F418938

General Info

Members Datasets Scaffolds Average Seq Length
352 245 342 271

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100015739|Ga0070699_1000157395
Length 241
Sequence MSTEADVGMVSADRPGKPAMPGTPVLEARGLVKTFGHVVGLAGVSLKLYPGEVLAIIGDNGAGKSTLIKCLSGALALDEGEILMDGEKIAFKSPVDARRAGPLGKFFRKLDTRGMRTAAKEQLNDLGIGTIQDITQKVETLSGGQRQAVAVARAAAFGSKVVILDEPTAALGVRESGQVLALIKRLRSRGMPVILISHNMPQVFEVADRIHIQRLGRCAGVITPQSHTMEEAVAIMTGARS

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
3 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
4 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
5 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
6 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
7 2902582711 Micromonospora sp. AP08 Isolate Unclassified
8 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
245 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 1.42
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 0.28
Rhizoplane 5.4
Rhizosphere 79.83
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008174 3300003203 Bacteria 4750
2 Ga0070658_10055943 3300005327 Bacteria 3205
3 Ga0070676_10056348 3300005328 Bacteria 2322
4 Ga0070683_100090594 3300005329 Bacteria 2871
5 Ga0068869_100004998 3300005334 Bacteria 8303
6 Ga0070680_100186940 3300005336 Bacteria 1745
7 Ga0070680_100214904 3300005336 Bacteria 1622
8 Ga0070682_100027686 3300005337 Bacteria 3403
9 Ga0068868_100010459 3300005338 Bacteria 6719
10 Ga0070691_10018796 3300005341 Bacteria 3186
11 Ga0070661_100047882 3300005344 Bacteria 3129
12 Ga0070675_100007030 3300005354 Bacteria 8653
13 Ga0070709_10365463 3300005434 Bacteria 1069
14 Ga0070714_100002117 3300005435 Bacteria 14575
15 Ga0070714_100249300 3300005435 Bacteria 1641
16 Ga0070711_100033010 3300005439 Bacteria 3445
17 Ga0070708_100013313 3300005445 Bacteria 6732
18 Ga0070663_100001111 3300005455 Bacteria 14785
19 Ga0070678_100467256 3300005456 Bacteria 1108
20 Ga0070662_100006107 3300005457 Bacteria 7740
21 Ga0070681_10142707 3300005458 Bacteria 2324
22 Ga0070706_100008989 3300005467 Bacteria 9301
23 Ga0070706_100013219 3300005467 Bacteria 7637
24 Ga0070706_100018856 3300005467 Bacteria 6363
25 Ga0070706_100295098 3300005467 Bacteria 1513
26 Ga0070707_100073649 3300005468 Bacteria 3293
27 Ga0070707_100075413 3300005468 Bacteria 3253
28 Ga0070698_100294819 3300005471 Bacteria 1553
29 Ga0070699_100000546 3300005518 Bacteria 35417
30 Ga0070699_100003016 3300005518 Bacteria 14946
31 Ga0070699_100015739 3300005518 Bacteria 6494
32 Ga0070679_100125922 3300005530 Bacteria 2544
33 Ga0070684_100001841 3300005535 Bacteria 15530
34 Ga0070684_100077955 3300005535 Bacteria 2927
35 Ga0070697_100005261 3300005536 Bacteria 9938
36 Ga0070697_100265624 3300005536 Bacteria 1470
37 Ga0070672_100153647 3300005543 Bacteria 1905
38 Ga0070693_100326118 3300005547 Bacteria 1043
39 Ga0070665_100206891 3300005548 Bacteria 1963
40 Ga0070704_100149942 3300005549 Bacteria 1832
41 Ga0068855_100004132 3300005563 Bacteria 17707
42 Ga0070664_100001559 3300005564 Bacteria 18311
43 Ga0068857_100039505 3300005577 Bacteria 4180
44 Ga0070702_100074953 3300005615 Bacteria 2009
45 Ga0068852_100253446 3300005616 Bacteria 1687
46 Ga0068852_100591072 3300005616 Bacteria 1114
47 Ga0068864_100159128 3300005618 Bacteria 2052
48 Ga0068870_10076713 3300005840 Bacteria 1836
49 Ga0068860_100109736 3300005843 Bacteria 2637
50 Ga0081539_10000111 3300005985 Bacteria 190245
51 Ga0081539_10000194 3300005985 Bacteria 141263
52 Ga0070717_10007757 3300006028 Bacteria 7985
53 Ga0070717_10013423 3300006028 Bacteria 6279
54 Ga0070717_10026972 3300006028 Bacteria 4588
55 Ga0075365_10001050 3300006038 Bacteria 11930
56 Ga0075365_10021384 3300006038 Bacteria 4036
57 Ga0075363_100045439 3300006048 Bacteria 2329
58 Ga0075364_10001701 3300006051 Bacteria 12086
59 Ga0075364_10001732 3300006051 Bacteria 12006
60 Ga0075364_10159579 3300006051 Bacteria 1522
61 Ga0075364_10314308 3300006051 Bacteria 1067
62 Ga0075367_10076486 3300006178 Bacteria 2020
63 Ga0075369_10030665 3300006186 Bacteria 2266
64 Ga0075370_10144436 3300006353 Bacteria 1392
65 Ga0075428_100004406 3300006844 Bacteria 15544
66 Ga0075428_100019551 3300006844 Bacteria 7494
67 Ga0075430_100015184 3300006846 Bacteria 6556
68 Ga0075431_100031132 3300006847 Bacteria 5495
69 Ga0075431_100611763 3300006847 Bacteria 1073
70 Ga0075429_100005125 3300006880 Bacteria 11266
71 Ga0075436_100302913 3300006914 Bacteria 1146
72 Ga0099795_10127916 3300007788 Bacteria 1022
73 Ga0105240_10006401 3300009093 Bacteria 17307
74 Ga0105240_10046269 3300009093 Bacteria 5514
75 Ga0111539_10002723 3300009094 Bacteria 23442
76 Ga0105245_10001764 3300009098 Bacteria 19712
77 Ga0105245_10501844 3300009098 Bacteria 1229
78 Ga0114129_10003796 3300009147 Bacteria 21298
79 Ga0105248_10730160 3300009177 Bacteria 1117
80 Ga0105238_10034196 3300009551 Bacteria 5172
81 Ga0105238_10416083 3300009551 Bacteria 1338
82 Ga0105238_10481751 3300009551 Bacteria 1240
83 Ga0105238_10888336 3300009551 Bacteria 909
84 Ga0105249_10049465 3300009553 Bacteria 3834
85 Ga0105239_10161219 3300010375 Bacteria 2505
86 Ga0105246_10055570 3300011119 Bacteria 2733
87 Ga0157370_10173280 3300013104 Bacteria 2005
88 Ga0157369_10092106 3300013105 Bacteria 3235
89 Ga0157375_10115896 3300013308 Bacteria 2783
90 Ga0157375_10203974 3300013308 Bacteria 2134
91 Ga0157375_10326743 3300013308 Bacteria 1699
92 Ga0163163_10190903 3300014325 Bacteria 2097
93 Ga0157377_10012159 3300014745 Bacteria 4321
94 Ga0206356_10450639 3300020070 Bacteria 2693
95 Ga0206354_11430158 3300020081 Bacteria 1981
96 Ga0213875_10000309 3300021388 Bacteria 46706
97 Ga0213875_10000738 3300021388 Bacteria 24848
98 Ga0213875_10015434 3300021388 Bacteria 3716
99 Ga0224712_10091565 3300022467 Bacteria 1275
100 Ga0207647_10097422 3300025904 Bacteria 1749
101 Ga0207699_10027708 3300025906 Bacteria 3140
102 Ga0207645_10066947 3300025907 Bacteria 2296
103 Ga0207705_10074040 3300025909 Bacteria 2472
104 Ga0207684_10000730 3300025910 Bacteria 38556
105 Ga0207684_10011695 3300025910 Bacteria 7657
106 Ga0207684_10191875 3300025910 Bacteria 1762
107 Ga0207684_10385585 3300025910 Bacteria 1205
108 Ga0207707_10018338 3300025912 Bacteria 6099
109 Ga0207695_10043208 3300025913 Bacteria 4804
110 Ga0207695_10215847 3300025913 Bacteria 1827
111 Ga0207671_10000138 3300025914 Bacteria 112019
112 Ga0207693_10077453 3300025915 Bacteria 2604
113 Ga0207663_10092020 3300025916 Bacteria 2015
114 Ga0207660_10086283 3300025917 Bacteria 2317
115 Ga0207649_10014963 3300025920 Bacteria 4355
116 Ga0207649_10338142 3300025920 Bacteria 1111
117 Ga0207652_10013279 3300025921 Bacteria 6668
118 Ga0207646_10016710 3300025922 Bacteria 6884
119 Ga0207646_10159104 3300025922 Bacteria 2038
120 Ga0207694_10066745 3300025924 Bacteria 2807
121 Ga0207694_10196529 3300025924 Bacteria 1640
122 Ga0207659_10052257 3300025926 Bacteria 2910
123 Ga0207687_10053577 3300025927 Bacteria 2819
124 Ga0207687_10465012 3300025927 Bacteria 1051
125 Ga0207664_10003042 3300025929 Bacteria 11156
126 Ga0207664_10167805 3300025929 Bacteria 1877
127 Ga0207706_10008235 3300025933 Bacteria 9621
128 Ga0207689_10056430 3300025942 Bacteria 3232
129 Ga0207661_10246744 3300025944 Bacteria 1586
130 Ga0207661_10461151 3300025944 Bacteria 1158
131 Ga0207679_10007149 3300025945 Bacteria 7070
132 Ga0207712_10047869 3300025961 Bacteria 2971
133 Ga0207668_10634542 3300025972 Bacteria 934
134 Ga0207640_10136017 3300025981 Bacteria 1784
135 Ga0207658_10458282 3300025986 Bacteria 1130
136 Ga0207677_10001246 3300026023 Bacteria 13738
137 Ga0207703_10107386 3300026035 Bacteria 2376
138 Ga0207678_10001627 3300026067 Bacteria 20595
139 Ga0207678_10063365 3300026067 Bacteria 3177
140 Ga0207648_10037420 3300026089 Bacteria 4274
141 Ga0207676_10069299 3300026095 Bacteria 2824
142 Ga0207674_10018192 3300026116 Bacteria 7647
143 Ga0207674_10055302 3300026116 Bacteria 4035
144 Ga0207683_10270314 3300026121 Bacteria 1553
145 Ga0207698_10096190 3300026142 Bacteria 2440
146 Ga0207698_10232279 3300026142 Bacteria 1675
147 Ga0207698_10581810 3300026142 Bacteria 1101
148 Ga0268266_10299191 3300028379 Bacteria 1500
149 Ga0268264_10139260 3300028381 Bacteria 2162
150 Ga0307517_10002771 3300028786 Bacteria 27879
151 Ga0307515_10000258 3300028794 Bacteria 131660
152 Ga0307511_10000481 3300030521 Bacteria 43338
153 Ga0307511_10073439 3300030521 Bacteria 2474
154 Ga0307513_10001948 3300031456 Bacteria 29204
155 Ga0307509_10040205 3300031507 Bacteria 5087
156 Ga0307509_10078907 3300031507 Bacteria 3409
157 Ga0307508_10117729 3300031616 Bacteria 2258
158 Ga0307516_10005436 3300031730 Bacteria 15245
159 Ga0307516_10010387 3300031730 Bacteria 10241
160 Ga0307518_10044160 3300031838 Bacteria 3243
161 Ga0307406_10000335 3300031901 Bacteria 27323
162 Ga0307412_10040178 3300031911 Bacteria 3026
163 Ga0307409_100057851 3300031995 Bacteria 3007
164 Ga0307409_100185225 3300031995 Bacteria 1847
165 Ga0307411_10001994 3300032005 Bacteria 8763
166 Ga0307415_100185930 3300032126 Bacteria 1635
167 Ga0307507_10013350 3300033179 Bacteria 9983
168 Ga0307507_10147311 3300033179 Bacteria 1784
169 Ga0307510_10027358 3300033180 Bacteria 6533
170 Ga0307510_10062268 3300033180 Bacteria 3814
171 Ga0373926_0030089 3300035083 Bacteria 1910
172 Ga0373936_0125496 3300035113 Bacteria 1100
173 Ga0373945_0045250 3300035116 Bacteria 1602
174 Ga0373943_0126679 3300035170 Bacteria 1362
175 Ga0373946_0059789 3300035171 Bacteria 1618
176 Ga0373924_0019603 3300035410 Bacteria 2622
177 Ga0373935_0117412 3300035692 Bacteria 1773
178 Ga0373935_0120660 3300035692 Bacteria 1751
179 Ga0373927_0194651 3300035695 Bacteria 1330
180 Ga0373947_0079515 3300035725 Bacteria 2026
181 Ga0373925_0003082 3300037068 Bacteria 13081
182 Ga0373925_0009862 3300037068 Bacteria 6938
183 Ga0373925_0074314 3300037068 Bacteria 2574
184 Ga0395899_0000277 3300037312 Bacteria 66861
185 Ga0395899_0199501 3300037312 Bacteria 1396
186 Ga0395898_0320566 3300037466 Bacteria 1478
187 Ga0436364_0141456 3300037853 Bacteria 107449
188 Ga0436364_0844372 3300037853 Bacteria 2552
189 Ga0436364_0896216 3300037853 Bacteria 15509
190 Ga0436365_0162386 3300039437 Bacteria 1538
191 Ga0436363_0789543 3300039450 Bacteria 1396
192 Ga0451853_3569602 3300041512 Bacteria 1336
193 Ga0439434_0041274 3300042435 Bacteria 1418
194 Ga0466972_0017065 3300044658 Bacteria 3632
195 Ga0466972_0027848 3300044658 Bacteria 2793
196 Ga0466972_0052792 3300044658 Bacteria 1958
197 Ga0466972_0115549 3300044658 Bacteria 1267
198 Ga0466965_0000151 3300044683 Bacteria 20572
199 Ga0466965_0057988 3300044683 Bacteria 1931
200 Ga0466965_0136211 3300044683 Bacteria 1276
201 Ga0466966_0000700 3300044684 Bacteria 21325
202 Ga0466961_0005971 3300044693 Bacteria 7716
203 Ga0466961_0042822 3300044693 Bacteria 2901
204 Ga0466961_0144027 3300044693 Bacteria 1491
205 Ga0466963_0011518 3300044694 Bacteria 5386
206 Ga0466971_0000447 3300044719 Bacteria 16147
207 Ga0466971_0151389 3300044719 Bacteria 1083
208 Ga0466970_0003794 3300044765 Bacteria 7400
209 Ga0466970_0062114 3300044765 Bacteria 2002
210 Ga0466970_0103134 3300044765 Bacteria 1554
211 Ga0466970_0112249 3300044765 Bacteria 1489
212 Ga0466970_0217058 3300044765 Bacteria 1067
213 Ga0466957_0000167 3300044842 Bacteria 29271
214 Ga0466960_0137499 3300044901 Bacteria 1295
215 Ga0466960_0213860 3300044901 Bacteria 1058
216 Ga0466959_0005592 3300045049 Bacteria 8639
217 Ga0466959_0223815 3300045049 Bacteria 1304
218 Ga0466958_0253798 3300045836 Bacteria 1125
219 Ga0466958_0439974 3300045836 Bacteria 844
220 Ga0466967_0000900 3300045976 Bacteria 15907
221 Ga0466967_0051237 3300045976 Bacteria 3617
222 Ga0466967_0117588 3300045976 Bacteria 2451
223 Ga0495592_0145456 3300046454 Bacteria 1644
224 Ga0495592_0154423 3300046454 Bacteria 1584
225 Ga0495603_0005272 3300046455 Bacteria 7713
226 Ga0495638_0083342 3300046460 Bacteria 1937
227 Ga0495638_0121324 3300046460 Bacteria 1544
228 Ga0495651_0000660 3300046462 Bacteria 26747
229 Ga0495651_0233020 3300046462 Bacteria 1267
230 Ga0495653_0063463 3300046463 Bacteria 2787
231 Ga0495582_0102435 3300046473 Bacteria 1603
232 Ga0495639_0008610 3300046475 Bacteria 4375
233 Ga0495594_0039618 3300046499 Bacteria 2577
234 Ga0495618_0090964 3300046514 Bacteria 1950
235 Ga0495628_0193066 3300046516 Bacteria 1537
236 Ga0495630_0098775 3300046517 Bacteria 2208
237 Ga0495652_0000783 3300046529 Bacteria 36627
238 Ga0495652_0089894 3300046529 Bacteria 2513
239 Ga0495652_0093909 3300046529 Bacteria 2448
240 Ga0495665_0000407 3300046531 Bacteria 21941
241 Ga0495645_0066804 3300046543 Bacteria 2597
242 Ga0495622_0040310 3300046557 Bacteria 2174
243 Ga0495667_0035717 3300046559 Bacteria 3320
244 Ga0495635_0007249 3300046663 Bacteria 7748
245 Ga0495588_0021641 3300046674 Bacteria 3171
246 Ga0495657_0113868 3300046675 Bacteria 1710
247 Ga0495623_0019955 3300046679 Bacteria 4333
248 Ga0495658_0007628 3300046683 Bacteria 5362
249 Ga0495613_0024873 3300046689 Bacteria 4462
250 Ga0495613_0035304 3300046689 Bacteria 3711
251 Ga0495600_0057706 3300046809 Bacteria 2535
252 Ga0495674_0101062 3300047319 Bacteria 2453
253 Ga0495676_0106899 3300047321 Bacteria 2061
254 Ga0495676_0121772 3300047321 Bacteria 1897
255 Ga0495680_0005606 3300047322 Bacteria 11769
256 Ga0495687_001818 3300047443 Bacteria 18758
257 Ga0495687_019933 3300047443 Bacteria 3278
258 Ga0495681_0000899 3300047470 Bacteria 22984
259 Ga0495684_0110978 3300047471 Bacteria 2069
260 Ga0495684_0178221 3300047471 Bacteria 1577
261 Ga0495686_0110238 3300047472 Bacteria 1651
262 Ga0495593_0000111 3300047673 Bacteria 38262
263 Ga0495602_0045873 3300048088 Bacteria 3952
264 Ga0495602_0095508 3300048088 Bacteria 2454
265 Ga0495614_0000527 3300048089 Bacteria 15768
266 Ga0496101_0107003 3300048904 Bacteria 2101
267 Ga0496104_0051661 3300048907 Bacteria 3880
268 Ga0496104_0199133 3300048907 Bacteria 1915
269 Ga0496105_0128868 3300048908 Bacteria 2087
270 Ga0496105_0207933 3300048908 Bacteria 1596
271 Ga0496105_0566519 3300048908 Bacteria 885
272 Ga0496108_0007569 3300048911 Bacteria 8797
273 Ga0496108_0094641 3300048911 Bacteria 2543
274 Ga0496108_0113675 3300048911 Bacteria 2317
275 Ga0496108_0695849 3300048911 Bacteria 882
276 Ga0496109_0077342 3300048912 Bacteria 3062
277 Ga0496109_0158254 3300048912 Bacteria 2122
278 Ga0496110_0029753 3300048913 Bacteria 4704
279 Ga0496110_0145900 3300048913 Bacteria 2140
280 Ga0496111_0018006 3300048914 Bacteria 4887
281 Ga0496112_0412363 3300048915 Bacteria 1290
282 Ga0496114_0004761 3300048917 Bacteria 10564
283 Ga0496114_0064171 3300048917 Bacteria 3075
284 Ga0496115_0180003 3300048918 Bacteria 1748
285 Ga0501031_0001624 3300049568 Bacteria 14068
286 Ga0501031_0262232 3300049568 Bacteria 1123
287 Ga0501032_0000056 3300049569 Bacteria 98236
288 Ga0501033_0001130 3300049570 Bacteria 24171
289 Ga0501034_0001982 3300049571 Bacteria 25917
290 Ga0501036_0000057 3300049572 Bacteria 72542
291 Ga0501036_0034272 3300049572 Bacteria 4294
292 Ga0501037_0003905 3300049573 Bacteria 10814
293 Ga0501038_0016991 3300049574 Bacteria 6584
294 Ga0501038_0060603 3300049574 Bacteria 3238
295 Ga0501039_0000623 3300049575 Bacteria 25628
296 Ga0501042_0268670 3300049578 Bacteria 1231
297 Ga0501043_0000755 3300049579 Bacteria 28766
298 Ga0501046_0000701 3300049580 Bacteria 32353
299 Ga0501047_0008315 3300049581 Bacteria 9792
300 Ga0501047_0011709 3300049581 Bacteria 8293
301 Ga0501047_0053647 3300049581 Bacteria 3899
302 Ga0501048_0000016 3300049582 Bacteria 72612
303 Ga0501067_0035696 3300049583 Bacteria 2760
304 Ga0501067_0191643 3300049583 Bacteria 1139
305 Ga0501067_0280946 3300049583 Bacteria 927
306 Ga0501068_0013160 3300049584 Bacteria 4703
307 Ga0501069_0005920 3300049585 Bacteria 6374
308 Ga0501070_0001292 3300049586 Bacteria 22464
309 Ga0501072_0190630 3300049588 Bacteria 1635
310 Ga0501073_0004931 3300049589 Bacteria 10017
311 Ga0501074_0003175 3300049590 Bacteria 11593
312 Ga0501080_0006298 3300049742 Bacteria 10649
313 Ga0501083_0000047 3300049744 Bacteria 88014
314 Ga0501083_0019629 3300049744 Bacteria 4708
315 Ga0501035_0000262 3300049822 Bacteria 62472
316 Ga0501044_0000312 3300049823 Bacteria 61322
317 Ga0501044_0200895 3300049823 Bacteria 1952
318 nmdc:mga03683_14544_c1 3300050489 Bacteria 2914
319 nmdc:mga03683_39314_c1 3300050489 Bacteria 1936
320 nmdc:mga00v17_3038_c1 3300050491 Bacteria 8628
321 nmdc:mga00v17_3223_c1 3300050491 Bacteria 8405
322 nmdc:mga0yw44_2669_c1 3300050492 Bacteria 7694
323 nmdc:mga0yw44_334469_c1 3300050492 Bacteria 1018
324 nmdc:mga04h51_20207_c1 3300050495 Bacteria 1984
325 nmdc:mga07m45_267034_c1 3300050496 Bacteria 995
326 nmdc:mga05p37_13675_c1 3300050507 Bacteria 9725
327 nmdc:mga08y16_5370_c1 3300050511 Bacteria 13400
328 nmdc:mga08x19_82662_c1 3300050514 Bacteria 2110
329 Ga0495601_0058900 3300053077 Bacteria 2435
330 Ga0495612_0006198 3300053078 Bacteria 4922
331 Ga0495619_0030606 3300053085 Bacteria 3484
332 Ga0500660_052779 3300053100 Bacteria 2001
333 Ga0500660_108760 3300053100 Bacteria 1188
334 Ga0500616_0000394 3300053153 Bacteria 60261
335 Ga0500616_0006375 3300053153 Bacteria 7738
336 Ga0500630_075728 3300053159 Bacteria 1584
337 Ga0501084_0000906 3300054114 Bacteria 22888
338 Ga0587077_010874 3300059493 Bacteria 1418
339 Ga0587091_019789 3300059511 Bacteria 1161
340 Ga0466962_0003732 3300061719 Bacteria 7266
341 Ga0466962_0009791 3300061719 Bacteria 4598
342 Ga0466962_0147419 3300061719 Bacteria 1141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100015739 Ga0070699_1000157395 222
2 3300042435 Ga0439434_0041274 Ga0439434_0041274_149_877 241
3 3300006844 Ga0075428_100004406 Ga0075428_1000044063 246
4 3300006846 Ga0075430_100015184 Ga0075430_1000151844 246
5 3300006847 Ga0075431_100031132 Ga0075431_1000311326 246
6 3300006880 Ga0075429_100005125 Ga0075429_1000051253 246
7 3300053100 Ga0500660_108760 Ga0500660_108760_395_1174 248
8 3300013308 Ga0157375_10203974 Ga0157375_102039742 249
9 3300048904 Ga0496101_0107003 Ga0496101_0107003_561_1361 249
10 iso_pu_bacteria 2884994152 2884995954 250
11 3300007788 Ga0099795_10127916 Ga0099795_101279161 252
12 3300035113 Ga0373936_0125496 Ga0373936_0125496_42_800 252
13 3300047321 Ga0495676_0106899 Ga0495676_0106899_249_1028 252
14 3300005327 Ga0070658_10055943 Ga0070658_100559432 253
15 3300005329 Ga0070683_100090594 Ga0070683_1000905942 253
16 3300005336 Ga0070680_100214904 Ga0070680_1002149041 253
17 3300005337 Ga0070682_100027686 Ga0070682_1000276862 253
18 3300005341 Ga0070691_10018796 Ga0070691_100187962 253
19 3300005458 Ga0070681_10142707 Ga0070681_101427072 253
20 3300005530 Ga0070679_100125922 Ga0070679_1001259224 253
21 3300005535 Ga0070684_100077955 Ga0070684_1000779552 253
22 3300005563 Ga0068855_100004132 Ga0068855_1000041322 253
23 3300009093 Ga0105240_10046269 Ga0105240_100462696 253
24 3300009551 Ga0105238_10481751 Ga0105238_104817512 253
25 3300013104 Ga0157370_10173280 Ga0157370_101732802 253
26 3300013105 Ga0157369_10092106 Ga0157369_100921063 253
27 3300020070 Ga0206356_10450639 Ga0206356_104506393 253
28 3300020081 Ga0206354_11430158 Ga0206354_114301582 253
29 3300025904 Ga0207647_10097422 Ga0207647_100974222 253
30 3300025909 Ga0207705_10074040 Ga0207705_100740402 253
31 3300025912 Ga0207707_10018338 Ga0207707_100183385 253
32 3300025913 Ga0207695_10215847 Ga0207695_102158472 253
33 3300025917 Ga0207660_10086283 Ga0207660_100862833 253
34 3300025920 Ga0207649_10338142 Ga0207649_103381422 253
35 3300025921 Ga0207652_10013279 Ga0207652_100132792 253
36 3300025924 Ga0207694_10196529 Ga0207694_101965292 253
37 3300025972 Ga0207668_10634542 Ga0207668_106345421 253
38 3300026067 Ga0207678_10063365 Ga0207678_100633652 253
39 3300026116 Ga0207674_10055302 Ga0207674_100553022 253
40 3300044693 Ga0466961_0005971 Ga0466961_0005971_3543_4358 253
41 3300047472 Ga0495686_0110238 Ga0495686_0110238_122_895 253
42 3300049744 Ga0501083_0000047 Ga0501083_0000047_53135_53953 253
43 3300050492 nmdc:mga0yw44_334469_c1 nmdc:mga0yw44_334469_c1_18_779 253
44 3300053077 Ga0495601_0058900 Ga0495601_0058900_976_1764 253
45 3300053153 Ga0500616_0000394 Ga0500616_0000394_31478_32251 253
46 iso_pu_bacteria 2852677369 2852678379 253
47 3300009093 Ga0105240_10006401 Ga0105240_1000640116 254
48 3300009551 Ga0105238_10034196 Ga0105238_100341964 254
49 3300010375 Ga0105239_10161219 Ga0105239_101612192 254
50 3300025913 Ga0207695_10043208 Ga0207695_100432083 254
51 3300025914 Ga0207671_10000138 Ga0207671_1000013839 254
52 3300025924 Ga0207694_10066745 Ga0207694_100667453 254
53 3300028786 Ga0307517_10002771 Ga0307517_100027715 254
54 3300028794 Ga0307515_10000258 Ga0307515_1000025877 254
55 3300031730 Ga0307516_10010387 Ga0307516_100103879 254
56 3300041512 Ga0451853_3569602 Ga0451853_3569602_405_1199 254
57 3300045836 Ga0466958_0439974 Ga0466958_0439974_31_804 254
58 3300048908 Ga0496105_0566519 Ga0496105_0566519_95_874 254
59 3300049581 Ga0501047_0011709 Ga0501047_0011709_3225_4010 254
60 3300049823 Ga0501044_0200895 Ga0501044_0200895_520_1305 254
61 3300059511 Ga0587091_019789 Ga0587091_019789_178_981 254
62 3300025915 Ga0207693_10077453 Ga0207693_100774533 255
63 3300031911 Ga0307412_10040178 Ga0307412_100401782 255
64 3300033179 Ga0307507_10013350 Ga0307507_100133504 255
65 3300033179 Ga0307507_10147311 Ga0307507_101473112 255
66 3300047470 Ga0495681_0000899 Ga0495681_0000899_2069_2881 255
67 3300048911 Ga0496108_0695849 Ga0496108_0695849_26_832 255
68 3300048915 Ga0496112_0412363 Ga0496112_0412363_24_824 255
69 iso_pu_bacteria 2582581314 2585317111 255
70 iso_pu_bacteria 2808606375 2808917224 255
71 iso_pu_bacteria 8056829672 8056832937 255
72 3300005467 Ga0070706_100008989 Ga0070706_1000089895 256
73 3300005548 Ga0070665_100206891 Ga0070665_1002068912 256
74 3300005985 Ga0081539_10000111 Ga0081539_1000011142 256
75 3300006028 Ga0070717_10013423 Ga0070717_100134235 256
76 3300009551 Ga0105238_10888336 Ga0105238_108883361 256
77 3300025910 Ga0207684_10000730 Ga0207684_1000073015 256
78 3300028379 Ga0268266_10299191 Ga0268266_102991912 256
79 3300030521 Ga0307511_10000481 Ga0307511_1000048112 256
80 3300030521 Ga0307511_10073439 Ga0307511_100734393 256
81 3300031507 Ga0307509_10078907 Ga0307509_100789073 256
82 3300031730 Ga0307516_10005436 Ga0307516_1000543615 256
83 3300031838 Ga0307518_10044160 Ga0307518_100441602 256
84 3300032005 Ga0307411_10001994 Ga0307411_1000199410 256
85 3300033180 Ga0307510_10027358 Ga0307510_100273584 256
86 3300033180 Ga0307510_10062268 Ga0307510_100622685 256
87 3300044658 Ga0466972_0052792 Ga0466972_0052792_805_1608 256
88 3300044693 Ga0466961_0042822 Ga0466961_0042822_315_1118 256
89 3300044719 Ga0466971_0151389 Ga0466971_0151389_25_828 256
90 3300045049 Ga0466959_0223815 Ga0466959_0223815_328_1110 256
91 3300046460 Ga0495638_0121324 Ga0495638_0121324_241_1023 256
92 3300046689 Ga0495613_0024873 Ga0495613_0024873_649_1452 256
93 3300047443 Ga0495687_001818 Ga0495687_001818_705_1508 256
94 3300047443 Ga0495687_019933 Ga0495687_019933_833_1636 256
95 3300048907 Ga0496104_0051661 Ga0496104_0051661_2594_3409 256
96 3300048908 Ga0496105_0207933 Ga0496105_0207933_173_988 256
97 3300048917 Ga0496114_0004761 Ga0496114_0004761_6275_7090 256
98 3300049572 Ga0501036_0034272 Ga0501036_0034272_1394_2188 256
99 3300049574 Ga0501038_0060603 Ga0501038_0060603_1370_2164 256
100 3300049581 Ga0501047_0053647 Ga0501047_0053647_1582_2376 256
101 3300053100 Ga0500660_052779 Ga0500660_052779_369_1172 256
102 3300053159 Ga0500630_075728 Ga0500630_075728_540_1343 256
103 3300061719 Ga0466962_0003732 Ga0466962_0003732_389_1192 256
104 iso_pu_bacteria 2784746768 2785365998 256
105 3300006844 Ga0075428_100019551 Ga0075428_1000195512 257
106 3300006847 Ga0075431_100611763 Ga0075431_1006117632 257
107 3300025981 Ga0207640_10136017 Ga0207640_101360172 257
108 3300031901 Ga0307406_10000335 Ga0307406_1000033515 257
109 3300035083 Ga0373926_0030089 Ga0373926_0030089_449_1255 257
110 3300035170 Ga0373943_0126679 Ga0373943_0126679_511_1317 257
111 3300035171 Ga0373946_0059789 Ga0373946_0059789_167_973 257
112 3300035692 Ga0373935_0120660 Ga0373935_0120660_534_1340 257
113 3300035695 Ga0373927_0194651 Ga0373927_0194651_148_954 257
114 3300037068 Ga0373925_0003082 Ga0373925_0003082_676_1482 257
115 3300044658 Ga0466972_0027848 Ga0466972_0027848_948_1754 257
116 3300044683 Ga0466965_0000151 Ga0466965_0000151_14744_15550 257
117 3300044684 Ga0466966_0000700 Ga0466966_0000700_15969_16775 257
118 3300044694 Ga0466963_0011518 Ga0466963_0011518_1104_1910 257
119 3300044719 Ga0466971_0000447 Ga0466971_0000447_11540_12346 257
120 3300044765 Ga0466970_0003794 Ga0466970_0003794_5500_6306 257
121 3300044765 Ga0466970_0112249 Ga0466970_0112249_133_939 257
122 3300044842 Ga0466957_0000167 Ga0466957_0000167_10036_10842 257
123 3300045049 Ga0466959_0005592 Ga0466959_0005592_6269_7075 257
124 3300045976 Ga0466967_0000900 Ga0466967_0000900_1135_1941 257
125 3300046455 Ga0495603_0005272 Ga0495603_0005272_6891_7697 257
126 3300046462 Ga0495651_0233020 Ga0495651_0233020_435_1238 257
127 3300046473 Ga0495582_0102435 Ga0495582_0102435_607_1413 257
128 3300046475 Ga0495639_0008610 Ga0495639_0008610_318_1124 257
129 3300046517 Ga0495630_0098775 Ga0495630_0098775_435_1241 257
130 3300046529 Ga0495652_0093909 Ga0495652_0093909_1323_2105 257
131 3300046531 Ga0495665_0000407 Ga0495665_0000407_14453_15259 257
132 3300046557 Ga0495622_0040310 Ga0495622_0040310_988_1794 257
133 3300046674 Ga0495588_0021641 Ga0495588_0021641_2180_2986 257
134 3300046683 Ga0495658_0007628 Ga0495658_0007628_3436_4242 257
135 3300046689 Ga0495613_0035304 Ga0495613_0035304_531_1337 257
136 3300047673 Ga0495593_0000111 Ga0495593_0000111_30896_31702 257
137 3300048089 Ga0495614_0000527 Ga0495614_0000527_2758_3564 257
138 3300048911 Ga0496108_0094641 Ga0496108_0094641_737_1531 257
139 3300050496 nmdc:mga07m45_267034_c1 nmdc:mga07m45_267034_c1_157_963 257
140 3300053085 Ga0495619_0030606 Ga0495619_0030606_131_913 257
141 3300061719 Ga0466962_0009791 Ga0466962_0009791_3605_4411 257
142 3300005434 Ga0070709_10365463 Ga0070709_103654631 258
143 3300005435 Ga0070714_100002117 Ga0070714_1000021176 258
144 3300005435 Ga0070714_100249300 Ga0070714_1002493004 258
145 3300005439 Ga0070711_100033010 Ga0070711_1000330103 258
146 3300005445 Ga0070708_100013313 Ga0070708_1000133136 258
147 3300005456 Ga0070678_100467256 Ga0070678_1004672561 258
148 3300005467 Ga0070706_100013219 Ga0070706_1000132196 258
149 3300005468 Ga0070707_100073649 Ga0070707_1000736492 258
150 3300005518 Ga0070699_100000546 Ga0070699_10000054626 258
151 3300005536 Ga0070697_100005261 Ga0070697_1000052614 258
152 3300006028 Ga0070717_10007757 Ga0070717_100077574 258
153 3300006028 Ga0070717_10026972 Ga0070717_100269724 258
154 3300006038 Ga0075365_10001050 Ga0075365_100010504 258
155 3300006038 Ga0075365_10021384 Ga0075365_100213844 258
156 3300006048 Ga0075363_100045439 Ga0075363_1000454392 258
157 3300006051 Ga0075364_10001701 Ga0075364_100017016 258
158 3300006051 Ga0075364_10001732 Ga0075364_100017324 258
159 3300006051 Ga0075364_10314308 Ga0075364_103143082 258
160 3300006178 Ga0075367_10076486 Ga0075367_100764862 258
161 3300006186 Ga0075369_10030665 Ga0075369_100306653 258
162 3300006353 Ga0075370_10144436 Ga0075370_101444362 258
163 3300006914 Ga0075436_100302913 Ga0075436_1003029132 258
164 3300009147 Ga0114129_10003796 Ga0114129_100037963 258
165 3300025906 Ga0207699_10027708 Ga0207699_100277084 258
166 3300025910 Ga0207684_10011695 Ga0207684_100116953 258
167 3300025916 Ga0207663_10092020 Ga0207663_100920202 258
168 3300025929 Ga0207664_10003042 Ga0207664_100030428 258
169 3300025929 Ga0207664_10167805 Ga0207664_101678052 258
170 3300026121 Ga0207683_10270314 Ga0207683_102703142 258
171 3300037068 Ga0373925_0009862 Ga0373925_0009862_1511_2401 258
172 3300037312 Ga0395899_0000277 Ga0395899_0000277_46222_47031 258
173 3300037312 Ga0395899_0199501 Ga0395899_0199501_146_943 258
174 3300037466 Ga0395898_0320566 Ga0395898_0320566_94_891 258
175 3300044658 Ga0466972_0115549 Ga0466972_0115549_346_1131 258
176 3300045976 Ga0466967_0117588 Ga0466967_0117588_33_848 258
177 3300047471 Ga0495684_0178221 Ga0495684_0178221_82_1008 258
178 3300050489 nmdc:mga03683_14544_c1 nmdc:mga03683_14544_c1_1584_2399 258
179 3300050489 nmdc:mga03683_39314_c1 nmdc:mga03683_39314_c1_1117_1911 258
180 3300050491 nmdc:mga00v17_3038_c1 nmdc:mga00v17_3038_c1_4838_5632 258
181 3300050491 nmdc:mga00v17_3223_c1 nmdc:mga00v17_3223_c1_1246_2061 258
182 3300050492 nmdc:mga0yw44_2669_c1 nmdc:mga0yw44_2669_c1_2191_3006 258
183 3300050495 nmdc:mga04h51_20207_c1 nmdc:mga04h51_20207_c1_973_1788 258
184 3300050507 nmdc:mga05p37_13675_c1 nmdc:mga05p37_13675_c1_2271_3059 258
185 3300050514 nmdc:mga08x19_82662_c1 nmdc:mga08x19_82662_c1_1002_1856 258
186 3300061719 Ga0466962_0147419 Ga0466962_0147419_109_903 258
187 iso_pu_bacteria 8055412473 8055417200 258
188 3300003203 JGI25406J46586_10008174 JGI25406J46586_100081744 259
189 3300005328 Ga0070676_10056348 Ga0070676_100563482 259
190 3300005334 Ga0068869_100004998 Ga0068869_1000049988 259
191 3300005336 Ga0070680_100186940 Ga0070680_1001869401 259
192 3300005338 Ga0068868_100010459 Ga0068868_1000104595 259
193 3300005344 Ga0070661_100047882 Ga0070661_1000478822 259
194 3300005354 Ga0070675_100007030 Ga0070675_1000070302 259
195 3300005455 Ga0070663_100001111 Ga0070663_10000111111 259
196 3300005457 Ga0070662_100006107 Ga0070662_1000061077 259
197 3300005467 Ga0070706_100018856 Ga0070706_1000188564 259
198 3300005467 Ga0070706_100295098 Ga0070706_1002950982 259
199 3300005468 Ga0070707_100075413 Ga0070707_1000754132 259
200 3300005471 Ga0070698_100294819 Ga0070698_1002948192 259
201 3300005518 Ga0070699_100003016 Ga0070699_1000030164 259
202 3300005535 Ga0070684_100001841 Ga0070684_10000184116 259
203 3300005536 Ga0070697_100265624 Ga0070697_1002656242 259
204 3300005543 Ga0070672_100153647 Ga0070672_1001536472 259
205 3300005547 Ga0070693_100326118 Ga0070693_1003261181 259
206 3300005549 Ga0070704_100149942 Ga0070704_1001499421 259
207 3300005564 Ga0070664_100001559 Ga0070664_10000155916 259
208 3300005577 Ga0068857_100039505 Ga0068857_1000395053 259
209 3300005615 Ga0070702_100074953 Ga0070702_1000749532 259
210 3300005616 Ga0068852_100253446 Ga0068852_1002534462 259
211 3300005616 Ga0068852_100591072 Ga0068852_1005910721 259
212 3300005618 Ga0068864_100159128 Ga0068864_1001591282 259
213 3300005840 Ga0068870_10076713 Ga0068870_100767131 259
214 3300005843 Ga0068860_100109736 Ga0068860_1001097362 259
215 3300005985 Ga0081539_10000194 Ga0081539_1000019411 259
216 3300006051 Ga0075364_10159579 Ga0075364_101595792 259
217 3300009094 Ga0111539_10002723 Ga0111539_1000272321 259
218 3300009098 Ga0105245_10001764 Ga0105245_1000176415 259
219 3300009098 Ga0105245_10501844 Ga0105245_105018442 259
220 3300009177 Ga0105248_10730160 Ga0105248_107301601 259
221 3300009551 Ga0105238_10416083 Ga0105238_104160831 259
222 3300009553 Ga0105249_10049465 Ga0105249_100494652 259
223 3300011119 Ga0105246_10055570 Ga0105246_100555702 259
224 3300013308 Ga0157375_10115896 Ga0157375_101158962 259
225 3300013308 Ga0157375_10326743 Ga0157375_103267432 259
226 3300014325 Ga0163163_10190903 Ga0163163_101909032 259
227 3300014745 Ga0157377_10012159 Ga0157377_100121592 259
228 3300021388 Ga0213875_10000309 Ga0213875_1000030928 259
229 3300021388 Ga0213875_10000738 Ga0213875_1000073823 259
230 3300021388 Ga0213875_10015434 Ga0213875_100154343 259
231 3300022467 Ga0224712_10091565 Ga0224712_100915652 259
232 3300025907 Ga0207645_10066947 Ga0207645_100669472 259
233 3300025910 Ga0207684_10191875 Ga0207684_101918752 259
234 3300025910 Ga0207684_10385585 Ga0207684_103855852 259
235 3300025920 Ga0207649_10014963 Ga0207649_100149632 259
236 3300025922 Ga0207646_10016710 Ga0207646_100167103 259
237 3300025922 Ga0207646_10159104 Ga0207646_101591042 259
238 3300025926 Ga0207659_10052257 Ga0207659_100522572 259
239 3300025927 Ga0207687_10053577 Ga0207687_100535771 259
240 3300025927 Ga0207687_10465012 Ga0207687_104650121 259
241 3300025933 Ga0207706_10008235 Ga0207706_100082355 259
242 3300025942 Ga0207689_10056430 Ga0207689_100564302 259
243 3300025944 Ga0207661_10246744 Ga0207661_102467442 259
244 3300025944 Ga0207661_10461151 Ga0207661_104611511 259
245 3300025945 Ga0207679_10007149 Ga0207679_100071495 259
246 3300025961 Ga0207712_10047869 Ga0207712_100478693 259
247 3300025986 Ga0207658_10458282 Ga0207658_104582822 259
248 3300026023 Ga0207677_10001246 Ga0207677_100012463 259
249 3300026035 Ga0207703_10107386 Ga0207703_101073863 259
250 3300026067 Ga0207678_10001627 Ga0207678_1000162716 259
251 3300026089 Ga0207648_10037420 Ga0207648_100374204 259
252 3300026095 Ga0207676_10069299 Ga0207676_100692993 259
253 3300026116 Ga0207674_10018192 Ga0207674_100181923 259
254 3300026142 Ga0207698_10096190 Ga0207698_100961903 259
255 3300026142 Ga0207698_10232279 Ga0207698_102322792 259
256 3300026142 Ga0207698_10581810 Ga0207698_105818102 259
257 3300028381 Ga0268264_10139260 Ga0268264_101392602 259
258 3300031456 Ga0307513_10001948 Ga0307513_100019485 259
259 3300031507 Ga0307509_10040205 Ga0307509_100402051 259
260 3300031616 Ga0307508_10117729 Ga0307508_101177292 259
261 3300031995 Ga0307409_100057851 Ga0307409_1000578512 259
262 3300031995 Ga0307409_100185225 Ga0307409_1001852252 259
263 3300032126 Ga0307415_100185930 Ga0307415_1001859301 259
264 3300035116 Ga0373945_0045250 Ga0373945_0045250_208_1071 259
265 3300035410 Ga0373924_0019603 Ga0373924_0019603_1147_2007 259
266 3300035692 Ga0373935_0117412 Ga0373935_0117412_24_908 259
267 3300035725 Ga0373947_0079515 Ga0373947_0079515_536_1399 259
268 3300037068 Ga0373925_0074314 Ga0373925_0074314_1198_2061 259
269 3300037853 Ga0436364_0141456 Ga0436364_0141456_29892_30818 259
270 3300037853 Ga0436364_0844372 Ga0436364_0844372_933_1799 259
271 3300037853 Ga0436364_0896216 Ga0436364_0896216_4976_5866 259
272 3300039437 Ga0436365_0162386 Ga0436365_0162386_29_910 259
273 3300039450 Ga0436363_0789543 Ga0436363_0789543_488_1309 259
274 3300044658 Ga0466972_0017065 Ga0466972_0017065_437_1288 259
275 3300044683 Ga0466965_0057988 Ga0466965_0057988_679_1530 259
276 3300044683 Ga0466965_0136211 Ga0466965_0136211_370_1197 259
277 3300044693 Ga0466961_0144027 Ga0466961_0144027_387_1214 259
278 3300044765 Ga0466970_0062114 Ga0466970_0062114_642_1493 259
279 3300044765 Ga0466970_0103134 Ga0466970_0103134_698_1525 259
280 3300044765 Ga0466970_0217058 Ga0466970_0217058_112_936 259
281 3300044901 Ga0466960_0137499 Ga0466960_0137499_445_1269 259
282 3300044901 Ga0466960_0213860 Ga0466960_0213860_91_918 259
283 3300045836 Ga0466958_0253798 Ga0466958_0253798_143_1009 259
284 3300045976 Ga0466967_0051237 Ga0466967_0051237_755_1606 259
285 3300046454 Ga0495592_0145456 Ga0495592_0145456_721_1539 259
286 3300046454 Ga0495592_0154423 Ga0495592_0154423_17_901 259
287 3300046460 Ga0495638_0083342 Ga0495638_0083342_176_1030 259
288 3300046462 Ga0495651_0000660 Ga0495651_0000660_22476_23273 259
289 3300046463 Ga0495653_0063463 Ga0495653_0063463_1105_1968 259
290 3300046499 Ga0495594_0039618 Ga0495594_0039618_950_1750 259
291 3300046514 Ga0495618_0090964 Ga0495618_0090964_1073_1936 259
292 3300046516 Ga0495628_0193066 Ga0495628_0193066_668_1486 259
293 3300046529 Ga0495652_0000783 Ga0495652_0000783_7272_8090 259
294 3300046529 Ga0495652_0089894 Ga0495652_0089894_1117_1977 259
295 3300046543 Ga0495645_0066804 Ga0495645_0066804_1691_2488 259
296 3300046559 Ga0495667_0035717 Ga0495667_0035717_773_1654 259
297 3300046663 Ga0495635_0007249 Ga0495635_0007249_4193_5011 259
298 3300046675 Ga0495657_0113868 Ga0495657_0113868_34_918 259
299 3300046679 Ga0495623_0019955 Ga0495623_0019955_3338_4135 259
300 3300046809 Ga0495600_0057706 Ga0495600_0057706_277_1074 259
301 3300047319 Ga0495674_0101062 Ga0495674_0101062_307_1191 259
302 3300047321 Ga0495676_0121772 Ga0495676_0121772_375_1232 259
303 3300047322 Ga0495680_0005606 Ga0495680_0005606_10086_10949 259
304 3300047471 Ga0495684_0110978 Ga0495684_0110978_800_1684 259
305 3300048088 Ga0495602_0045873 Ga0495602_0045873_1871_2752 259
306 3300048088 Ga0495602_0095508 Ga0495602_0095508_1066_1884 259
307 3300048907 Ga0496104_0199133 Ga0496104_0199133_901_1698 259
308 3300048908 Ga0496105_0128868 Ga0496105_0128868_1119_1958 259
309 3300048911 Ga0496108_0007569 Ga0496108_0007569_160_990 259
310 3300048911 Ga0496108_0113675 Ga0496108_0113675_1285_2115 259
311 3300048912 Ga0496109_0077342 Ga0496109_0077342_14_844 259
312 3300048912 Ga0496109_0158254 Ga0496109_0158254_1086_1946 259
313 3300048913 Ga0496110_0029753 Ga0496110_0029753_1458_2288 259
314 3300048913 Ga0496110_0145900 Ga0496110_0145900_667_1497 259
315 3300048914 Ga0496111_0018006 Ga0496111_0018006_3758_4588 259
316 3300048917 Ga0496114_0064171 Ga0496114_0064171_2097_2927 259
317 3300048918 Ga0496115_0180003 Ga0496115_0180003_383_1243 259
318 3300049568 Ga0501031_0001624 Ga0501031_0001624_6394_7218 259
319 3300049568 Ga0501031_0262232 Ga0501031_0262232_47_859 259
320 3300049569 Ga0501032_0000056 Ga0501032_0000056_65907_66731 259
321 3300049570 Ga0501033_0001130 Ga0501033_0001130_20878_21702 259
322 3300049571 Ga0501034_0001982 Ga0501034_0001982_6851_7675 259
323 3300049572 Ga0501036_0000057 Ga0501036_0000057_45157_45981 259
324 3300049573 Ga0501037_0003905 Ga0501037_0003905_3140_3964 259
325 3300049574 Ga0501038_0016991 Ga0501038_0016991_905_1729 259
326 3300049575 Ga0501039_0000623 Ga0501039_0000623_6544_7368 259
327 3300049578 Ga0501042_0268670 Ga0501042_0268670_117_941 259
328 3300049579 Ga0501043_0000755 Ga0501043_0000755_17933_18757 259
329 3300049580 Ga0501046_0000701 Ga0501046_0000701_36_860 259
330 3300049581 Ga0501047_0008315 Ga0501047_0008315_5829_6653 259
331 3300049582 Ga0501048_0000016 Ga0501048_0000016_57482_58306 259
332 3300049583 Ga0501067_0035696 Ga0501067_0035696_1655_2479 259
333 3300049583 Ga0501067_0191643 Ga0501067_0191643_281_1108 259
334 3300049583 Ga0501067_0280946 Ga0501067_0280946_12_845 259
335 3300049584 Ga0501068_0013160 Ga0501068_0013160_2424_3248 259
336 3300049585 Ga0501069_0005920 Ga0501069_0005920_905_1729 259
337 3300049586 Ga0501070_0001292 Ga0501070_0001292_7756_8580 259
338 3300049588 Ga0501072_0190630 Ga0501072_0190630_800_1624 259
339 3300049589 Ga0501073_0004931 Ga0501073_0004931_2238_3062 259
340 3300049590 Ga0501074_0003175 Ga0501074_0003175_4813_5637 259
341 3300049742 Ga0501080_0006298 Ga0501080_0006298_3432_4256 259
342 3300049744 Ga0501083_0019629 Ga0501083_0019629_60_884 259
343 3300049822 Ga0501035_0000262 Ga0501035_0000262_56482_57306 259
344 3300049823 Ga0501044_0000312 Ga0501044_0000312_1133_1957 259
345 3300050511 nmdc:mga08y16_5370_c1 nmdc:mga08y16_5370_c1_9502_10320 259
346 3300053078 Ga0495612_0006198 Ga0495612_0006198_2953_3750 259
347 3300053153 Ga0500616_0006375 Ga0500616_0006375_200_1054 259
348 3300054114 Ga0501084_0000906 Ga0501084_0000906_19751_20575 259
349 3300059493 Ga0587077_010874 Ga0587077_010874_361_1194 259
350 iso_pu_bacteria 2883821847 2883825185 259
351 iso_pu_bacteria 2902582711 2902583093 259
352 iso_pu_bacteria 2996221748 2996225107 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

169

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.8958 7 236
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8914 4 235
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8899 7 235
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.8891 4 234
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.8885 6 235
ID Description Score Start End Superfamily
af_Q6BEX0_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.959 4 249 3.40.50.300
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9563 3 249 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9551 5 247 3.40.50.300
af_P77509_7_245_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 3 247 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 5 247 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5D0N8V3-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9981 7 259 GO:0005524
GO:0016887
AF-A0A0W8I469-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9978 2 252 GO:0005524
GO:0016887
AF-A0A2T0TX34-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.9976 2 253 GO:0005524
GO:0016887
AF-A0A0Q9KTL6-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9971 12 253 GO:0005524
GO:0016887
AF-A0A1C5JB28-F1-model_v4 Fructose transport system ATP-binding protein 0.9959 1 259 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.85 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map