F419026
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 184 | 346 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10107468|Ga0163163_101074683 |
| Length | 247 |
| Sequence | LKIKARLNWRAFLYPAMIDDAPMDAPELDDLDDLVRRVDPDRWLSSRFVGDAHARADVLAIYAYDHELARAPRVTSNPLMGEIRLTWWREALDEIFEGRPVRAHPTAQALADVVLRRGLAREPLETMIDARYRELDPTPMRENELLDWARDTGGLAAQVAAQILDPASDAKLALAGGAAWALGKKLADRPDLRPTFLRVIHAARGASRALSVAAFPAVAHAALAGRPSKNDFSRRLRLTVAVARGKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 3 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 4 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 5 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 6 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 109 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 118 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 167 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 168 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 169 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 170 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 171 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 172 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 174 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 175 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 176 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 178 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 179 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 180 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 181 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 182 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 184 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 0 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.64 |
| Nodule | 0 |
| Rhizoplane | 3.41 |
| Rhizosphere | 75.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1010997 | 3300003781 | Bacteria | 3522 |
| 2 | Ga0055536_1011545 | 3300003781 | Bacteria | 3374 |
| 3 | Ga0055530_10004835 | 3300003791 | Bacteria | 6738 |
| 4 | Ga0055530_10010169 | 3300003791 | Bacteria | 3514 |
| 5 | Ga0055531_10002894 | 3300003794 | Bacteria | 11174 |
| 6 | Ga0055531_10015028 | 3300003794 | Bacteria | 3440 |
| 7 | Ga0055543_1012685 | 3300004625 | Bacteria | 1685 |
| 8 | Ga0065165_1000029 | 3300005262 | Bacteria | 220342 |
| 9 | Ga0065165_1016253 | 3300005262 | Bacteria | 2795 |
| 10 | Ga0070658_10221900 | 3300005327 | Bacteria | 1599 |
| 11 | Ga0070658_10333025 | 3300005327 | Bacteria | 1297 |
| 12 | Ga0070658_10358961 | 3300005327 | Bacteria | 1248 |
| 13 | Ga0070683_100462369 | 3300005329 | Bacteria | 1211 |
| 14 | Ga0070670_100000050 | 3300005331 | Bacteria | 132470 |
| 15 | Ga0068869_100344141 | 3300005334 | Bacteria | 1214 |
| 16 | Ga0070680_100134195 | 3300005336 | Bacteria | 2072 |
| 17 | Ga0070680_100354541 | 3300005336 | Bacteria | 1248 |
| 18 | Ga0068868_100337780 | 3300005338 | Unclassified | 1287 |
| 19 | Ga0070660_100183538 | 3300005339 | Bacteria | 1694 |
| 20 | Ga0070660_100371331 | 3300005339 | Bacteria | 1180 |
| 21 | Ga0070660_100539820 | 3300005339 | Bacteria | 972 |
| 22 | Ga0070668_100001106 | 3300005347 | Bacteria | 19008 |
| 23 | Ga0070668_100001563 | 3300005347 | Bacteria | 16519 |
| 24 | Ga0070668_100001996 | 3300005347 | Bacteria | 14916 |
| 25 | Ga0070668_100032853 | 3300005347 | Bacteria | 3949 |
| 26 | Ga0070669_100000576 | 3300005353 | Bacteria | 27261 |
| 27 | Ga0070671_100000798 | 3300005355 | Bacteria | 22734 |
| 28 | Ga0070671_100087094 | 3300005355 | Bacteria | 2613 |
| 29 | Ga0070671_100205944 | 3300005355 | Bacteria | 1668 |
| 30 | Ga0070673_100253397 | 3300005364 | Bacteria | 1535 |
| 31 | Ga0070659_100001047 | 3300005366 | Bacteria | 20214 |
| 32 | Ga0070659_100001844 | 3300005366 | Bacteria | 15225 |
| 33 | Ga0070659_100001909 | 3300005366 | Bacteria | 14893 |
| 34 | Ga0070667_100000140 | 3300005367 | Bacteria | 91817 |
| 35 | Ga0070667_100002966 | 3300005367 | Bacteria | 14584 |
| 36 | Ga0070667_100014536 | 3300005367 | Bacteria | 6504 |
| 37 | Ga0070667_100265782 | 3300005367 | Bacteria | 1537 |
| 38 | Ga0070667_100372466 | 3300005367 | Bacteria | 1296 |
| 39 | Ga0070662_100212105 | 3300005457 | Bacteria | 1541 |
| 40 | Ga0070681_10009284 | 3300005458 | Bacteria | 9672 |
| 41 | Ga0070681_10009895 | 3300005458 | Bacteria | 9394 |
| 42 | Ga0070679_100012066 | 3300005530 | Bacteria | 8250 |
| 43 | Ga0068853_100053469 | 3300005539 | Bacteria | 3478 |
| 44 | Ga0068853_100079096 | 3300005539 | Bacteria | 2875 |
| 45 | Ga0068853_100094286 | 3300005539 | Bacteria | 2637 |
| 46 | Ga0068853_100199383 | 3300005539 | Bacteria | 1821 |
| 47 | Ga0068853_100598242 | 3300005539 | Bacteria | 1047 |
| 48 | Ga0070665_100000248 | 3300005548 | Bacteria | 89239 |
| 49 | Ga0070665_100006854 | 3300005548 | Bacteria | 11582 |
| 50 | Ga0070665_100007821 | 3300005548 | Bacteria | 10848 |
| 51 | Ga0070665_100022780 | 3300005548 | Bacteria | 6305 |
| 52 | Ga0070665_100044262 | 3300005548 | Bacteria | 4470 |
| 53 | Ga0070665_100836033 | 3300005548 | Bacteria | 934 |
| 54 | Ga0068855_100114040 | 3300005563 | Bacteria | 3099 |
| 55 | Ga0068855_100122502 | 3300005563 | Bacteria | 2975 |
| 56 | Ga0068855_100193725 | 3300005563 | Bacteria | 2291 |
| 57 | Ga0068855_100268511 | 3300005563 | Bacteria | 1898 |
| 58 | Ga0070664_100090930 | 3300005564 | Bacteria | 2642 |
| 59 | Ga0068856_100713539 | 3300005614 | Bacteria | 1023 |
| 60 | Ga0068852_100053018 | 3300005616 | Bacteria | 3489 |
| 61 | Ga0068859_100000177 | 3300005617 | Bacteria | 62179 |
| 62 | Ga0068859_100147562 | 3300005617 | Bacteria | 2427 |
| 63 | Ga0068864_100000472 | 3300005618 | Bacteria | 34898 |
| 64 | Ga0068864_100000533 | 3300005618 | Bacteria | 32621 |
| 65 | Ga0068864_100012289 | 3300005618 | Bacteria | 7077 |
| 66 | Ga0068863_100002271 | 3300005841 | Bacteria | 19100 |
| 67 | Ga0068863_100005428 | 3300005841 | Bacteria | 12555 |
| 68 | Ga0068863_100005478 | 3300005841 | Bacteria | 12499 |
| 69 | Ga0068863_100366164 | 3300005841 | Bacteria | 1406 |
| 70 | Ga0068858_100000098 | 3300005842 | Bacteria | 90747 |
| 71 | Ga0068858_100001321 | 3300005842 | Bacteria | 25610 |
| 72 | Ga0068858_100020066 | 3300005842 | Bacteria | 6251 |
| 73 | Ga0068860_100000580 | 3300005843 | Bacteria | 43948 |
| 74 | Ga0068860_100000583 | 3300005843 | Bacteria | 43765 |
| 75 | Ga0068860_100045145 | 3300005843 | Bacteria | 4201 |
| 76 | Ga0068860_100781381 | 3300005843 | Bacteria | 968 |
| 77 | Ga0068862_100000443 | 3300005844 | Bacteria | 45038 |
| 78 | Ga0068862_100004861 | 3300005844 | Bacteria | 11312 |
| 79 | Ga0068862_100067920 | 3300005844 | Bacteria | 3075 |
| 80 | Ga0068862_100141066 | 3300005844 | Bacteria | 2139 |
| 81 | Ga0075363_100036329 | 3300006048 | Bacteria | 2583 |
| 82 | Ga0075364_10003123 | 3300006051 | Bacteria | 9375 |
| 83 | Ga0075367_10042007 | 3300006178 | Bacteria | 2674 |
| 84 | Ga0075366_10049809 | 3300006195 | Bacteria | 2486 |
| 85 | Ga0075370_10051132 | 3300006353 | Bacteria | 2344 |
| 86 | Ga0075370_10231505 | 3300006353 | Bacteria | 1093 |
| 87 | Ga0068865_100000723 | 3300006881 | Bacteria | 18580 |
| 88 | Ga0097620_100000177 | 3300006931 | Bacteria | 62179 |
| 89 | Ga0097620_100147570 | 3300006931 | Bacteria | 2427 |
| 90 | Ga0105240_10044078 | 3300009093 | Bacteria | 5672 |
| 91 | Ga0105240_10061152 | 3300009093 | Bacteria | 4694 |
| 92 | Ga0105240_10063491 | 3300009093 | Bacteria | 4594 |
| 93 | Ga0105240_10130439 | 3300009093 | Bacteria | 3016 |
| 94 | Ga0105240_10245709 | 3300009093 | Bacteria | 2072 |
| 95 | Ga0105240_10521475 | 3300009093 | Bacteria | 1318 |
| 96 | Ga0105240_10533609 | 3300009093 | Bacteria | 1300 |
| 97 | Ga0105240_10975858 | 3300009093 | Bacteria | 908 |
| 98 | Ga0105245_10098494 | 3300009098 | Bacteria | 2702 |
| 99 | Ga0105247_10126171 | 3300009101 | Bacteria | 1663 |
| 100 | Ga0105247_10197719 | 3300009101 | Bacteria | 1349 |
| 101 | Ga0105242_10443388 | 3300009176 | Bacteria | 1222 |
| 102 | Ga0105248_10003160 | 3300009177 | Bacteria | 18236 |
| 103 | Ga0105248_10006553 | 3300009177 | Bacteria | 12766 |
| 104 | Ga0105248_10056922 | 3300009177 | Bacteria | 4387 |
| 105 | Ga0105248_10416420 | 3300009177 | Bacteria | 1513 |
| 106 | Ga0105237_10228342 | 3300009545 | Bacteria | 1862 |
| 107 | Ga0105238_10185174 | 3300009551 | Bacteria | 2058 |
| 108 | Ga0105238_10351958 | 3300009551 | Bacteria | 1462 |
| 109 | Ga0105238_10673201 | 3300009551 | Bacteria | 1046 |
| 110 | Ga0105249_10004149 | 3300009553 | Bacteria | 12511 |
| 111 | Ga0157370_10201003 | 3300013104 | Bacteria | 1849 |
| 112 | Ga0157370_10316270 | 3300013104 | Bacteria | 1441 |
| 113 | Ga0157370_10366792 | 3300013104 | Bacteria | 1327 |
| 114 | Ga0157369_10323569 | 3300013105 | Bacteria | 1603 |
| 115 | Ga0163162_10052631 | 3300013306 | Bacteria | 4089 |
| 116 | Ga0163162_10307085 | 3300013306 | Bacteria | 1719 |
| 117 | Ga0157372_10015386 | 3300013307 | Bacteria | 8199 |
| 118 | Ga0163163_10005231 | 3300014325 | Bacteria | 11189 |
| 119 | Ga0163163_10031710 | 3300014325 | Bacteria | 5103 |
| 120 | Ga0163163_10032695 | 3300014325 | Bacteria | 5026 |
| 121 | Ga0163163_10107468 | 3300014325 | Bacteria | 2817 |
| 122 | Ga0163163_10908136 | 3300014325 | Bacteria | 944 |
| 123 | Ga0157379_10003393 | 3300014968 | Bacteria | 13475 |
| 124 | Ga0157379_10026633 | 3300014968 | Bacteria | 5147 |
| 125 | Ga0157379_10056257 | 3300014968 | Bacteria | 3515 |
| 126 | Ga0157379_10795801 | 3300014968 | Bacteria | 892 |
| 127 | Ga0213876_10011595 | 3300021384 | Bacteria | 4704 |
| 128 | Ga0213876_10021790 | 3300021384 | Bacteria | 3389 |
| 129 | Ga0209026_1001648 | 3300025250 | Bacteria | 9474 |
| 130 | Ga0209026_1005573 | 3300025250 | Bacteria | 3343 |
| 131 | Ga0209676_1000099 | 3300025292 | Bacteria | 230048 |
| 132 | Ga0209676_1000180 | 3300025292 | Bacteria | 148369 |
| 133 | Ga0209758_1000401 | 3300025297 | Bacteria | 74599 |
| 134 | Ga0209050_1000031 | 3300025298 | Bacteria | 458181 |
| 135 | Ga0209050_1000319 | 3300025298 | Bacteria | 96837 |
| 136 | Ga0209050_1007309 | 3300025298 | Bacteria | 6233 |
| 137 | Ga0209051_1001724 | 3300025303 | Bacteria | 17462 |
| 138 | Ga0209257_1000073 | 3300025304 | Bacteria | 325833 |
| 139 | Ga0209257_1000614 | 3300025304 | Bacteria | 58019 |
| 140 | Ga0209257_1003297 | 3300025304 | Bacteria | 14064 |
| 141 | Ga0209257_1008323 | 3300025304 | Bacteria | 5937 |
| 142 | Ga0207710_10091371 | 3300025900 | Bacteria | 1425 |
| 143 | Ga0207680_10086938 | 3300025903 | Bacteria | 1978 |
| 144 | Ga0207705_10005248 | 3300025909 | Bacteria | 9712 |
| 145 | Ga0207705_10202905 | 3300025909 | Bacteria | 1503 |
| 146 | Ga0207705_10282605 | 3300025909 | Unclassified | 1270 |
| 147 | Ga0207707_10009978 | 3300025912 | Bacteria | 8236 |
| 148 | Ga0207707_10011536 | 3300025912 | Bacteria | 7695 |
| 149 | Ga0207695_10000984 | 3300025913 | Bacteria | 50625 |
| 150 | Ga0207695_10004268 | 3300025913 | Bacteria | 19631 |
| 151 | Ga0207695_10006284 | 3300025913 | Bacteria | 15460 |
| 152 | Ga0207695_10006822 | 3300025913 | Bacteria | 14705 |
| 153 | Ga0207695_10378594 | 3300025913 | Bacteria | 1301 |
| 154 | Ga0207671_10338259 | 3300025914 | Bacteria | 1192 |
| 155 | Ga0207660_10017169 | 3300025917 | Bacteria | 4803 |
| 156 | Ga0207660_10051165 | 3300025917 | Bacteria | 2936 |
| 157 | Ga0207660_10123962 | 3300025917 | Bacteria | 1960 |
| 158 | Ga0207657_10002252 | 3300025919 | Bacteria | 20914 |
| 159 | Ga0207657_10145061 | 3300025919 | Bacteria | 1937 |
| 160 | Ga0207657_10282852 | 3300025919 | Bacteria | 1316 |
| 161 | Ga0207657_10403620 | 3300025919 | Unclassified | 1075 |
| 162 | Ga0207649_10222308 | 3300025920 | Bacteria | 1346 |
| 163 | Ga0207652_10023389 | 3300025921 | Bacteria | 5118 |
| 164 | Ga0207681_10057547 | 3300025923 | Bacteria | 2657 |
| 165 | Ga0207694_10016477 | 3300025924 | Bacteria | 5581 |
| 166 | Ga0207694_10028408 | 3300025924 | Bacteria | 4264 |
| 167 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 168 | Ga0207650_10141537 | 3300025925 | Bacteria | 1892 |
| 169 | Ga0207687_10112230 | 3300025927 | Bacteria | 2025 |
| 170 | Ga0207644_10002515 | 3300025931 | Bacteria | 11795 |
| 171 | Ga0207644_10034161 | 3300025931 | Bacteria | 3558 |
| 172 | Ga0207690_10000066 | 3300025932 | Bacteria | 91772 |
| 173 | Ga0207690_10002531 | 3300025932 | Bacteria | 11043 |
| 174 | Ga0207690_10004547 | 3300025932 | Bacteria | 8193 |
| 175 | Ga0207686_10275110 | 3300025934 | Bacteria | 1240 |
| 176 | Ga0207704_10001512 | 3300025938 | Bacteria | 10422 |
| 177 | Ga0207711_10006520 | 3300025941 | Bacteria | 9827 |
| 178 | Ga0207711_10007924 | 3300025941 | Bacteria | 8886 |
| 179 | Ga0207711_10011025 | 3300025941 | Bacteria | 7509 |
| 180 | Ga0207711_10341295 | 3300025941 | Bacteria | 1386 |
| 181 | Ga0207689_10123981 | 3300025942 | Bacteria | 2125 |
| 182 | Ga0207661_10696157 | 3300025944 | Bacteria | 935 |
| 183 | Ga0207679_10055519 | 3300025945 | Bacteria | 2920 |
| 184 | Ga0207667_10010340 | 3300025949 | Bacteria | 10911 |
| 185 | Ga0207667_10021682 | 3300025949 | Bacteria | 7117 |
| 186 | Ga0207667_10033965 | 3300025949 | Bacteria | 5480 |
| 187 | Ga0207667_10037839 | 3300025949 | Bacteria | 5157 |
| 188 | Ga0207667_10106438 | 3300025949 | Bacteria | 2893 |
| 189 | Ga0207651_10102212 | 3300025960 | Bacteria | 2130 |
| 190 | Ga0207712_10002299 | 3300025961 | Bacteria | 12407 |
| 191 | Ga0207668_10000046 | 3300025972 | Bacteria | 102051 |
| 192 | Ga0207668_10002636 | 3300025972 | Bacteria | 10493 |
| 193 | Ga0207668_10003086 | 3300025972 | Bacteria | 9766 |
| 194 | Ga0207668_10007685 | 3300025972 | Bacteria | 6416 |
| 195 | Ga0207658_10000264 | 3300025986 | Bacteria | 55170 |
| 196 | Ga0207658_10006846 | 3300025986 | Bacteria | 7767 |
| 197 | Ga0207658_10437782 | 3300025986 | Bacteria | 1155 |
| 198 | Ga0207703_10000086 | 3300026035 | Bacteria | 107307 |
| 199 | Ga0207703_10003329 | 3300026035 | Bacteria | 13494 |
| 200 | Ga0207639_10038282 | 3300026041 | Bacteria | 3567 |
| 201 | Ga0207639_10058780 | 3300026041 | Bacteria | 2959 |
| 202 | Ga0207639_10220782 | 3300026041 | Bacteria | 1637 |
| 203 | Ga0207639_10265195 | 3300026041 | Bacteria | 1504 |
| 204 | Ga0207639_10348673 | 3300026041 | Bacteria | 1322 |
| 205 | Ga0207702_10043863 | 3300026078 | Bacteria | 3757 |
| 206 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 207 | Ga0207641_10001512 | 3300026088 | Bacteria | 22780 |
| 208 | Ga0207641_10023715 | 3300026088 | Bacteria | 5055 |
| 209 | Ga0207641_10130438 | 3300026088 | Bacteria | 2256 |
| 210 | Ga0207641_10614589 | 3300026088 | Bacteria | 1065 |
| 211 | Ga0207676_10000445 | 3300026095 | Bacteria | 35000 |
| 212 | Ga0207676_10000784 | 3300026095 | Bacteria | 24801 |
| 213 | Ga0207676_10026760 | 3300026095 | Bacteria | 4290 |
| 214 | Ga0207676_10233415 | 3300026095 | Bacteria | 1646 |
| 215 | Ga0207676_10557262 | 3300026095 | Bacteria | 1096 |
| 216 | Ga0207676_10909709 | 3300026095 | Bacteria | 863 |
| 217 | Ga0207674_10265813 | 3300026116 | Bacteria | 1663 |
| 218 | Ga0207675_100509555 | 3300026118 | Bacteria | 1199 |
| 219 | Ga0207675_100803510 | 3300026118 | Bacteria | 954 |
| 220 | Ga0207698_10105462 | 3300026142 | Bacteria | 2349 |
| 221 | Ga0207698_10221277 | 3300026142 | Bacteria | 1711 |
| 222 | Ga0207698_10662881 | 3300026142 | Bacteria | 1035 |
| 223 | Ga0209981_1012554 | 3300027378 | Bacteria | 1173 |
| 224 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 225 | Ga0268266_10001455 | 3300028379 | Bacteria | 28167 |
| 226 | Ga0268266_10003594 | 3300028379 | Bacteria | 15342 |
| 227 | Ga0268266_10036647 | 3300028379 | Bacteria | 4176 |
| 228 | Ga0268266_10301322 | 3300028379 | Bacteria | 1495 |
| 229 | Ga0268265_10002810 | 3300028380 | Bacteria | 12814 |
| 230 | Ga0268265_10017676 | 3300028380 | Bacteria | 4927 |
| 231 | Ga0268265_10107120 | 3300028380 | Bacteria | 2272 |
| 232 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 233 | Ga0268264_10000358 | 3300028381 | Bacteria | 68359 |
| 234 | Ga0265326_10059363 | 3300028558 | Bacteria | 1082 |
| 235 | Ga0307517_10025834 | 3300028786 | Bacteria | 7154 |
| 236 | Ga0307517_10075828 | 3300028786 | Bacteria | 2945 |
| 237 | Ga0307515_10077312 | 3300028794 | Bacteria | 4398 |
| 238 | Ga0265338_10102268 | 3300028800 | Bacteria | 2330 |
| 239 | Ga0265338_10115021 | 3300028800 | Bacteria | 2157 |
| 240 | Ga0307511_10021241 | 3300030521 | Bacteria | 6122 |
| 241 | Ga0265327_10001725 | 3300031251 | Bacteria | 25910 |
| 242 | Ga0265327_10140043 | 3300031251 | Bacteria | 1131 |
| 243 | Ga0307513_10001008 | 3300031456 | Bacteria | 40757 |
| 244 | Ga0307513_10004817 | 3300031456 | Bacteria | 17920 |
| 245 | Ga0307513_10010331 | 3300031456 | Bacteria | 11708 |
| 246 | Ga0307513_10064828 | 3300031456 | Bacteria | 3846 |
| 247 | Ga0265314_10016607 | 3300031711 | Bacteria | 5807 |
| 248 | Ga0265314_10123510 | 3300031711 | Bacteria | 1626 |
| 249 | Ga0307413_10152336 | 3300031824 | Bacteria | 1613 |
| 250 | Ga0307413_10193923 | 3300031824 | Bacteria | 1461 |
| 251 | Ga0307411_10062581 | 3300032005 | Bacteria | 2483 |
| 252 | Ga0307411_10300309 | 3300032005 | Bacteria | 1287 |
| 253 | Ga0307510_10007774 | 3300033180 | Bacteria | 12786 |
| 254 | Ga0373936_0007727 | 3300035113 | Bacteria | 4038 |
| 255 | Ga0373939_0107530 | 3300035114 | Bacteria | 966 |
| 256 | Ga0373935_0402243 | 3300035692 | Bacteria | 984 |
| 257 | Ga0373927_0001191 | 3300035695 | Bacteria | 19735 |
| 258 | Ga0373925_0000136 | 3300037068 | Bacteria | 77912 |
| 259 | Ga0373925_0033525 | 3300037068 | Bacteria | 3784 |
| 260 | Ga0395899_0000399 | 3300037312 | Bacteria | 51229 |
| 261 | Ga0395899_0093871 | 3300037312 | Bacteria | 2172 |
| 262 | Ga0395900_0000010 | 3300037418 | Bacteria | 461364 |
| 263 | Ga0395900_0023763 | 3300037418 | Bacteria | 6270 |
| 264 | Ga0395900_0402732 | 3300037418 | Bacteria | 1332 |
| 265 | Ga0395898_0001666 | 3300037466 | Bacteria | 29798 |
| 266 | Ga0395898_0106060 | 3300037466 | Bacteria | 2695 |
| 267 | Ga0395898_0147888 | 3300037466 | Bacteria | 2248 |
| 268 | Ga0395905_0004354 | 3300037471 | Bacteria | 14743 |
| 269 | Ga0395905_0328576 | 3300037471 | Bacteria | 1419 |
| 270 | Ga0395905_0530967 | 3300037471 | Bacteria | 1077 |
| 271 | Ga0395905_0892213 | 3300037471 | Bacteria | 792 |
| 272 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 273 | Ga0395901_0216734 | 3300038443 | Bacteria | 2002 |
| 274 | Ga0395901_0354196 | 3300038443 | Bacteria | 1514 |
| 275 | Ga0395901_0452734 | 3300038443 | Bacteria | 1312 |
| 276 | Ga0436365_0482828 | 3300039437 | Bacteria | 1832 |
| 277 | Ga0436365_1485304 | 3300039437 | Bacteria | 4687 |
| 278 | Ga0466964_0072816 | 3300044706 | Bacteria | 1457 |
| 279 | Ga0466957_0492522 | 3300044842 | Bacteria | 849 |
| 280 | Ga0495629_0258424 | 3300046459 | Bacteria | 1197 |
| 281 | Ga0495638_0000764 | 3300046460 | Bacteria | 34208 |
| 282 | Ga0495583_0056513 | 3300046506 | Bacteria | 1769 |
| 283 | Ga0495610_0005615 | 3300046512 | Bacteria | 8854 |
| 284 | Ga0495616_0246043 | 3300046513 | Bacteria | 770 |
| 285 | Ga0495643_0056489 | 3300046522 | Bacteria | 2095 |
| 286 | Ga0495648_0000399 | 3300046524 | Bacteria | 47763 |
| 287 | Ga0495654_0094396 | 3300046530 | Bacteria | 1384 |
| 288 | Ga0495597_0002439 | 3300046542 | Bacteria | 11798 |
| 289 | Ga0495622_0004437 | 3300046557 | Bacteria | 6513 |
| 290 | Ga0495668_0009345 | 3300046616 | Bacteria | 6028 |
| 291 | Ga0495668_0009746 | 3300046616 | Bacteria | 5869 |
| 292 | Ga0495611_0041673 | 3300046648 | Bacteria | 2048 |
| 293 | Ga0495625_0063542 | 3300046660 | Bacteria | 2606 |
| 294 | Ga0495625_0105477 | 3300046660 | Bacteria | 1930 |
| 295 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 296 | Ga0495669_0000267 | 3300046684 | Bacteria | 29896 |
| 297 | Ga0495636_0018718 | 3300047318 | Bacteria | 2779 |
| 298 | Ga0495672_0039552 | 3300047320 | Bacteria | 2867 |
| 299 | Ga0495677_0037951 | 3300047445 | Bacteria | 1760 |
| 300 | Ga0495673_0000403 | 3300047469 | Bacteria | 50650 |
| 301 | Ga0495681_0082178 | 3300047470 | Bacteria | 1436 |
| 302 | Ga0495686_0011524 | 3300047472 | Bacteria | 6228 |
| 303 | Ga0496101_0187443 | 3300048904 | Bacteria | 1595 |
| 304 | Ga0496102_0036426 | 3300048905 | Bacteria | 4432 |
| 305 | Ga0496102_0080838 | 3300048905 | Bacteria | 2995 |
| 306 | Ga0496106_0216673 | 3300048909 | Bacteria | 1526 |
| 307 | Ga0496108_0017868 | 3300048911 | Bacteria | 5801 |
| 308 | Ga0496109_0094610 | 3300048912 | Bacteria | 2766 |
| 309 | Ga0496112_0027122 | 3300048915 | Bacteria | 5521 |
| 310 | Ga0496112_0069222 | 3300048915 | Bacteria | 3486 |
| 311 | Ga0496113_0027742 | 3300048916 | Bacteria | 4063 |
| 312 | Ga0496115_0000396 | 3300048918 | Bacteria | 35918 |
| 313 | Ga0496115_0000643 | 3300048918 | Bacteria | 26252 |
| 314 | Ga0496115_0238866 | 3300048918 | Bacteria | 1498 |
| 315 | Ga0496117_0031239 | 3300048920 | Bacteria | 4070 |
| 316 | Ga0496118_0014843 | 3300048921 | Bacteria | 7258 |
| 317 | Ga0496119_0026271 | 3300048922 | Bacteria | 4041 |
| 318 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 319 | Ga0496121_0352884 | 3300048924 | Bacteria | 979 |
| 320 | Ga0496124_0011339 | 3300048927 | Bacteria | 8914 |
| 321 | Ga0496125_0096949 | 3300048928 | Bacteria | 2187 |
| 322 | Ga0501047_0002124 | 3300049581 | Bacteria | 18973 |
| 323 | Ga0501047_0190243 | 3300049581 | Bacteria | 1916 |
| 324 | Ga0501257_057749 | 3300049686 | Bacteria | 977 |
| 325 | nmdc:mga03n38_467122_c1 | 3300050490 | Bacteria | 704 |
| 326 | nmdc:mga00v17_2502_c1 | 3300050491 | Bacteria | 9409 |
| 327 | nmdc:mga0yw44_520405_c1 | 3300050492 | Bacteria | 807 |
| 328 | nmdc:mga0k408_31412_c1 | 3300050493 | Bacteria | 3032 |
| 329 | nmdc:mga06z11_9004_c1 | 3300050494 | Bacteria | 4192 |
| 330 | nmdc:mga07m45_150997_c1 | 3300050496 | Bacteria | 1347 |
| 331 | nmdc:mga07m45_2641_c1 | 3300050496 | Bacteria | 8439 |
| 332 | nmdc:mga07m45_66836_c1 | 3300050496 | Bacteria | 2043 |
| 333 | nmdc:mga0sz30_2139_c1 | 3300050516 | Bacteria | 7060 |
| 334 | Ga0500578_0000080 | 3300053086 | Bacteria | 106387 |
| 335 | Ga0500643_003867 | 3300053087 | Bacteria | 6970 |
| 336 | Ga0500643_004110 | 3300053087 | Bacteria | 6702 |
| 337 | Ga0500644_0000218 | 3300053088 | Bacteria | 33235 |
| 338 | Ga0500562_000163 | 3300053108 | Bacteria | 18798 |
| 339 | Ga0500594_0000587 | 3300053118 | Bacteria | 7792 |
| 340 | Ga0500595_006788 | 3300053119 | Bacteria | 4820 |
| 341 | Ga0500595_067270 | 3300053119 | Bacteria | 1069 |
| 342 | Ga0500608_000062 | 3300053122 | Bacteria | 46850 |
| 343 | Ga0500559_0045585 | 3300053136 | Bacteria | 1920 |
| 344 | Ga0500564_000127 | 3300053138 | Bacteria | 19327 |
| 345 | Ga0500622_0000812 | 3300053156 | Bacteria | 26774 |
| 346 | Ga0500645_011450 | 3300053730 | Bacteria | 2896 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100067920 | Ga0068862_1000679202 | 188 |
| 2 | 3300025920 | Ga0207649_10222308 | Ga0207649_102223082 | 192 |
| 3 | 3300031251 | Ga0265327_10001725 | Ga0265327_1000172512 | 192 |
| 4 | 3300003791 | Ga0055530_10004835 | Ga0055530_100048356 | 193 |
| 5 | 3300003794 | Ga0055531_10015028 | Ga0055531_100150285 | 193 |
| 6 | 3300025298 | Ga0209050_1000031 | Ga0209050_1000031226 | 193 |
| 7 | 3300025304 | Ga0209257_1000073 | Ga0209257_1000073154 | 193 |
| 8 | 3300009176 | Ga0105242_10443388 | Ga0105242_104433882 | 194 |
| 9 | 3300021384 | Ga0213876_10021790 | Ga0213876_100217903 | 194 |
| 10 | 3300025934 | Ga0207686_10275110 | Ga0207686_102751102 | 194 |
| 11 | 3300026041 | Ga0207639_10265195 | Ga0207639_102651952 | 194 |
| 12 | 3300039437 | Ga0436365_0482828 | Ga0436365_0482828_452_1186 | 194 |
| 13 | 3300038443 | Ga0395901_0452734 | Ga0395901_0452734_544_1221 | 197 |
| 14 | 3300053087 | Ga0500643_004110 | Ga0500643_004110_5438_6130 | 197 |
| 15 | 3300009177 | Ga0105248_10416420 | Ga0105248_104164202 | 198 |
| 16 | 3300037471 | Ga0395905_0892213 | Ga0395905_0892213_26_700 | 198 |
| 17 | 3300009093 | Ga0105240_10975858 | Ga0105240_109758582 | 199 |
| 18 | 3300025297 | Ga0209758_1000401 | Ga0209758_100040158 | 200 |
| 19 | 3300031824 | Ga0307413_10152336 | Ga0307413_101523361 | 200 |
| 20 | 3300032005 | Ga0307411_10300309 | Ga0307411_103003092 | 200 |
| 21 | 3300050492 | nmdc:mga0yw44_520405_c1 | nmdc:mga0yw44_520405_c1_131_778 | 200 |
| 22 | 3300005347 | Ga0070668_100001563 | Ga0070668_10000156311 | 202 |
| 23 | 3300005548 | Ga0070665_100006854 | Ga0070665_1000068547 | 202 |
| 24 | 3300005844 | Ga0068862_100141066 | Ga0068862_1001410662 | 202 |
| 25 | 3300009101 | Ga0105247_10126171 | Ga0105247_101261712 | 202 |
| 26 | 3300025900 | Ga0207710_10091371 | Ga0207710_100913712 | 202 |
| 27 | 3300025972 | Ga0207668_10000046 | Ga0207668_1000004670 | 202 |
| 28 | 3300026088 | Ga0207641_10614589 | Ga0207641_106145892 | 202 |
| 29 | 3300028379 | Ga0268266_10001455 | Ga0268266_100014558 | 202 |
| 30 | 3300028380 | Ga0268265_10107120 | Ga0268265_101071202 | 202 |
| 31 | 3300005618 | Ga0068864_100012289 | Ga0068864_1000122894 | 208 |
| 32 | 3300014968 | Ga0157379_10795801 | Ga0157379_107958011 | 208 |
| 33 | 3300026095 | Ga0207676_10026760 | Ga0207676_100267603 | 208 |
| 34 | 3300046684 | Ga0495669_0000267 | Ga0495669_0000267_22166_22861 | 209 |
| 35 | 3300005347 | Ga0070668_100001106 | Ga0070668_10000110622 | 210 |
| 36 | 3300005617 | Ga0068859_100147562 | Ga0068859_1001475622 | 210 |
| 37 | 3300005843 | Ga0068860_100000583 | Ga0068860_10000058322 | 210 |
| 38 | 3300005844 | Ga0068862_100004861 | Ga0068862_1000048618 | 210 |
| 39 | 3300006931 | Ga0097620_100147570 | Ga0097620_1001475704 | 210 |
| 40 | 3300009177 | Ga0105248_10056922 | Ga0105248_100569221 | 210 |
| 41 | 3300025941 | Ga0207711_10011025 | Ga0207711_100110251 | 210 |
| 42 | 3300025972 | Ga0207668_10007685 | Ga0207668_100076852 | 210 |
| 43 | 3300028380 | Ga0268265_10017676 | Ga0268265_100176765 | 210 |
| 44 | 3300028381 | Ga0268264_10000046 | Ga0268264_1000004622 | 210 |
| 45 | 3300037068 | Ga0373925_0033525 | Ga0373925_0033525_324_983 | 210 |
| 46 | 3300048905 | Ga0496102_0080838 | Ga0496102_0080838_2116_2811 | 210 |
| 47 | 3300048920 | Ga0496117_0031239 | Ga0496117_0031239_1118_1813 | 210 |
| 48 | 3300048921 | Ga0496118_0014843 | Ga0496118_0014843_674_1369 | 210 |
| 49 | 3300048922 | Ga0496119_0026271 | Ga0496119_0026271_248_943 | 210 |
| 50 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_763178_763873 | 210 |
| 51 | 3300049686 | Ga0501257_057749 | Ga0501257_057749_204_875 | 210 |
| 52 | 3300005329 | Ga0070683_100462369 | Ga0070683_1004623692 | 211 |
| 53 | 3300005563 | Ga0068855_100268511 | Ga0068855_1002685112 | 211 |
| 54 | 3300009093 | Ga0105240_10130439 | Ga0105240_101304394 | 211 |
| 55 | 3300025944 | Ga0207661_10696157 | Ga0207661_106961571 | 211 |
| 56 | 3300025949 | Ga0207667_10037839 | Ga0207667_100378394 | 211 |
| 57 | 3300030521 | Ga0307511_10021241 | Ga0307511_100212417 | 211 |
| 58 | 3300050490 | nmdc:mga03n38_467122_c1 | nmdc:mga03n38_467122_c1_22_669 | 211 |
| 59 | 3300053119 | Ga0500595_067270 | Ga0500595_067270_148_795 | 211 |
| 60 | 3300004625 | Ga0055543_1012685 | Ga0055543_10126852 | 212 |
| 61 | 3300005262 | Ga0065165_1000029 | Ga0065165_1000029174 | 212 |
| 62 | 3300005262 | Ga0065165_1016253 | Ga0065165_10162533 | 212 |
| 63 | 3300025250 | Ga0209026_1001648 | Ga0209026_10016483 | 212 |
| 64 | 3300025304 | Ga0209257_1003297 | Ga0209257_10032975 | 212 |
| 65 | 3300031824 | Ga0307413_10193923 | Ga0307413_101939232 | 212 |
| 66 | 3300032005 | Ga0307411_10062581 | Ga0307411_100625812 | 212 |
| 67 | 3300046513 | Ga0495616_0246043 | Ga0495616_0246043_61_711 | 212 |
| 68 | 3300047472 | Ga0495686_0011524 | Ga0495686_0011524_3294_3944 | 212 |
| 69 | 3300053730 | Ga0500645_011450 | Ga0500645_011450_1462_2112 | 212 |
| 70 | 3300006048 | Ga0075363_100036329 | Ga0075363_1000363294 | 213 |
| 71 | 3300006195 | Ga0075366_10049809 | Ga0075366_100498092 | 213 |
| 72 | 3300006353 | Ga0075370_10051132 | Ga0075370_100511322 | 213 |
| 73 | 3300050493 | nmdc:mga0k408_31412_c1 | nmdc:mga0k408_31412_c1_1131_1814 | 213 |
| 74 | 3300050496 | nmdc:mga07m45_2641_c1 | nmdc:mga07m45_2641_c1_3346_4029 | 213 |
| 75 | 3300031456 | Ga0307513_10001008 | Ga0307513_1000100823 | 214 |
| 76 | 3300053087 | Ga0500643_003867 | Ga0500643_003867_6021_6779 | 214 |
| 77 | 3300005338 | Ga0068868_100337780 | Ga0068868_1003377802 | 215 |
| 78 | 3300005355 | Ga0070671_100087094 | Ga0070671_1000870942 | 215 |
| 79 | 3300005355 | Ga0070671_100205944 | Ga0070671_1002059442 | 215 |
| 80 | 3300005364 | Ga0070673_100253397 | Ga0070673_1002533972 | 215 |
| 81 | 3300005548 | Ga0070665_100022780 | Ga0070665_1000227802 | 215 |
| 82 | 3300005548 | Ga0070665_100836033 | Ga0070665_1008360331 | 215 |
| 83 | 3300005564 | Ga0070664_100090930 | Ga0070664_1000909303 | 215 |
| 84 | 3300005843 | Ga0068860_100781381 | Ga0068860_1007813812 | 215 |
| 85 | 3300014968 | Ga0157379_10056257 | Ga0157379_100562572 | 215 |
| 86 | 3300025903 | Ga0207680_10086938 | Ga0207680_100869382 | 215 |
| 87 | 3300025931 | Ga0207644_10034161 | Ga0207644_100341614 | 215 |
| 88 | 3300025941 | Ga0207711_10007924 | Ga0207711_100079244 | 215 |
| 89 | 3300025941 | Ga0207711_10341295 | Ga0207711_103412952 | 215 |
| 90 | 3300025945 | Ga0207679_10055519 | Ga0207679_100555192 | 215 |
| 91 | 3300025960 | Ga0207651_10102212 | Ga0207651_101022122 | 215 |
| 92 | 3300026095 | Ga0207676_10557262 | Ga0207676_105572621 | 215 |
| 93 | 3300028379 | Ga0268266_10036647 | Ga0268266_100366474 | 215 |
| 94 | 3300028786 | Ga0307517_10075828 | Ga0307517_100758283 | 215 |
| 95 | 3300031456 | Ga0307513_10010331 | Ga0307513_100103312 | 215 |
| 96 | 3300035114 | Ga0373939_0107530 | Ga0373939_0107530_49_747 | 215 |
| 97 | 3300046506 | Ga0495583_0056513 | Ga0495583_0056513_682_1377 | 215 |
| 98 | 3300046648 | Ga0495611_0041673 | Ga0495611_0041673_762_1457 | 215 |
| 99 | 3300046660 | Ga0495625_0105477 | Ga0495625_0105477_1211_1906 | 215 |
| 100 | 3300047318 | Ga0495636_0018718 | Ga0495636_0018718_327_1022 | 215 |
| 101 | 3300047470 | Ga0495681_0082178 | Ga0495681_0082178_341_1036 | 215 |
| 102 | 3300048904 | Ga0496101_0187443 | Ga0496101_0187443_369_1064 | 215 |
| 103 | 3300048905 | Ga0496102_0036426 | Ga0496102_0036426_1139_1834 | 215 |
| 104 | 3300048909 | Ga0496106_0216673 | Ga0496106_0216673_256_954 | 215 |
| 105 | 3300048911 | Ga0496108_0017868 | Ga0496108_0017868_3979_4674 | 215 |
| 106 | 3300048912 | Ga0496109_0094610 | Ga0496109_0094610_1926_2621 | 215 |
| 107 | 3300048915 | Ga0496112_0069222 | Ga0496112_0069222_578_1273 | 215 |
| 108 | 3300048916 | Ga0496113_0027742 | Ga0496113_0027742_1228_1923 | 215 |
| 109 | 3300048918 | Ga0496115_0000396 | Ga0496115_0000396_6813_7529 | 215 |
| 110 | 3300005336 | Ga0070680_100134195 | Ga0070680_1001341953 | 216 |
| 111 | 3300005336 | Ga0070680_100354541 | Ga0070680_1003545412 | 216 |
| 112 | 3300005458 | Ga0070681_10009895 | Ga0070681_100098956 | 216 |
| 113 | 3300005530 | Ga0070679_100012066 | Ga0070679_1000120665 | 216 |
| 114 | 3300005539 | Ga0068853_100598242 | Ga0068853_1005982422 | 216 |
| 115 | 3300005563 | Ga0068855_100114040 | Ga0068855_1001140402 | 216 |
| 116 | 3300005563 | Ga0068855_100122502 | Ga0068855_1001225021 | 216 |
| 117 | 3300005563 | Ga0068855_100193725 | Ga0068855_1001937252 | 216 |
| 118 | 3300005614 | Ga0068856_100713539 | Ga0068856_1007135391 | 216 |
| 119 | 3300005616 | Ga0068852_100053018 | Ga0068852_1000530185 | 216 |
| 120 | 3300005618 | Ga0068864_100000472 | Ga0068864_10000047226 | 216 |
| 121 | 3300005841 | Ga0068863_100005428 | Ga0068863_1000054288 | 216 |
| 122 | 3300005841 | Ga0068863_100366164 | Ga0068863_1003661642 | 216 |
| 123 | 3300005842 | Ga0068858_100000098 | Ga0068858_10000009864 | 216 |
| 124 | 3300009093 | Ga0105240_10044078 | Ga0105240_100440781 | 216 |
| 125 | 3300009093 | Ga0105240_10061152 | Ga0105240_100611525 | 216 |
| 126 | 3300009093 | Ga0105240_10521475 | Ga0105240_105214751 | 216 |
| 127 | 3300009093 | Ga0105240_10533609 | Ga0105240_105336092 | 216 |
| 128 | 3300009545 | Ga0105237_10228342 | Ga0105237_102283422 | 216 |
| 129 | 3300009551 | Ga0105238_10185174 | Ga0105238_101851742 | 216 |
| 130 | 3300013104 | Ga0157370_10201003 | Ga0157370_102010032 | 216 |
| 131 | 3300013104 | Ga0157370_10366792 | Ga0157370_103667922 | 216 |
| 132 | 3300013105 | Ga0157369_10323569 | Ga0157369_103235692 | 216 |
| 133 | 3300013307 | Ga0157372_10015386 | Ga0157372_100153864 | 216 |
| 134 | 3300014325 | Ga0163163_10107468 | Ga0163163_101074683 | 216 |
| 135 | 3300025912 | Ga0207707_10009978 | Ga0207707_100099785 | 216 |
| 136 | 3300025913 | Ga0207695_10004268 | Ga0207695_100042685 | 216 |
| 137 | 3300025913 | Ga0207695_10006822 | Ga0207695_100068226 | 216 |
| 138 | 3300025913 | Ga0207695_10378594 | Ga0207695_103785942 | 216 |
| 139 | 3300025917 | Ga0207660_10051165 | Ga0207660_100511653 | 216 |
| 140 | 3300025917 | Ga0207660_10123962 | Ga0207660_101239622 | 216 |
| 141 | 3300025924 | Ga0207694_10016477 | Ga0207694_100164774 | 216 |
| 142 | 3300025924 | Ga0207694_10028408 | Ga0207694_100284082 | 216 |
| 143 | 3300025949 | Ga0207667_10010340 | Ga0207667_100103407 | 216 |
| 144 | 3300025949 | Ga0207667_10033965 | Ga0207667_100339653 | 216 |
| 145 | 3300025949 | Ga0207667_10106438 | Ga0207667_101064382 | 216 |
| 146 | 3300026035 | Ga0207703_10000086 | Ga0207703_1000008679 | 216 |
| 147 | 3300026041 | Ga0207639_10348673 | Ga0207639_103486732 | 216 |
| 148 | 3300026078 | Ga0207702_10043863 | Ga0207702_100438633 | 216 |
| 149 | 3300026088 | Ga0207641_10000012 | Ga0207641_1000001240 | 216 |
| 150 | 3300026088 | Ga0207641_10130438 | Ga0207641_101304383 | 216 |
| 151 | 3300026095 | Ga0207676_10000445 | Ga0207676_1000044525 | 216 |
| 152 | 3300026142 | Ga0207698_10105462 | Ga0207698_101054622 | 216 |
| 153 | 3300026142 | Ga0207698_10662881 | Ga0207698_106628811 | 216 |
| 154 | 3300028786 | Ga0307517_10025834 | Ga0307517_100258345 | 216 |
| 155 | 3300031456 | Ga0307513_10064828 | Ga0307513_100648282 | 216 |
| 156 | 3300033180 | Ga0307510_10007774 | Ga0307510_100077743 | 216 |
| 157 | 3300037312 | Ga0395899_0000399 | Ga0395899_0000399_27104_27775 | 216 |
| 158 | 3300037312 | Ga0395899_0093871 | Ga0395899_0093871_1347_2024 | 216 |
| 159 | 3300037418 | Ga0395900_0000010 | Ga0395900_0000010_288615_289286 | 216 |
| 160 | 3300037466 | Ga0395898_0001666 | Ga0395898_0001666_6142_6813 | 216 |
| 161 | 3300037466 | Ga0395898_0147888 | Ga0395898_0147888_1346_2023 | 216 |
| 162 | 3300037471 | Ga0395905_0004354 | Ga0395905_0004354_8899_9570 | 216 |
| 163 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_372979_373650 | 216 |
| 164 | 3300038443 | Ga0395901_0354196 | Ga0395901_0354196_202_873 | 216 |
| 165 | 3300046522 | Ga0495643_0056489 | Ga0495643_0056489_394_1092 | 216 |
| 166 | 3300046542 | Ga0495597_0002439 | Ga0495597_0002439_7886_8584 | 216 |
| 167 | 3300046557 | Ga0495622_0004437 | Ga0495622_0004437_4617_5315 | 216 |
| 168 | 3300046616 | Ga0495668_0009345 | Ga0495668_0009345_2926_3624 | 216 |
| 169 | 3300005327 | Ga0070658_10221900 | Ga0070658_102219002 | 217 |
| 170 | 3300005327 | Ga0070658_10333025 | Ga0070658_103330252 | 217 |
| 171 | 3300005327 | Ga0070658_10358961 | Ga0070658_103589612 | 217 |
| 172 | 3300005339 | Ga0070660_100183538 | Ga0070660_1001835382 | 217 |
| 173 | 3300005339 | Ga0070660_100371331 | Ga0070660_1003713311 | 217 |
| 174 | 3300005366 | Ga0070659_100001844 | Ga0070659_1000018441 | 217 |
| 175 | 3300005366 | Ga0070659_100001909 | Ga0070659_10000190910 | 217 |
| 176 | 3300005458 | Ga0070681_10009284 | Ga0070681_100092844 | 217 |
| 177 | 3300005539 | Ga0068853_100053469 | Ga0068853_1000534693 | 217 |
| 178 | 3300005539 | Ga0068853_100079096 | Ga0068853_1000790962 | 217 |
| 179 | 3300005539 | Ga0068853_100199383 | Ga0068853_1001993833 | 217 |
| 180 | 3300005548 | Ga0070665_100000248 | Ga0070665_1000002488 | 217 |
| 181 | 3300009093 | Ga0105240_10063491 | Ga0105240_100634912 | 217 |
| 182 | 3300009093 | Ga0105240_10245709 | Ga0105240_102457093 | 217 |
| 183 | 3300009098 | Ga0105245_10098494 | Ga0105245_100984942 | 217 |
| 184 | 3300009177 | Ga0105248_10006553 | Ga0105248_100065538 | 217 |
| 185 | 3300009551 | Ga0105238_10351958 | Ga0105238_103519582 | 217 |
| 186 | 3300013104 | Ga0157370_10316270 | Ga0157370_103162702 | 217 |
| 187 | 3300014325 | Ga0163163_10031710 | Ga0163163_100317102 | 217 |
| 188 | 3300014325 | Ga0163163_10032695 | Ga0163163_100326953 | 217 |
| 189 | 3300025909 | Ga0207705_10005248 | Ga0207705_100052488 | 217 |
| 190 | 3300025909 | Ga0207705_10202905 | Ga0207705_102029052 | 217 |
| 191 | 3300025909 | Ga0207705_10282605 | Ga0207705_102826051 | 217 |
| 192 | 3300025912 | Ga0207707_10011536 | Ga0207707_100115362 | 217 |
| 193 | 3300025913 | Ga0207695_10000984 | Ga0207695_1000098430 | 217 |
| 194 | 3300025913 | Ga0207695_10006284 | Ga0207695_100062844 | 217 |
| 195 | 3300025917 | Ga0207660_10017169 | Ga0207660_100171692 | 217 |
| 196 | 3300025919 | Ga0207657_10002252 | Ga0207657_1000225221 | 217 |
| 197 | 3300025919 | Ga0207657_10145061 | Ga0207657_101450612 | 217 |
| 198 | 3300025919 | Ga0207657_10282852 | Ga0207657_102828522 | 217 |
| 199 | 3300025919 | Ga0207657_10403620 | Ga0207657_104036202 | 217 |
| 200 | 3300025921 | Ga0207652_10023389 | Ga0207652_100233896 | 217 |
| 201 | 3300025927 | Ga0207687_10112230 | Ga0207687_101122302 | 217 |
| 202 | 3300025932 | Ga0207690_10000066 | Ga0207690_1000006638 | 217 |
| 203 | 3300025932 | Ga0207690_10004547 | Ga0207690_100045477 | 217 |
| 204 | 3300025949 | Ga0207667_10021682 | Ga0207667_100216828 | 217 |
| 205 | 3300026041 | Ga0207639_10058780 | Ga0207639_100587803 | 217 |
| 206 | 3300026041 | Ga0207639_10220782 | Ga0207639_102207822 | 217 |
| 207 | 3300026095 | Ga0207676_10909709 | Ga0207676_109097091 | 217 |
| 208 | 3300026116 | Ga0207674_10265813 | Ga0207674_102658132 | 217 |
| 209 | 3300026142 | Ga0207698_10221277 | Ga0207698_102212772 | 217 |
| 210 | 3300027378 | Ga0209981_1012554 | Ga0209981_10125541 | 217 |
| 211 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051198 | 217 |
| 212 | 3300031251 | Ga0265327_10140043 | Ga0265327_101400431 | 217 |
| 213 | 3300035113 | Ga0373936_0007727 | Ga0373936_0007727_126_803 | 217 |
| 214 | 3300035695 | Ga0373927_0001191 | Ga0373927_0001191_542_1219 | 217 |
| 215 | 3300037068 | Ga0373925_0000136 | Ga0373925_0000136_5474_6151 | 217 |
| 216 | 3300037418 | Ga0395900_0023763 | Ga0395900_0023763_533_1225 | 217 |
| 217 | 3300037418 | Ga0395900_0402732 | Ga0395900_0402732_25_708 | 217 |
| 218 | 3300037466 | Ga0395898_0106060 | Ga0395898_0106060_308_1000 | 217 |
| 219 | 3300037471 | Ga0395905_0328576 | Ga0395905_0328576_288_980 | 217 |
| 220 | 3300037471 | Ga0395905_0530967 | Ga0395905_0530967_14_688 | 217 |
| 221 | 3300038443 | Ga0395901_0216734 | Ga0395901_0216734_1070_1762 | 217 |
| 222 | 3300048918 | Ga0496115_0000643 | Ga0496115_0000643_18260_18964 | 217 |
| 223 | 3300049581 | Ga0501047_0002124 | Ga0501047_0002124_2128_2796 | 217 |
| 224 | 3300049581 | Ga0501047_0190243 | Ga0501047_0190243_139_822 | 217 |
| 225 | 3300005367 | Ga0070667_100014536 | Ga0070667_1000145366 | 218 |
| 226 | 3300006881 | Ga0068865_100000723 | Ga0068865_1000007236 | 218 |
| 227 | 3300013306 | Ga0163162_10307085 | Ga0163162_103070852 | 218 |
| 228 | 3300014325 | Ga0163163_10908136 | Ga0163163_109081362 | 218 |
| 229 | 3300025938 | Ga0207704_10001512 | Ga0207704_1000151212 | 218 |
| 230 | 3300025986 | Ga0207658_10006846 | Ga0207658_100068468 | 218 |
| 231 | 3300026095 | Ga0207676_10233415 | Ga0207676_102334152 | 218 |
| 232 | 3300048915 | Ga0496112_0027122 | Ga0496112_0027122_3781_4485 | 218 |
| 233 | 3300053108 | Ga0500562_000163 | Ga0500562_000163_15690_16361 | 218 |
| 234 | iso_pu_bacteria | 2643221598 | 2644002097 | 218 |
| 235 | 3300025250 | Ga0209026_1005573 | Ga0209026_10055732 | 219 |
| 236 | 3300026118 | Ga0207675_100509555 | Ga0207675_1005095552 | 220 |
| 237 | 3300005331 | Ga0070670_100000050 | Ga0070670_10000005019 | 221 |
| 238 | 3300005347 | Ga0070668_100001996 | Ga0070668_10000199614 | 221 |
| 239 | 3300005347 | Ga0070668_100032853 | Ga0070668_1000328533 | 221 |
| 240 | 3300005353 | Ga0070669_100000576 | Ga0070669_10000057625 | 221 |
| 241 | 3300005355 | Ga0070671_100000798 | Ga0070671_10000079820 | 221 |
| 242 | 3300005367 | Ga0070667_100000140 | Ga0070667_10000014040 | 221 |
| 243 | 3300005367 | Ga0070667_100002966 | Ga0070667_1000029663 | 221 |
| 244 | 3300005367 | Ga0070667_100372466 | Ga0070667_1003724662 | 221 |
| 245 | 3300005457 | Ga0070662_100212105 | Ga0070662_1002121052 | 221 |
| 246 | 3300005548 | Ga0070665_100007821 | Ga0070665_1000078213 | 221 |
| 247 | 3300005548 | Ga0070665_100044262 | Ga0070665_1000442622 | 221 |
| 248 | 3300005617 | Ga0068859_100000177 | Ga0068859_10000017725 | 221 |
| 249 | 3300005618 | Ga0068864_100000533 | Ga0068864_10000053317 | 221 |
| 250 | 3300005841 | Ga0068863_100002271 | Ga0068863_10000227119 | 221 |
| 251 | 3300005841 | Ga0068863_100005478 | Ga0068863_1000054782 | 221 |
| 252 | 3300005842 | Ga0068858_100001321 | Ga0068858_10000132113 | 221 |
| 253 | 3300005842 | Ga0068858_100020066 | Ga0068858_1000200665 | 221 |
| 254 | 3300005843 | Ga0068860_100000580 | Ga0068860_10000058018 | 221 |
| 255 | 3300005843 | Ga0068860_100045145 | Ga0068860_1000451454 | 221 |
| 256 | 3300005844 | Ga0068862_100000443 | Ga0068862_10000044329 | 221 |
| 257 | 3300006051 | Ga0075364_10003123 | Ga0075364_100031238 | 221 |
| 258 | 3300006178 | Ga0075367_10042007 | Ga0075367_100420071 | 221 |
| 259 | 3300006353 | Ga0075370_10231505 | Ga0075370_102315052 | 221 |
| 260 | 3300006931 | Ga0097620_100000177 | Ga0097620_10000017725 | 221 |
| 261 | 3300009101 | Ga0105247_10197719 | Ga0105247_101977191 | 221 |
| 262 | 3300009177 | Ga0105248_10003160 | Ga0105248_1000316011 | 221 |
| 263 | 3300009551 | Ga0105238_10673201 | Ga0105238_106732011 | 221 |
| 264 | 3300009553 | Ga0105249_10004149 | Ga0105249_1000414911 | 221 |
| 265 | 3300013306 | Ga0163162_10052631 | Ga0163162_100526313 | 221 |
| 266 | 3300014325 | Ga0163163_10005231 | Ga0163163_100052312 | 221 |
| 267 | 3300014968 | Ga0157379_10003393 | Ga0157379_100033936 | 221 |
| 268 | 3300014968 | Ga0157379_10026633 | Ga0157379_100266333 | 221 |
| 269 | 3300025914 | Ga0207671_10338259 | Ga0207671_103382592 | 221 |
| 270 | 3300025923 | Ga0207681_10057547 | Ga0207681_100575474 | 221 |
| 271 | 3300025925 | Ga0207650_10000062 | Ga0207650_10000062131 | 221 |
| 272 | 3300025925 | Ga0207650_10141537 | Ga0207650_101415372 | 221 |
| 273 | 3300025931 | Ga0207644_10002515 | Ga0207644_100025156 | 221 |
| 274 | 3300025941 | Ga0207711_10006520 | Ga0207711_100065208 | 221 |
| 275 | 3300025961 | Ga0207712_10002299 | Ga0207712_100022994 | 221 |
| 276 | 3300025972 | Ga0207668_10002636 | Ga0207668_1000263611 | 221 |
| 277 | 3300025972 | Ga0207668_10003086 | Ga0207668_100030864 | 221 |
| 278 | 3300025986 | Ga0207658_10000264 | Ga0207658_1000026440 | 221 |
| 279 | 3300026035 | Ga0207703_10003329 | Ga0207703_100033294 | 221 |
| 280 | 3300026088 | Ga0207641_10001512 | Ga0207641_1000151222 | 221 |
| 281 | 3300026088 | Ga0207641_10023715 | Ga0207641_100237155 | 221 |
| 282 | 3300026095 | Ga0207676_10000784 | Ga0207676_100007845 | 221 |
| 283 | 3300026118 | Ga0207675_100803510 | Ga0207675_1008035102 | 221 |
| 284 | 3300028379 | Ga0268266_10003594 | Ga0268266_1000359418 | 221 |
| 285 | 3300028379 | Ga0268266_10301322 | Ga0268266_103013221 | 221 |
| 286 | 3300028380 | Ga0268265_10002810 | Ga0268265_100028108 | 221 |
| 287 | 3300028381 | Ga0268264_10000358 | Ga0268264_1000035819 | 221 |
| 288 | 3300031456 | Ga0307513_10004817 | Ga0307513_1000481714 | 221 |
| 289 | 3300044842 | Ga0466957_0492522 | Ga0466957_0492522_49_747 | 221 |
| 290 | 3300046459 | Ga0495629_0258424 | Ga0495629_0258424_414_1112 | 221 |
| 291 | 3300047320 | Ga0495672_0039552 | Ga0495672_0039552_1022_1708 | 221 |
| 292 | 3300050491 | nmdc:mga00v17_2502_c1 | nmdc:mga00v17_2502_c1_3043_3735 | 221 |
| 293 | 3300050494 | nmdc:mga06z11_9004_c1 | nmdc:mga06z11_9004_c1_18_710 | 221 |
| 294 | 3300050496 | nmdc:mga07m45_66836_c1 | nmdc:mga07m45_66836_c1_1188_1880 | 221 |
| 295 | 3300053119 | Ga0500595_006788 | Ga0500595_006788_3886_4584 | 221 |
| 296 | 3300005334 | Ga0068869_100344141 | Ga0068869_1003441412 | 224 |
| 297 | 3300005539 | Ga0068853_100094286 | Ga0068853_1000942861 | 224 |
| 298 | 3300025942 | Ga0207689_10123981 | Ga0207689_101239812 | 224 |
| 299 | 3300026041 | Ga0207639_10038282 | Ga0207639_100382823 | 224 |
| 300 | 3300035692 | Ga0373935_0402243 | Ga0373935_0402243_73_765 | 224 |
| 301 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_273155_273862 | 224 |
| 302 | 3300047445 | Ga0495677_0037951 | Ga0495677_0037951_593_1300 | 224 |
| 303 | 3300005367 | Ga0070667_100265782 | Ga0070667_1002657821 | 225 |
| 304 | 3300025986 | Ga0207658_10437782 | Ga0207658_104377822 | 225 |
| 305 | 3300028800 | Ga0265338_10115021 | Ga0265338_101150213 | 225 |
| 306 | 3300028558 | Ga0265326_10059363 | Ga0265326_100593631 | 226 |
| 307 | 3300028800 | Ga0265338_10102268 | Ga0265338_101022683 | 226 |
| 308 | 3300031711 | Ga0265314_10016607 | Ga0265314_100166074 | 226 |
| 309 | 3300048918 | Ga0496115_0238866 | Ga0496115_0238866_19_726 | 226 |
| 310 | 3300021384 | Ga0213876_10011595 | Ga0213876_100115953 | 227 |
| 311 | 3300039437 | Ga0436365_1485304 | Ga0436365_1485304_1114_1815 | 227 |
| 312 | 3300005366 | Ga0070659_100001047 | Ga0070659_10000104722 | 232 |
| 313 | 3300025932 | Ga0207690_10002531 | Ga0207690_100025314 | 232 |
| 314 | 3300031711 | Ga0265314_10123510 | Ga0265314_101235102 | 232 |
| 315 | iso_pu_bacteria | 2582581279 | 2585145827 | 233 |
| 316 | iso_pu_bacteria | 2643221642 | 2644234867 | 233 |
| 317 | iso_pu_bacteria | 2857504554 | 2857509413 | 233 |
| 318 | iso_pu_bacteria | 2884960567 | 2884963026 | 233 |
| 319 | iso_pu_bacteria | 2928531327 | 2928532450 | 233 |
| 320 | 3300005339 | Ga0070660_100539820 | Ga0070660_1005398202 | 234 |
| 321 | 3300003781 | Ga0055536_1010997 | Ga0055536_10109972 | 237 |
| 322 | 3300003781 | Ga0055536_1011545 | Ga0055536_10115452 | 237 |
| 323 | 3300003791 | Ga0055530_10010169 | Ga0055530_100101692 | 237 |
| 324 | 3300003794 | Ga0055531_10002894 | Ga0055531_100028942 | 237 |
| 325 | 3300025292 | Ga0209676_1000099 | Ga0209676_100009948 | 237 |
| 326 | 3300025292 | Ga0209676_1000180 | Ga0209676_100018059 | 237 |
| 327 | 3300025298 | Ga0209050_1000319 | Ga0209050_100031963 | 237 |
| 328 | 3300025298 | Ga0209050_1007309 | Ga0209050_10073094 | 237 |
| 329 | 3300025303 | Ga0209051_1001724 | Ga0209051_100172412 | 237 |
| 330 | 3300025304 | Ga0209257_1000614 | Ga0209257_10006144 | 237 |
| 331 | 3300025304 | Ga0209257_1008323 | Ga0209257_10083235 | 237 |
| 332 | 3300028794 | Ga0307515_10077312 | Ga0307515_100773122 | 237 |
| 333 | 3300044706 | Ga0466964_0072816 | Ga0466964_0072816_454_1167 | 237 |
| 334 | 3300046460 | Ga0495638_0000764 | Ga0495638_0000764_3767_4480 | 237 |
| 335 | 3300046512 | Ga0495610_0005615 | Ga0495610_0005615_1257_1970 | 237 |
| 336 | 3300046524 | Ga0495648_0000399 | Ga0495648_0000399_40790_41503 | 237 |
| 337 | 3300046530 | Ga0495654_0094396 | Ga0495654_0094396_352_1065 | 237 |
| 338 | 3300046616 | Ga0495668_0009746 | Ga0495668_0009746_4594_5307 | 237 |
| 339 | 3300046660 | Ga0495625_0063542 | Ga0495625_0063542_1254_1967 | 237 |
| 340 | 3300047469 | Ga0495673_0000403 | Ga0495673_0000403_30838_31551 | 237 |
| 341 | 3300048924 | Ga0496121_0352884 | Ga0496121_0352884_197_910 | 237 |
| 342 | 3300048927 | Ga0496124_0011339 | Ga0496124_0011339_7688_8401 | 237 |
| 343 | 3300048928 | Ga0496125_0096949 | Ga0496125_0096949_989_1702 | 237 |
| 344 | 3300050496 | nmdc:mga07m45_150997_c1 | nmdc:mga07m45_150997_c1_531_1244 | 237 |
| 345 | 3300050516 | nmdc:mga0sz30_2139_c1 | nmdc:mga0sz30_2139_c1_6289_7002 | 237 |
| 346 | 3300053086 | Ga0500578_0000080 | Ga0500578_0000080_61440_62153 | 237 |
| 347 | 3300053088 | Ga0500644_0000218 | Ga0500644_0000218_2297_3010 | 237 |
| 348 | 3300053118 | Ga0500594_0000587 | Ga0500594_0000587_2001_2714 | 237 |
| 349 | 3300053122 | Ga0500608_000062 | Ga0500608_000062_35366_36079 | 237 |
| 350 | 3300053136 | Ga0500559_0045585 | Ga0500559_0045585_1129_1842 | 237 |
| 351 | 3300053138 | Ga0500564_000127 | Ga0500564_000127_11403_12116 | 237 |
| 352 | 3300053156 | Ga0500622_0000812 | Ga0500622_0000812_11762_12475 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vje-assembly2.cif.gz_B | crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a | 0.7707 | 7 | 235 |
| 2zcr-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 | 0.7694 | 7 | 235 |
| 5iys-assembly1.cif.gz_A | crystal structure of a dehydrosqualene synthase in complex with ligand | 0.7661 | 7 | 235 |
| 3adz-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp | 0.7565 | 7 | 235 |
| 3lgz-assembly1.cif.gz_B | crystal structure of dehydrosqualene synthase y129a from s. aureus complexed with presqualene pyrophosphate | 0.7536 | 7 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q17477_122_396_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8884 | 7 | 216 | 1.10.600.10 |
| af_B4FPS7_5_269_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.856 | 7 | 216 | 1.10.600.10 |
| af_Q330K2_57_309_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8499 | 7 | 228 | 1.10.600.10 |
| af_Q54E48_68_332_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8481 | 7 | 228 | 1.10.600.10 |
| 3w7fA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8025 | 7 | 235 | 1.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H3CB12-F1-model_v4 | Phytoene/squalene synthase family protein | 0.9984 | 1 | 237 |
GO:0005737
GO:0009058 GO:0043231 |
| AF-A0A2D2AX03-F1-model_v4 | Phytoene synthase | 0.964 | 1 | 237 |
GO:0009058
|
| AF-A0A2D2AX03-F1-model_v4 | Phytoene synthase | 0.9596 | 1 | 237 |
GO:0009058
|
| AF-A0A4Q3S3Q2-F1-model_v4 | Phytoene/squalene synthase family protein | 0.9524 | 7 | 237 |
GO:0009058
|
| AF-A0A6B3UQR3-F1-model_v4 | Squalene/phytoene synthase family protein | 0.9444 | 1 | 166 |
GO:0005737
GO:0009058 GO:0043231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar