64
Nodule 0
Rhizoplane 3.41
Rhizosphere 75.85
Stem 0
Stem Tuber 0
Unclassified 7.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1010997 3300003781 Bacteria 3522
2 Ga0055536_1011545 3300003781 Bacteria 3374
3 Ga0055530_10004835 3300003791 Bacteria 6738
4 Ga0055530_10010169 3300003791 Bacteria 3514
5 Ga0055531_10002894 3300003794 Bacteria 11174
6 Ga0055531_10015028 3300003794 Bacteria 3440
7 Ga0055543_1012685 3300004625 Bacteria 1685
8 Ga0065165_1000029 3300005262 Bacteria 220342
9 Ga0065165_1016253 3300005262 Bacteria 2795
10 Ga0070658_10221900 3300005327 Bacteria 1599
11 Ga0070658_10333025 3300005327 Bacteria 1297
12 Ga0070658_10358961 3300005327 Bacteria 1248
13 Ga0070683_100462369 3300005329 Bacteria 1211
14 Ga0070670_100000050 3300005331 Bacteria 132470
15 Ga0068869_100344141 3300005334 Bacteria 1214
16 Ga0070680_100134195 3300005336 Bacteria 2072
17 Ga0070680_100354541 3300005336 Bacteria 1248
18 Ga0068868_100337780 3300005338 Unclassified 1287
19 Ga0070660_100183538 3300005339 Bacteria 1694
20 Ga0070660_100371331 3300005339 Bacteria 1180
21 Ga0070660_100539820 3300005339 Bacteria 972
22 Ga0070668_100001106 3300005347 Bacteria 19008
23 Ga0070668_100001563 3300005347 Bacteria 16519
24 Ga0070668_100001996 3300005347 Bacteria 14916
25 Ga0070668_100032853 3300005347 Bacteria 3949
26 Ga0070669_100000576 3300005353 Bacteria 27261
27 Ga0070671_100000798 3300005355 Bacteria 22734
28 Ga0070671_100087094 3300005355 Bacteria 2613
29 Ga0070671_100205944 3300005355 Bacteria 1668
30 Ga0070673_100253397 3300005364 Bacteria 1535
31 Ga0070659_100001047 3300005366 Bacteria 20214
32 Ga0070659_100001844 3300005366 Bacteria 15225
33 Ga0070659_100001909 3300005366 Bacteria 14893
34 Ga0070667_100000140 3300005367 Bacteria 91817
35 Ga0070667_100002966 3300005367 Bacteria 14584
36 Ga0070667_100014536 3300005367 Bacteria 6504
37 Ga0070667_100265782 3300005367 Bacteria 1537
38 Ga0070667_100372466 3300005367 Bacteria 1296
39 Ga0070662_100212105 3300005457 Bacteria 1541
40 Ga0070681_10009284 3300005458 Bacteria 9672
41 Ga0070681_10009895 3300005458 Bacteria 9394
42 Ga0070679_100012066 3300005530 Bacteria 8250
43 Ga0068853_100053469 3300005539 Bacteria 3478
44 Ga0068853_100079096 3300005539 Bacteria 2875
45 Ga0068853_100094286 3300005539 Bacteria 2637
46 Ga0068853_100199383 3300005539 Bacteria 1821
47 Ga0068853_100598242 3300005539 Bacteria 1047
48 Ga0070665_100000248 3300005548 Bacteria 89239
49 Ga0070665_100006854 3300005548 Bacteria 11582
50 Ga0070665_100007821 3300005548 Bacteria 10848
51 Ga0070665_100022780 3300005548 Bacteria 6305
52 Ga0070665_100044262 3300005548 Bacteria 4470
53 Ga0070665_100836033 3300005548 Bacteria 934
54 Ga0068855_100114040 3300005563 Bacteria 3099
55 Ga0068855_100122502 3300005563 Bacteria 2975
56 Ga0068855_100193725 3300005563 Bacteria 2291
57 Ga0068855_100268511 3300005563 Bacteria 1898
58 Ga0070664_100090930 3300005564 Bacteria 2642
59 Ga0068856_100713539 3300005614 Bacteria 1023
60 Ga0068852_100053018 3300005616 Bacteria 3489
61 Ga0068859_100000177 3300005617 Bacteria 62179
62 Ga0068859_100147562 3300005617 Bacteria 2427
63 Ga0068864_100000472 3300005618 Bacteria 34898
64 Ga0068864_100000533 3300005618 Bacteria 32621
65 Ga0068864_100012289 3300005618 Bacteria 7077
66 Ga0068863_100002271 3300005841 Bacteria 19100
67 Ga0068863_100005428 3300005841 Bacteria 12555
68 Ga0068863_100005478 3300005841 Bacteria 12499
69 Ga0068863_100366164 3300005841 Bacteria 1406
70 Ga0068858_100000098 3300005842 Bacteria 90747
71 Ga0068858_100001321 3300005842 Bacteria 25610
72 Ga0068858_100020066 3300005842 Bacteria 6251
73 Ga0068860_100000580 3300005843 Bacteria 43948
74 Ga0068860_100000583 3300005843 Bacteria 43765
75 Ga0068860_100045145 3300005843 Bacteria 4201
76 Ga0068860_100781381 3300005843 Bacteria 968
77 Ga0068862_100000443 3300005844 Bacteria 45038
78 Ga0068862_100004861 3300005844 Bacteria 11312
79 Ga0068862_100067920 3300005844 Bacteria 3075
80 Ga0068862_100141066 3300005844 Bacteria 2139
81 Ga0075363_100036329 3300006048 Bacteria 2583
82 Ga0075364_10003123 3300006051 Bacteria 9375
83 Ga0075367_10042007 3300006178 Bacteria 2674
84 Ga0075366_10049809 3300006195 Bacteria 2486
85 Ga0075370_10051132 3300006353 Bacteria 2344
86 Ga0075370_10231505 3300006353 Bacteria 1093
87 Ga0068865_100000723 3300006881 Bacteria 18580
88 Ga0097620_100000177 3300006931 Bacteria 62179
89 Ga0097620_100147570 3300006931 Bacteria 2427
90 Ga0105240_10044078 3300009093 Bacteria 5672
91 Ga0105240_10061152 3300009093 Bacteria 4694
92 Ga0105240_10063491 3300009093 Bacteria 4594
93 Ga0105240_10130439 3300009093 Bacteria 3016
94 Ga0105240_10245709 3300009093 Bacteria 2072
95 Ga0105240_10521475 3300009093 Bacteria 1318
96 Ga0105240_10533609 3300009093 Bacteria 1300
97 Ga0105240_10975858 3300009093 Bacteria 908
98 Ga0105245_10098494 3300009098 Bacteria 2702
99 Ga0105247_10126171 3300009101 Bacteria 1663
100 Ga0105247_10197719 3300009101 Bacteria 1349
101 Ga0105242_10443388 3300009176 Bacteria 1222
102 Ga0105248_10003160 3300009177 Bacteria 18236
103 Ga0105248_10006553 3300009177 Bacteria 12766
104 Ga0105248_10056922 3300009177 Bacteria 4387
105 Ga0105248_10416420 3300009177 Bacteria 1513
106 Ga0105237_10228342 3300009545 Bacteria 1862
107 Ga0105238_10185174 3300009551 Bacteria 2058
108 Ga0105238_10351958 3300009551 Bacteria 1462
109 Ga0105238_10673201 3300009551 Bacteria 1046
110 Ga0105249_10004149 3300009553 Bacteria 12511
111 Ga0157370_10201003 3300013104 Bacteria 1849
112 Ga0157370_10316270 3300013104 Bacteria 1441
113 Ga0157370_10366792 3300013104 Bacteria 1327
114 Ga0157369_10323569 3300013105 Bacteria 1603
115 Ga0163162_10052631 3300013306 Bacteria 4089
116 Ga0163162_10307085 3300013306 Bacteria 1719
117 Ga0157372_10015386 3300013307 Bacteria 8199
118 Ga0163163_10005231 3300014325 Bacteria 11189
119 Ga0163163_10031710 3300014325 Bacteria 5103
120 Ga0163163_10032695 3300014325 Bacteria 5026
121 Ga0163163_10107468 3300014325 Bacteria 2817
122 Ga0163163_10908136 3300014325 Bacteria 944
123 Ga0157379_10003393 3300014968 Bacteria 13475
124 Ga0157379_10026633 3300014968 Bacteria 5147
125 Ga0157379_10056257 3300014968 Bacteria 3515
126 Ga0157379_10795801 3300014968 Bacteria 892
127 Ga0213876_10011595 3300021384 Bacteria 4704
128 Ga0213876_10021790 3300021384 Bacteria 3389
129 Ga0209026_1001648 3300025250 Bacteria 9474
130 Ga0209026_1005573 3300025250 Bacteria 3343
131 Ga0209676_1000099 3300025292 Bacteria 230048
132 Ga0209676_1000180 3300025292 Bacteria 148369
133 Ga0209758_1000401 3300025297 Bacteria 74599
134 Ga0209050_1000031 3300025298 Bacteria 458181
135 Ga0209050_1000319 3300025298 Bacteria 96837
136 Ga0209050_1007309 3300025298 Bacteria 6233
137 Ga0209051_1001724 3300025303 Bacteria 17462
138 Ga0209257_1000073 3300025304 Bacteria 325833
139 Ga0209257_1000614 3300025304 Bacteria 58019
140 Ga0209257_1003297 3300025304 Bacteria 14064
141 Ga0209257_1008323 3300025304 Bacteria 5937
142 Ga0207710_10091371 3300025900 Bacteria 1425
143 Ga0207680_10086938 3300025903 Bacteria 1978
144 Ga0207705_10005248 3300025909 Bacteria 9712
145 Ga0207705_10202905 3300025909 Bacteria 1503
146 Ga0207705_10282605 3300025909 Unclassified 1270
147 Ga0207707_10009978 3300025912 Bacteria 8236
148 Ga0207707_10011536 3300025912 Bacteria 7695
149 Ga0207695_10000984 3300025913 Bacteria 50625
150 Ga0207695_10004268 3300025913 Bacteria 19631
151 Ga0207695_10006284 3300025913 Bacteria 15460
152 Ga0207695_10006822 3300025913 Bacteria 14705
153 Ga0207695_10378594 3300025913 Bacteria 1301
154 Ga0207671_10338259 3300025914 Bacteria 1192
155 Ga0207660_10017169 3300025917 Bacteria 4803
156 Ga0207660_10051165 3300025917 Bacteria 2936
157 Ga0207660_10123962 3300025917 Bacteria 1960
158 Ga0207657_10002252 3300025919 Bacteria 20914
159 Ga0207657_10145061 3300025919 Bacteria 1937
160 Ga0207657_10282852 3300025919 Bacteria 1316
161 Ga0207657_10403620 3300025919 Unclassified 1075
162 Ga0207649_10222308 3300025920 Bacteria 1346
163 Ga0207652_10023389 3300025921 Bacteria 5118
164 Ga0207681_10057547 3300025923 Bacteria 2657
165 Ga0207694_10016477 3300025924 Bacteria 5581
166 Ga0207694_10028408 3300025924 Bacteria 4264
167 Ga0207650_10000062 3300025925 Bacteria 149776
168 Ga0207650_10141537 3300025925 Bacteria 1892
169 Ga0207687_10112230 3300025927 Bacteria 2025
170 Ga0207644_10002515 3300025931 Bacteria 11795
171 Ga0207644_10034161 3300025931 Bacteria 3558
172 Ga0207690_10000066 3300025932 Bacteria 91772
173 Ga0207690_10002531 3300025932 Bacteria 11043
174 Ga0207690_10004547 3300025932 Bacteria 8193
175 Ga0207686_10275110 3300025934 Bacteria 1240
176 Ga0207704_10001512 3300025938 Bacteria 10422
177 Ga0207711_10006520 3300025941 Bacteria 9827
178 Ga0207711_10007924 3300025941 Bacteria 8886
179 Ga0207711_10011025 3300025941 Bacteria 7509
180 Ga0207711_10341295 3300025941 Bacteria 1386
181 Ga0207689_10123981 3300025942 Bacteria 2125
182 Ga0207661_10696157 3300025944 Bacteria 935
183 Ga0207679_10055519 3300025945 Bacteria 2920
184 Ga0207667_10010340 3300025949 Bacteria 10911
185 Ga0207667_10021682 3300025949 Bacteria 7117
186 Ga0207667_10033965 3300025949 Bacteria 5480
187 Ga0207667_10037839 3300025949 Bacteria 5157
188 Ga0207667_10106438 3300025949 Bacteria 2893
189 Ga0207651_10102212 3300025960 Bacteria 2130
190 Ga0207712_10002299 3300025961 Bacteria 12407
191 Ga0207668_10000046 3300025972 Bacteria 102051
192 Ga0207668_10002636 3300025972 Bacteria 10493
193 Ga0207668_10003086 3300025972 Bacteria 9766
194 Ga0207668_10007685 3300025972 Bacteria 6416
195 Ga0207658_10000264 3300025986 Bacteria 55170
196 Ga0207658_10006846 3300025986 Bacteria 7767
197 Ga0207658_10437782 3300025986 Bacteria 1155
198 Ga0207703_10000086 3300026035 Bacteria 107307
199 Ga0207703_10003329 3300026035 Bacteria 13494
200 Ga0207639_10038282 3300026041 Bacteria 3567
201 Ga0207639_10058780 3300026041 Bacteria 2959
202 Ga0207639_10220782 3300026041 Bacteria 1637
203 Ga0207639_10265195 3300026041 Bacteria 1504
204 Ga0207639_10348673 3300026041 Bacteria 1322
205 Ga0207702_10043863 3300026078 Bacteria 3757
206 Ga0207641_10000012 3300026088 Bacteria 375486
207 Ga0207641_10001512 3300026088 Bacteria 22780
208 Ga0207641_10023715 3300026088 Bacteria 5055
209 Ga0207641_10130438 3300026088 Bacteria 2256
210 Ga0207641_10614589 3300026088 Bacteria 1065
211 Ga0207676_10000445 3300026095 Bacteria 35000
212 Ga0207676_10000784 3300026095 Bacteria 24801
213 Ga0207676_10026760 3300026095 Bacteria 4290
214 Ga0207676_10233415 3300026095 Bacteria 1646
215 Ga0207676_10557262 3300026095 Bacteria 1096
216 Ga0207676_10909709 3300026095 Bacteria 863
217 Ga0207674_10265813 3300026116 Bacteria 1663
218 Ga0207675_100509555 3300026118 Bacteria 1199
219 Ga0207675_100803510 3300026118 Bacteria 954
220 Ga0207698_10105462 3300026142 Bacteria 2349
221 Ga0207698_10221277 3300026142 Bacteria 1711
222 Ga0207698_10662881 3300026142 Bacteria 1035
223 Ga0209981_1012554 3300027378 Bacteria 1173
224 Ga0268266_10000005 3300028379 Bacteria 1448194
225 Ga0268266_10001455 3300028379 Bacteria 28167
226 Ga0268266_10003594 3300028379 Bacteria 15342
227 Ga0268266_10036647 3300028379 Bacteria 4176
228 Ga0268266_10301322 3300028379 Bacteria 1495
229 Ga0268265_10002810 3300028380 Bacteria 12814
230 Ga0268265_10017676 3300028380 Bacteria 4927
231 Ga0268265_10107120 3300028380 Bacteria 2272
232 Ga0268264_10000046 3300028381 Bacteria 364597
233 Ga0268264_10000358 3300028381 Bacteria 68359
234 Ga0265326_10059363 3300028558 Bacteria 1082
235 Ga0307517_10025834 3300028786 Bacteria 7154
236 Ga0307517_10075828 3300028786 Bacteria 2945
237 Ga0307515_10077312 3300028794 Bacteria 4398
238 Ga0265338_10102268 3300028800 Bacteria 2330
239 Ga0265338_10115021 3300028800 Bacteria 2157
240 Ga0307511_10021241 3300030521 Bacteria 6122
241 Ga0265327_10001725 3300031251 Bacteria 25910
242 Ga0265327_10140043 3300031251 Bacteria 1131
243 Ga0307513_10001008 3300031456 Bacteria 40757
244 Ga0307513_10004817 3300031456 Bacteria 17920
245 Ga0307513_10010331 3300031456 Bacteria 11708
246 Ga0307513_10064828 3300031456 Bacteria 3846
247 Ga0265314_10016607 3300031711 Bacteria 5807
248 Ga0265314_10123510 3300031711 Bacteria 1626
249 Ga0307413_10152336 3300031824 Bacteria 1613
250 Ga0307413_10193923 3300031824 Bacteria 1461
251 Ga0307411_10062581 3300032005 Bacteria 2483
252 Ga0307411_10300309 3300032005 Bacteria 1287
253 Ga0307510_10007774 3300033180 Bacteria 12786
254 Ga0373936_0007727 3300035113 Bacteria 4038
255 Ga0373939_0107530 3300035114 Bacteria 966
256 Ga0373935_0402243 3300035692 Bacteria 984
257 Ga0373927_0001191 3300035695 Bacteria 19735
258 Ga0373925_0000136 3300037068 Bacteria 77912
259 Ga0373925_0033525 3300037068 Bacteria 3784
260 Ga0395899_0000399 3300037312 Bacteria 51229
261 Ga0395899_0093871 3300037312 Bacteria 2172
262 Ga0395900_0000010 3300037418 Bacteria 461364
263 Ga0395900_0023763 3300037418 Bacteria 6270
264 Ga0395900_0402732 3300037418 Bacteria 1332
265 Ga0395898_0001666 3300037466 Bacteria 29798
266 Ga0395898_0106060 3300037466 Bacteria 2695
267 Ga0395898_0147888 3300037466 Bacteria 2248
268 Ga0395905_0004354 3300037471 Bacteria 14743
269 Ga0395905_0328576 3300037471 Bacteria 1419
270 Ga0395905_0530967 3300037471 Bacteria 1077
271 Ga0395905_0892213 3300037471 Bacteria 792
272 Ga0395901_0000007 3300038443 Bacteria 497408
273 Ga0395901_0216734 3300038443 Bacteria 2002
274 Ga0395901_0354196 3300038443 Bacteria 1514
275 Ga0395901_0452734 3300038443 Bacteria 1312
276 Ga0436365_0482828 3300039437 Bacteria 1832
277 Ga0436365_1485304 3300039437 Bacteria 4687
278 Ga0466964_0072816 3300044706 Bacteria 1457
279 Ga0466957_0492522 3300044842 Bacteria 849
280 Ga0495629_0258424 3300046459 Bacteria 1197
281 Ga0495638_0000764 3300046460 Bacteria 34208
282 Ga0495583_0056513 3300046506 Bacteria 1769
283 Ga0495610_0005615 3300046512 Bacteria 8854
284 Ga0495616_0246043 3300046513 Bacteria 770
285 Ga0495643_0056489 3300046522 Bacteria 2095
286 Ga0495648_0000399 3300046524 Bacteria 47763
287 Ga0495654_0094396 3300046530 Bacteria 1384
288 Ga0495597_0002439 3300046542 Bacteria 11798
289 Ga0495622_0004437 3300046557 Bacteria 6513
290 Ga0495668_0009345 3300046616 Bacteria 6028
291 Ga0495668_0009746 3300046616 Bacteria 5869
292 Ga0495611_0041673 3300046648 Bacteria 2048
293 Ga0495625_0063542 3300046660 Bacteria 2606
294 Ga0495625_0105477 3300046660 Bacteria 1930
295 Ga0495669_0000001 3300046684 Bacteria 291866
296 Ga0495669_0000267 3300046684 Bacteria 29896
297 Ga0495636_0018718 3300047318 Bacteria 2779
298 Ga0495672_0039552 3300047320 Bacteria 2867
299 Ga0495677_0037951 3300047445 Bacteria 1760
300 Ga0495673_0000403 3300047469 Bacteria 50650
301 Ga0495681_0082178 3300047470 Bacteria 1436
302 Ga0495686_0011524 3300047472 Bacteria 6228
303 Ga0496101_0187443 3300048904 Bacteria 1595
304 Ga0496102_0036426 3300048905 Bacteria 4432
305 Ga0496102_0080838 3300048905 Bacteria 2995
306 Ga0496106_0216673 3300048909 Bacteria 1526
307 Ga0496108_0017868 3300048911 Bacteria 5801
308 Ga0496109_0094610 3300048912 Bacteria 2766
309 Ga0496112_0027122 3300048915 Bacteria 5521
310 Ga0496112_0069222 3300048915 Bacteria 3486
311 Ga0496113_0027742 3300048916 Bacteria 4063
312 Ga0496115_0000396 3300048918 Bacteria 35918
313 Ga0496115_0000643 3300048918 Bacteria 26252
314 Ga0496115_0238866 3300048918 Bacteria 1498
315 Ga0496117_0031239 3300048920 Bacteria 4070
316 Ga0496118_0014843 3300048921 Bacteria 7258
317 Ga0496119_0026271 3300048922 Bacteria 4041
318 Ga0496121_0000009 3300048924 Bacteria 836971
319 Ga0496121_0352884 3300048924 Bacteria 979
320 Ga0496124_0011339 3300048927 Bacteria 8914
321 Ga0496125_0096949 3300048928 Bacteria 2187
322 Ga0501047_0002124 3300049581 Bacteria 18973
323 Ga0501047_0190243 3300049581 Bacteria 1916
324 Ga0501257_057749 3300049686 Bacteria 977
325 nmdc:mga03n38_467122_c1 3300050490 Bacteria 704
326 nmdc:mga00v17_2502_c1 3300050491 Bacteria 9409
327 nmdc:mga0yw44_520405_c1 3300050492 Bacteria 807
328 nmdc:mga0k408_31412_c1 3300050493 Bacteria 3032
329 nmdc:mga06z11_9004_c1 3300050494 Bacteria 4192
330 nmdc:mga07m45_150997_c1 3300050496 Bacteria 1347
331 nmdc:mga07m45_2641_c1 3300050496 Bacteria 8439
332 nmdc:mga07m45_66836_c1 3300050496 Bacteria 2043
333 nmdc:mga0sz30_2139_c1 3300050516 Bacteria 7060
334 Ga0500578_0000080 3300053086 Bacteria 106387
335 Ga0500643_003867 3300053087 Bacteria 6970
336 Ga0500643_004110 3300053087 Bacteria 6702
337 Ga0500644_0000218 3300053088 Bacteria 33235
338 Ga0500562_000163 3300053108 Bacteria 18798
339 Ga0500594_0000587 3300053118 Bacteria 7792
340 Ga0500595_006788 3300053119 Bacteria 4820
341 Ga0500595_067270 3300053119 Bacteria 1069
342 Ga0500608_000062 3300053122 Bacteria 46850
343 Ga0500559_0045585 3300053136 Bacteria 1920
344 Ga0500564_000127 3300053138 Bacteria 19327
345 Ga0500622_0000812 3300053156 Bacteria 26774
346 Ga0500645_011450 3300053730 Bacteria 2896

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100067920 Ga0068862_1000679202 188
2 3300025920 Ga0207649_10222308 Ga0207649_102223082 192
3 3300031251 Ga0265327_10001725 Ga0265327_1000172512 192
4 3300003791 Ga0055530_10004835 Ga0055530_100048356 193
5 3300003794 Ga0055531_10015028 Ga0055531_100150285 193
6 3300025298 Ga0209050_1000031 Ga0209050_1000031226 193
7 3300025304 Ga0209257_1000073 Ga0209257_1000073154 193
8 3300009176 Ga0105242_10443388 Ga0105242_104433882 194
9 3300021384 Ga0213876_10021790 Ga0213876_100217903 194
10 3300025934 Ga0207686_10275110 Ga0207686_102751102 194
11 3300026041 Ga0207639_10265195 Ga0207639_102651952 194
12 3300039437 Ga0436365_0482828 Ga0436365_0482828_452_1186 194
13 3300038443 Ga0395901_0452734 Ga0395901_0452734_544_1221 197
14 3300053087 Ga0500643_004110 Ga0500643_004110_5438_6130 197
15 3300009177 Ga0105248_10416420 Ga0105248_104164202 198
16 3300037471 Ga0395905_0892213 Ga0395905_0892213_26_700 198
17 3300009093 Ga0105240_10975858 Ga0105240_109758582 199
18 3300025297 Ga0209758_1000401 Ga0209758_100040158 200
19 3300031824 Ga0307413_10152336 Ga0307413_101523361 200
20 3300032005 Ga0307411_10300309 Ga0307411_103003092 200
21 3300050492 nmdc:mga0yw44_520405_c1 nmdc:mga0yw44_520405_c1_131_778 200
22 3300005347 Ga0070668_100001563 Ga0070668_10000156311 202
23 3300005548 Ga0070665_100006854 Ga0070665_1000068547 202
24 3300005844 Ga0068862_100141066 Ga0068862_1001410662 202
25 3300009101 Ga0105247_10126171 Ga0105247_101261712 202
26 3300025900 Ga0207710_10091371 Ga0207710_100913712 202
27 3300025972 Ga0207668_10000046 Ga0207668_1000004670 202
28 3300026088 Ga0207641_10614589 Ga0207641_106145892 202
29 3300028379 Ga0268266_10001455 Ga0268266_100014558 202
30 3300028380 Ga0268265_10107120 Ga0268265_101071202 202
31 3300005618 Ga0068864_100012289 Ga0068864_1000122894 208
32 3300014968 Ga0157379_10795801 Ga0157379_107958011 208
33 3300026095 Ga0207676_10026760 Ga0207676_100267603 208
34 3300046684 Ga0495669_0000267 Ga0495669_0000267_22166_22861 209
35 3300005347 Ga0070668_100001106 Ga0070668_10000110622 210
36 3300005617 Ga0068859_100147562 Ga0068859_1001475622 210
37 3300005843 Ga0068860_100000583 Ga0068860_10000058322 210
38 3300005844 Ga0068862_100004861 Ga0068862_1000048618 210
39 3300006931 Ga0097620_100147570 Ga0097620_1001475704 210
40 3300009177 Ga0105248_10056922 Ga0105248_100569221 210
41 3300025941 Ga0207711_10011025 Ga0207711_100110251 210
42 3300025972 Ga0207668_10007685 Ga0207668_100076852 210
43 3300028380 Ga0268265_10017676 Ga0268265_100176765 210
44 3300028381 Ga0268264_10000046 Ga0268264_1000004622 210
45 3300037068 Ga0373925_0033525 Ga0373925_0033525_324_983 210
46 3300048905 Ga0496102_0080838 Ga0496102_0080838_2116_2811 210
47 3300048920 Ga0496117_0031239 Ga0496117_0031239_1118_1813 210
48 3300048921 Ga0496118_0014843 Ga0496118_0014843_674_1369 210
49 3300048922 Ga0496119_0026271 Ga0496119_0026271_248_943 210
50 3300048924 Ga0496121_0000009 Ga0496121_0000009_763178_763873 210
51 3300049686 Ga0501257_057749 Ga0501257_057749_204_875 210
52 3300005329 Ga0070683_100462369 Ga0070683_1004623692 211
53 3300005563 Ga0068855_100268511 Ga0068855_1002685112 211
54 3300009093 Ga0105240_10130439 Ga0105240_101304394 211
55 3300025944 Ga0207661_10696157 Ga0207661_106961571 211
56 3300025949 Ga0207667_10037839 Ga0207667_100378394 211
57 3300030521 Ga0307511_10021241 Ga0307511_100212417 211
58 3300050490 nmdc:mga03n38_467122_c1 nmdc:mga03n38_467122_c1_22_669 211
59 3300053119 Ga0500595_067270 Ga0500595_067270_148_795 211
60 3300004625 Ga0055543_1012685 Ga0055543_10126852 212
61 3300005262 Ga0065165_1000029 Ga0065165_1000029174 212
62 3300005262 Ga0065165_1016253 Ga0065165_10162533 212
63 3300025250 Ga0209026_1001648 Ga0209026_10016483 212
64 3300025304 Ga0209257_1003297 Ga0209257_10032975 212
65 3300031824 Ga0307413_10193923 Ga0307413_101939232 212
66 3300032005 Ga0307411_10062581 Ga0307411_100625812 212
67 3300046513 Ga0495616_0246043 Ga0495616_0246043_61_711 212
68 3300047472 Ga0495686_0011524 Ga0495686_0011524_3294_3944 212
69 3300053730 Ga0500645_011450 Ga0500645_011450_1462_2112 212
70 3300006048 Ga0075363_100036329 Ga0075363_1000363294 213
71 3300006195 Ga0075366_10049809 Ga0075366_100498092 213
72 3300006353 Ga0075370_10051132 Ga0075370_100511322 213
73 3300050493 nmdc:mga0k408_31412_c1 nmdc:mga0k408_31412_c1_1131_1814 213
74 3300050496 nmdc:mga07m45_2641_c1 nmdc:mga07m45_2641_c1_3346_4029 213
75 3300031456 Ga0307513_10001008 Ga0307513_1000100823 214
76 3300053087 Ga0500643_003867 Ga0500643_003867_6021_6779 214
77 3300005338 Ga0068868_100337780 Ga0068868_1003377802 215
78 3300005355 Ga0070671_100087094 Ga0070671_1000870942 215
79 3300005355 Ga0070671_100205944 Ga0070671_1002059442 215
80 3300005364 Ga0070673_100253397 Ga0070673_1002533972 215
81 3300005548 Ga0070665_100022780 Ga0070665_1000227802 215
82 3300005548 Ga0070665_100836033 Ga0070665_1008360331 215
83 3300005564 Ga0070664_100090930 Ga0070664_1000909303 215
84 3300005843 Ga0068860_100781381 Ga0068860_1007813812 215
85 3300014968 Ga0157379_10056257 Ga0157379_100562572 215
86 3300025903 Ga0207680_10086938 Ga0207680_100869382 215
87 3300025931 Ga0207644_10034161 Ga0207644_100341614 215
88 3300025941 Ga0207711_10007924 Ga0207711_100079244 215
89 3300025941 Ga0207711_10341295 Ga0207711_103412952 215
90 3300025945 Ga0207679_10055519 Ga0207679_100555192 215
91 3300025960 Ga0207651_10102212 Ga0207651_101022122 215
92 3300026095 Ga0207676_10557262 Ga0207676_105572621 215
93 3300028379 Ga0268266_10036647 Ga0268266_100366474 215
94 3300028786 Ga0307517_10075828 Ga0307517_100758283 215
95 3300031456 Ga0307513_10010331 Ga0307513_100103312 215
96 3300035114 Ga0373939_0107530 Ga0373939_0107530_49_747 215
97 3300046506 Ga0495583_0056513 Ga0495583_0056513_682_1377 215
98 3300046648 Ga0495611_0041673 Ga0495611_0041673_762_1457 215
99 3300046660 Ga0495625_0105477 Ga0495625_0105477_1211_1906 215
100 3300047318 Ga0495636_0018718 Ga0495636_0018718_327_1022 215
101 3300047470 Ga0495681_0082178 Ga0495681_0082178_341_1036 215
102 3300048904 Ga0496101_0187443 Ga0496101_0187443_369_1064 215
103 3300048905 Ga0496102_0036426 Ga0496102_0036426_1139_1834 215
104 3300048909 Ga0496106_0216673 Ga0496106_0216673_256_954 215
105 3300048911 Ga0496108_0017868 Ga0496108_0017868_3979_4674 215
106 3300048912 Ga0496109_0094610 Ga0496109_0094610_1926_2621 215
107 3300048915 Ga0496112_0069222 Ga0496112_0069222_578_1273 215
108 3300048916 Ga0496113_0027742 Ga0496113_0027742_1228_1923 215
109 3300048918 Ga0496115_0000396 Ga0496115_0000396_6813_7529 215
110 3300005336 Ga0070680_100134195 Ga0070680_1001341953 216
111 3300005336 Ga0070680_100354541 Ga0070680_1003545412 216
112 3300005458 Ga0070681_10009895 Ga0070681_100098956 216
113 3300005530 Ga0070679_100012066 Ga0070679_1000120665 216
114 3300005539 Ga0068853_100598242 Ga0068853_1005982422 216
115 3300005563 Ga0068855_100114040 Ga0068855_1001140402 216
116 3300005563 Ga0068855_100122502 Ga0068855_1001225021 216
117 3300005563 Ga0068855_100193725 Ga0068855_1001937252 216
118 3300005614 Ga0068856_100713539 Ga0068856_1007135391 216
119 3300005616 Ga0068852_100053018 Ga0068852_1000530185 216
120 3300005618 Ga0068864_100000472 Ga0068864_10000047226 216
121 3300005841 Ga0068863_100005428 Ga0068863_1000054288 216
122 3300005841 Ga0068863_100366164 Ga0068863_1003661642 216
123 3300005842 Ga0068858_100000098 Ga0068858_10000009864 216
124 3300009093 Ga0105240_10044078 Ga0105240_100440781 216
125 3300009093 Ga0105240_10061152 Ga0105240_100611525 216
126 3300009093 Ga0105240_10521475 Ga0105240_105214751 216
127 3300009093 Ga0105240_10533609 Ga0105240_105336092 216
128 3300009545 Ga0105237_10228342 Ga0105237_102283422 216
129 3300009551 Ga0105238_10185174 Ga0105238_101851742 216
130 3300013104 Ga0157370_10201003 Ga0157370_102010032 216
131 3300013104 Ga0157370_10366792 Ga0157370_103667922 216
132 3300013105 Ga0157369_10323569 Ga0157369_103235692 216
133 3300013307 Ga0157372_10015386 Ga0157372_100153864 216
134 3300014325 Ga0163163_10107468 Ga0163163_101074683 216
135 3300025912 Ga0207707_10009978 Ga0207707_100099785 216
136 3300025913 Ga0207695_10004268 Ga0207695_100042685 216
137 3300025913 Ga0207695_10006822 Ga0207695_100068226 216
138 3300025913 Ga0207695_10378594 Ga0207695_103785942 216
139 3300025917 Ga0207660_10051165 Ga0207660_100511653 216
140 3300025917 Ga0207660_10123962 Ga0207660_101239622 216
141 3300025924 Ga0207694_10016477 Ga0207694_100164774 216
142 3300025924 Ga0207694_10028408 Ga0207694_100284082 216
143 3300025949 Ga0207667_10010340 Ga0207667_100103407 216
144 3300025949 Ga0207667_10033965 Ga0207667_100339653 216
145 3300025949 Ga0207667_10106438 Ga0207667_101064382 216
146 3300026035 Ga0207703_10000086 Ga0207703_1000008679 216
147 3300026041 Ga0207639_10348673 Ga0207639_103486732 216
148 3300026078 Ga0207702_10043863 Ga0207702_100438633 216
149 3300026088 Ga0207641_10000012 Ga0207641_1000001240 216
150 3300026088 Ga0207641_10130438 Ga0207641_101304383 216
151 3300026095 Ga0207676_10000445 Ga0207676_1000044525 216
152 3300026142 Ga0207698_10105462 Ga0207698_101054622 216
153 3300026142 Ga0207698_10662881 Ga0207698_106628811 216
154 3300028786 Ga0307517_10025834 Ga0307517_100258345 216
155 3300031456 Ga0307513_10064828 Ga0307513_100648282 216
156 3300033180 Ga0307510_10007774 Ga0307510_100077743 216
157 3300037312 Ga0395899_0000399 Ga0395899_0000399_27104_27775 216
158 3300037312 Ga0395899_0093871 Ga0395899_0093871_1347_2024 216
159 3300037418 Ga0395900_0000010 Ga0395900_0000010_288615_289286 216
160 3300037466 Ga0395898_0001666 Ga0395898_0001666_6142_6813 216
161 3300037466 Ga0395898_0147888 Ga0395898_0147888_1346_2023 216
162 3300037471 Ga0395905_0004354 Ga0395905_0004354_8899_9570 216
163 3300038443 Ga0395901_0000007 Ga0395901_0000007_372979_373650 216
164 3300038443 Ga0395901_0354196 Ga0395901_0354196_202_873 216
165 3300046522 Ga0495643_0056489 Ga0495643_0056489_394_1092 216
166 3300046542 Ga0495597_0002439 Ga0495597_0002439_7886_8584 216
167 3300046557 Ga0495622_0004437 Ga0495622_0004437_4617_5315 216
168 3300046616 Ga0495668_0009345 Ga0495668_0009345_2926_3624 216
169 3300005327 Ga0070658_10221900 Ga0070658_102219002 217
170 3300005327 Ga0070658_10333025 Ga0070658_103330252 217
171 3300005327 Ga0070658_10358961 Ga0070658_103589612 217
172 3300005339 Ga0070660_100183538 Ga0070660_1001835382 217
173 3300005339 Ga0070660_100371331 Ga0070660_1003713311 217
174 3300005366 Ga0070659_100001844 Ga0070659_1000018441 217
175 3300005366 Ga0070659_100001909 Ga0070659_10000190910 217
176 3300005458 Ga0070681_10009284 Ga0070681_100092844 217
177 3300005539 Ga0068853_100053469 Ga0068853_1000534693 217
178 3300005539 Ga0068853_100079096 Ga0068853_1000790962 217
179 3300005539 Ga0068853_100199383 Ga0068853_1001993833 217
180 3300005548 Ga0070665_100000248 Ga0070665_1000002488 217
181 3300009093 Ga0105240_10063491 Ga0105240_100634912 217
182 3300009093 Ga0105240_10245709 Ga0105240_102457093 217
183 3300009098 Ga0105245_10098494 Ga0105245_100984942 217
184 3300009177 Ga0105248_10006553 Ga0105248_100065538 217
185 3300009551 Ga0105238_10351958 Ga0105238_103519582 217
186 3300013104 Ga0157370_10316270 Ga0157370_103162702 217
187 3300014325 Ga0163163_10031710 Ga0163163_100317102 217
188 3300014325 Ga0163163_10032695 Ga0163163_100326953 217
189 3300025909 Ga0207705_10005248 Ga0207705_100052488 217
190 3300025909 Ga0207705_10202905 Ga0207705_102029052 217
191 3300025909 Ga0207705_10282605 Ga0207705_102826051 217
192 3300025912 Ga0207707_10011536 Ga0207707_100115362 217
193 3300025913 Ga0207695_10000984 Ga0207695_1000098430 217
194 3300025913 Ga0207695_10006284 Ga0207695_100062844 217
195 3300025917 Ga0207660_10017169 Ga0207660_100171692 217
196 3300025919 Ga0207657_10002252 Ga0207657_1000225221 217
197 3300025919 Ga0207657_10145061 Ga0207657_101450612 217
198 3300025919 Ga0207657_10282852 Ga0207657_102828522 217
199 3300025919 Ga0207657_10403620 Ga0207657_104036202 217
200 3300025921 Ga0207652_10023389 Ga0207652_100233896 217
201 3300025927 Ga0207687_10112230 Ga0207687_101122302 217
202 3300025932 Ga0207690_10000066 Ga0207690_1000006638 217
203 3300025932 Ga0207690_10004547 Ga0207690_100045477 217
204 3300025949 Ga0207667_10021682 Ga0207667_100216828 217
205 3300026041 Ga0207639_10058780 Ga0207639_100587803 217
206 3300026041 Ga0207639_10220782 Ga0207639_102207822 217
207 3300026095 Ga0207676_10909709 Ga0207676_109097091 217
208 3300026116 Ga0207674_10265813 Ga0207674_102658132 217
209 3300026142 Ga0207698_10221277 Ga0207698_102212772 217
210 3300027378 Ga0209981_1012554 Ga0209981_10125541 217
211 3300028379 Ga0268266_10000005 Ga0268266_100000051198 217
212 3300031251 Ga0265327_10140043 Ga0265327_101400431 217
213 3300035113 Ga0373936_0007727 Ga0373936_0007727_126_803 217
214 3300035695 Ga0373927_0001191 Ga0373927_0001191_542_1219 217
215 3300037068 Ga0373925_0000136 Ga0373925_0000136_5474_6151 217
216 3300037418 Ga0395900_0023763 Ga0395900_0023763_533_1225 217
217 3300037418 Ga0395900_0402732 Ga0395900_0402732_25_708 217
218 3300037466 Ga0395898_0106060 Ga0395898_0106060_308_1000 217
219 3300037471 Ga0395905_0328576 Ga0395905_0328576_288_980 217
220 3300037471 Ga0395905_0530967 Ga0395905_0530967_14_688 217
221 3300038443 Ga0395901_0216734 Ga0395901_0216734_1070_1762 217
222 3300048918 Ga0496115_0000643 Ga0496115_0000643_18260_18964 217
223 3300049581 Ga0501047_0002124 Ga0501047_0002124_2128_2796 217
224 3300049581 Ga0501047_0190243 Ga0501047_0190243_139_822 217
225 3300005367 Ga0070667_100014536 Ga0070667_1000145366 218
226 3300006881 Ga0068865_100000723 Ga0068865_1000007236 218
227 3300013306 Ga0163162_10307085 Ga0163162_103070852 218
228 3300014325 Ga0163163_10908136 Ga0163163_109081362 218
229 3300025938 Ga0207704_10001512 Ga0207704_1000151212 218
230 3300025986 Ga0207658_10006846 Ga0207658_100068468 218
231 3300026095 Ga0207676_10233415 Ga0207676_102334152 218
232 3300048915 Ga0496112_0027122 Ga0496112_0027122_3781_4485 218
233 3300053108 Ga0500562_000163 Ga0500562_000163_15690_16361 218
234 iso_pu_bacteria 2643221598 2644002097 218
235 3300025250 Ga0209026_1005573 Ga0209026_10055732 219
236 3300026118 Ga0207675_100509555 Ga0207675_1005095552 220
237 3300005331 Ga0070670_100000050 Ga0070670_10000005019 221
238 3300005347 Ga0070668_100001996 Ga0070668_10000199614 221
239 3300005347 Ga0070668_100032853 Ga0070668_1000328533 221
240 3300005353 Ga0070669_100000576 Ga0070669_10000057625 221
241 3300005355 Ga0070671_100000798 Ga0070671_10000079820 221
242 3300005367 Ga0070667_100000140 Ga0070667_10000014040 221
243 3300005367 Ga0070667_100002966 Ga0070667_1000029663 221
244 3300005367 Ga0070667_100372466 Ga0070667_1003724662 221
245 3300005457 Ga0070662_100212105 Ga0070662_1002121052 221
246 3300005548 Ga0070665_100007821 Ga0070665_1000078213 221
247 3300005548 Ga0070665_100044262 Ga0070665_1000442622 221
248 3300005617 Ga0068859_100000177 Ga0068859_10000017725 221
249 3300005618 Ga0068864_100000533 Ga0068864_10000053317 221
250 3300005841 Ga0068863_100002271 Ga0068863_10000227119 221
251 3300005841 Ga0068863_100005478 Ga0068863_1000054782 221
252 3300005842 Ga0068858_100001321 Ga0068858_10000132113 221
253 3300005842 Ga0068858_100020066 Ga0068858_1000200665 221
254 3300005843 Ga0068860_100000580 Ga0068860_10000058018 221
255 3300005843 Ga0068860_100045145 Ga0068860_1000451454 221
256 3300005844 Ga0068862_100000443 Ga0068862_10000044329 221
257 3300006051 Ga0075364_10003123 Ga0075364_100031238 221
258 3300006178 Ga0075367_10042007 Ga0075367_100420071 221
259 3300006353 Ga0075370_10231505 Ga0075370_102315052 221
260 3300006931 Ga0097620_100000177 Ga0097620_10000017725 221
261 3300009101 Ga0105247_10197719 Ga0105247_101977191 221
262 3300009177 Ga0105248_10003160 Ga0105248_1000316011 221
263 3300009551 Ga0105238_10673201 Ga0105238_106732011 221
264 3300009553 Ga0105249_10004149 Ga0105249_1000414911 221
265 3300013306 Ga0163162_10052631 Ga0163162_100526313 221
266 3300014325 Ga0163163_10005231 Ga0163163_100052312 221
267 3300014968 Ga0157379_10003393 Ga0157379_100033936 221
268 3300014968 Ga0157379_10026633 Ga0157379_100266333 221
269 3300025914 Ga0207671_10338259 Ga0207671_103382592 221
270 3300025923 Ga0207681_10057547 Ga0207681_100575474 221
271 3300025925 Ga0207650_10000062 Ga0207650_10000062131 221
272 3300025925 Ga0207650_10141537 Ga0207650_101415372 221
273 3300025931 Ga0207644_10002515 Ga0207644_100025156 221
274 3300025941 Ga0207711_10006520 Ga0207711_100065208 221
275 3300025961 Ga0207712_10002299 Ga0207712_100022994 221
276 3300025972 Ga0207668_10002636 Ga0207668_1000263611 221
277 3300025972 Ga0207668_10003086 Ga0207668_100030864 221
278 3300025986 Ga0207658_10000264 Ga0207658_1000026440 221
279 3300026035 Ga0207703_10003329 Ga0207703_100033294 221
280 3300026088 Ga0207641_10001512 Ga0207641_1000151222 221
281 3300026088 Ga0207641_10023715 Ga0207641_100237155 221
282 3300026095 Ga0207676_10000784 Ga0207676_100007845 221
283 3300026118 Ga0207675_100803510 Ga0207675_1008035102 221
284 3300028379 Ga0268266_10003594 Ga0268266_1000359418 221
285 3300028379 Ga0268266_10301322 Ga0268266_103013221 221
286 3300028380 Ga0268265_10002810 Ga0268265_100028108 221
287 3300028381 Ga0268264_10000358 Ga0268264_1000035819 221
288 3300031456 Ga0307513_10004817 Ga0307513_1000481714 221
289 3300044842 Ga0466957_0492522 Ga0466957_0492522_49_747 221
290 3300046459 Ga0495629_0258424 Ga0495629_0258424_414_1112 221
291 3300047320 Ga0495672_0039552 Ga0495672_0039552_1022_1708 221
292 3300050491 nmdc:mga00v17_2502_c1 nmdc:mga00v17_2502_c1_3043_3735 221
293 3300050494 nmdc:mga06z11_9004_c1 nmdc:mga06z11_9004_c1_18_710 221
294 3300050496 nmdc:mga07m45_66836_c1 nmdc:mga07m45_66836_c1_1188_1880 221
295 3300053119 Ga0500595_006788 Ga0500595_006788_3886_4584 221
296 3300005334 Ga0068869_100344141 Ga0068869_1003441412 224
297 3300005539 Ga0068853_100094286 Ga0068853_1000942861 224
298 3300025942 Ga0207689_10123981 Ga0207689_101239812 224
299 3300026041 Ga0207639_10038282 Ga0207639_100382823 224
300 3300035692 Ga0373935_0402243 Ga0373935_0402243_73_765 224
301 3300046684 Ga0495669_0000001 Ga0495669_0000001_273155_273862 224
302 3300047445 Ga0495677_0037951 Ga0495677_0037951_593_1300 224
303 3300005367 Ga0070667_100265782 Ga0070667_1002657821 225
304 3300025986 Ga0207658_10437782 Ga0207658_104377822 225
305 3300028800 Ga0265338_10115021 Ga0265338_101150213 225
306 3300028558 Ga0265326_10059363 Ga0265326_100593631 226
307 3300028800 Ga0265338_10102268 Ga0265338_101022683 226
308 3300031711 Ga0265314_10016607 Ga0265314_100166074 226
309 3300048918 Ga0496115_0238866 Ga0496115_0238866_19_726 226
310 3300021384 Ga0213876_10011595 Ga0213876_100115953 227
311 3300039437 Ga0436365_1485304 Ga0436365_1485304_1114_1815 227
312 3300005366 Ga0070659_100001047 Ga0070659_10000104722 232
313 3300025932 Ga0207690_10002531 Ga0207690_100025314 232
314 3300031711 Ga0265314_10123510 Ga0265314_101235102 232
315 iso_pu_bacteria 2582581279 2585145827 233
316 iso_pu_bacteria 2643221642 2644234867 233
317 iso_pu_bacteria 2857504554 2857509413 233
318 iso_pu_bacteria 2884960567 2884963026 233
319 iso_pu_bacteria 2928531327 2928532450 233
320 3300005339 Ga0070660_100539820 Ga0070660_1005398202 234
321 3300003781 Ga0055536_1010997 Ga0055536_10109972 237
322 3300003781 Ga0055536_1011545 Ga0055536_10115452 237
323 3300003791 Ga0055530_10010169 Ga0055530_100101692 237
324 3300003794 Ga0055531_10002894 Ga0055531_100028942 237
325 3300025292 Ga0209676_1000099 Ga0209676_100009948 237
326 3300025292 Ga0209676_1000180 Ga0209676_100018059 237
327 3300025298 Ga0209050_1000319 Ga0209050_100031963 237
328 3300025298 Ga0209050_1007309 Ga0209050_10073094 237
329 3300025303 Ga0209051_1001724 Ga0209051_100172412 237
330 3300025304 Ga0209257_1000614 Ga0209257_10006144 237
331 3300025304 Ga0209257_1008323 Ga0209257_10083235 237
332 3300028794 Ga0307515_10077312 Ga0307515_100773122 237
333 3300044706 Ga0466964_0072816 Ga0466964_0072816_454_1167 237
334 3300046460 Ga0495638_0000764 Ga0495638_0000764_3767_4480 237
335 3300046512 Ga0495610_0005615 Ga0495610_0005615_1257_1970 237
336 3300046524 Ga0495648_0000399 Ga0495648_0000399_40790_41503 237
337 3300046530 Ga0495654_0094396 Ga0495654_0094396_352_1065 237
338 3300046616 Ga0495668_0009746 Ga0495668_0009746_4594_5307 237
339 3300046660 Ga0495625_0063542 Ga0495625_0063542_1254_1967 237
340 3300047469 Ga0495673_0000403 Ga0495673_0000403_30838_31551 237
341 3300048924 Ga0496121_0352884 Ga0496121_0352884_197_910 237
342 3300048927 Ga0496124_0011339 Ga0496124_0011339_7688_8401 237
343 3300048928 Ga0496125_0096949 Ga0496125_0096949_989_1702 237
344 3300050496 nmdc:mga07m45_150997_c1 nmdc:mga07m45_150997_c1_531_1244 237
345 3300050516 nmdc:mga0sz30_2139_c1 nmdc:mga0sz30_2139_c1_6289_7002 237
346 3300053086 Ga0500578_0000080 Ga0500578_0000080_61440_62153 237
347 3300053088 Ga0500644_0000218 Ga0500644_0000218_2297_3010 237
348 3300053118 Ga0500594_0000587 Ga0500594_0000587_2001_2714 237
349 3300053122 Ga0500608_000062 Ga0500608_000062_35366_36079 237
350 3300053136 Ga0500559_0045585 Ga0500559_0045585_1129_1842 237
351 3300053138 Ga0500564_000127 Ga0500564_000127_11403_12116 237
352 3300053156 Ga0500622_0000812 Ga0500622_0000812_11762_12475 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

35

193

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vje-assembly2.cif.gz_B crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a 0.7707 7 235
2zcr-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 0.7694 7 235
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.7661 7 235
3adz-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp 0.7565 7 235
3lgz-assembly1.cif.gz_B crystal structure of dehydrosqualene synthase y129a from s. aureus complexed with presqualene pyrophosphate 0.7536 7 235
ID Description Score Start End Superfamily
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8884 7 216 1.10.600.10
af_B4FPS7_5_269_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.856 7 216 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8499 7 228 1.10.600.10
af_Q54E48_68_332_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8481 7 228 1.10.600.10
3w7fA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8025 7 235 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A0H3CB12-F1-model_v4 Phytoene/squalene synthase family protein 0.9984 1 237 GO:0005737
GO:0009058
GO:0043231
AF-A0A2D2AX03-F1-model_v4 Phytoene synthase 0.964 1 237 GO:0009058
AF-A0A2D2AX03-F1-model_v4 Phytoene synthase 0.9596 1 237 GO:0009058
AF-A0A4Q3S3Q2-F1-model_v4 Phytoene/squalene synthase family protein 0.9524 7 237 GO:0009058
AF-A0A6B3UQR3-F1-model_v4 Squalene/phytoene synthase family protein 0.9444 1 166 GO:0005737
GO:0009058
GO:0043231

Feature Viewer

pLDDT pTM Quality
94.53 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map