F418902

General Info

Members Datasets Scaffolds Average Seq Length
352 192 704 191

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100263912|Ga0070660_1002639121
Length 211
Sequence VNLLVLGPQGAGKGTQAKRISAEYEIPHVATGDMFRALDASTELGREVGEFMARGDLVPDALTVEMIENRLAEPDAADGFVLDGFPRNLAQARALDAMLGGIGRVLDAILFFSISDEIGMERALSRAALEGRADDTREVIAHRLEIYHRETEPIVEHYRTTGKLIPLHADRSIEQVWSEISEALQQVVAGVGSTEPDKSGAAGFAGGGAQR

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 3.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.67
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100263912 3300005339 Bacteria 1406
2 Ga0070683_100084911 3300005329 Bacteria 2967
3 Ga0070683_100267939 3300005329 Bacteria 1624
4 Ga0070683_100357260 3300005329 Bacteria 1391
5 Ga0070680_100027192 3300005336 Bacteria 4581
6 Ga0070680_100129870 3300005336 Bacteria 2107
7 Ga0070680_100183748 3300005336 Bacteria 1761
8 Ga0070682_100094288 3300005337 Bacteria 1963
9 Ga0070682_100160399 3300005337 Bacteria 1552
10 Ga0070660_100029341 3300005339 Bacteria 4122
11 Ga0070660_100146289 3300005339 Bacteria 1898
12 Ga0070660_100460532 3300005339 Unclassified 1056
13 Ga0070661_100089624 3300005344 Bacteria 2277
14 Ga0070661_100113024 3300005344 Bacteria 2029
15 Ga0070659_100083907 3300005366 Bacteria 2547
16 Ga0070659_100091648 3300005366 Bacteria 2436
17 Ga0070710_10160160 3300005437 Bacteria 1395
18 Ga0070711_100058315 3300005439 Bacteria 2676
19 Ga0070711_100700325 3300005439 Bacteria 853
20 Ga0070663_100524488 3300005455 Bacteria 987
21 Ga0070681_10027829 3300005458 Bacteria 5684
22 Ga0070681_10052601 3300005458 Bacteria 4062
23 Ga0068867_101153248 3300005459 Bacteria 710
24 Ga0070685_10084460 3300005466 Bacteria 1910
25 Ga0070698_100369875 3300005471 Bacteria 1365
26 Ga0070699_100043214 3300005518 Bacteria 3901
27 Ga0070679_100051789 3300005530 Bacteria 4089
28 Ga0070679_100075358 3300005530 Bacteria 3364
29 Ga0070679_100191234 3300005530 Bacteria 2015
30 Ga0070684_100078006 3300005535 Bacteria 2926
31 Ga0070684_100534012 3300005535 Bacteria 1088
32 Ga0068853_100372415 3300005539 Bacteria 1332
33 Ga0068853_100386495 3300005539 Bacteria 1308
34 Ga0070672_100398007 3300005543 Bacteria 1180
35 Ga0070696_100354669 3300005546 Bacteria 1137
36 Ga0070665_100097262 3300005548 Bacteria 2949
37 Ga0070665_100221231 3300005548 Bacteria 1894
38 Ga0068855_100094532 3300005563 Bacteria 3446
39 Ga0068855_100101880 3300005563 Bacteria 3305
40 Ga0068855_100161946 3300005563 Bacteria 2538
41 Ga0068855_100848020 3300005563 Bacteria 968
42 Ga0068857_100209290 3300005577 Bacteria 1779
43 Ga0068857_101385968 3300005577 Bacteria 684
44 Ga0068854_100123809 3300005578 Bacteria 1967
45 Ga0068854_100457827 3300005578 Bacteria 1067
46 Ga0068856_100436006 3300005614 Bacteria 1330
47 Ga0068856_100596463 3300005614 Bacteria 1126
48 Ga0068856_100913834 3300005614 Unclassified 896
49 Ga0068852_100079590 3300005616 Bacteria 2903
50 Ga0068852_100085766 3300005616 Bacteria 2806
51 Ga0068852_100468904 3300005616 Bacteria 1249
52 Ga0068852_100472695 3300005616 Bacteria 1244
53 Ga0081538_10177099 3300005981 Unclassified 919
54 Ga0070712_100074651 3300006175 Bacteria 2437
55 Ga0068871_101274938 3300006358 Bacteria 691
56 Ga0075435_100162652 3300007076 Bacteria 1881
57 Ga0105240_10087972 3300009093 Bacteria 3802
58 Ga0105245_10740147 3300009098 Bacteria 1018
59 Ga0105245_10782933 3300009098 Bacteria 991
60 Ga0105245_10886589 3300009098 Bacteria 933
61 Ga0114129_11046595 3300009147 Bacteria 1025
62 Ga0105242_10435966 3300009176 Bacteria 1232
63 Ga0105237_10208869 3300009545 Bacteria 1952
64 Ga0105237_10460064 3300009545 Bacteria 1278
65 Ga0105238_10054126 3300009551 Bacteria 4032
66 Ga0105238_10622888 3300009551 Bacteria 1088
67 Ga0157373_10410293 3300013100 Bacteria 971
68 Ga0157371_10254608 3300013102 Bacteria 1265
69 Ga0157370_10029142 3300013104 Bacteria 5422
70 Ga0157370_10298371 3300013104 Bacteria 1488
71 Ga0157370_10680877 3300013104 Bacteria 939
72 Ga0157370_10745372 3300013104 Bacteria 893
73 Ga0157369_10035022 3300013105 Bacteria 5506
74 Ga0157369_10146313 3300013105 Bacteria 2498
75 Ga0157369_10174557 3300013105 Bacteria 2263
76 Ga0157369_10736692 3300013105 Bacteria 1014
77 Ga0157374_10230547 3300013296 Bacteria 1819
78 Ga0157374_10382116 3300013296 Bacteria 1403
79 Ga0157374_10396050 3300013296 Bacteria 1377
80 Ga0157378_10234775 3300013297 Bacteria 1749
81 Ga0163162_11178320 3300013306 Bacteria 869
82 Ga0157372_10242332 3300013307 Bacteria 2092
83 Ga0157372_10417534 3300013307 Bacteria 1563
84 Ga0157372_11216040 3300013307 Bacteria 870
85 Ga0163163_11109360 3300014325 Unclassified 854
86 Ga0182008_10069535 3300014497 Bacteria 1732
87 Ga0157376_10089762 3300014969 Bacteria 2658
88 Ga0197907_11119596 3300020069 Bacteria 1718
89 Ga0206356_10332808 3300020070 Bacteria 1711
90 Ga0206356_11002308 3300020070 Bacteria 1091
91 Ga0206352_10733436 3300020078 Bacteria 930
92 Ga0206354_10208290 3300020081 Bacteria 1186
93 Ga0206354_10928898 3300020081 Bacteria 1822
94 Ga0206354_11004249 3300020081 Bacteria 1705
95 Ga0206353_10374620 3300020082 Bacteria 2518
96 Ga0206353_11804933 3300020082 Bacteria 2892
97 Ga0213874_10060064 3300021377 Bacteria 1189
98 Ga0213876_10168007 3300021384 Bacteria 1167
99 Ga0224712_10006954 3300022467 Bacteria 3264
100 Ga0207705_10063270 3300025909 Bacteria 2673
101 Ga0207705_10300500 3300025909 Unclassified 1231
102 Ga0207684_10115764 3300025910 Bacteria 2297
103 Ga0207707_10048324 3300025912 Bacteria 3706
104 Ga0207707_10054518 3300025912 Bacteria 3480
105 Ga0207695_10230438 3300025913 Bacteria 1757
106 Ga0207671_10124536 3300025914 Bacteria 1973
107 Ga0207693_10166125 3300025915 Bacteria 1737
108 Ga0207693_10235151 3300025915 Bacteria 1439
109 Ga0207663_10045021 3300025916 Bacteria 2712
110 Ga0207663_10604867 3300025916 Bacteria 862
111 Ga0207660_10024815 3300025917 Bacteria 4062
112 Ga0207660_10097980 3300025917 Bacteria 2186
113 Ga0207660_10770574 3300025917 Archaea 785
114 Ga0207657_10034817 3300025919 Bacteria 4522
115 Ga0207657_10062710 3300025919 Bacteria 3181
116 Ga0207652_10005753 3300025921 Bacteria 10059
117 Ga0207652_10196885 3300025921 Bacteria 1813
118 Ga0207652_10201917 3300025921 Bacteria 1789
119 Ga0207652_10375138 3300025921 Bacteria 1284
120 Ga0207646_10218243 3300025922 Bacteria 1723
121 Ga0207694_10077497 3300025924 Bacteria 2605
122 Ga0207687_10291751 3300025927 Bacteria 1311
123 Ga0207687_10896538 3300025927 Bacteria 759
124 Ga0207664_10133092 3300025929 Bacteria 2095
125 Ga0207690_10066811 3300025932 Bacteria 2464
126 Ga0207690_10265823 3300025932 Bacteria 1331
127 Ga0207686_10436340 3300025934 Bacteria 1005
128 Ga0207711_10416032 3300025941 Bacteria 1250
129 Ga0207661_10043744 3300025944 Bacteria 3536
130 Ga0207661_10077408 3300025944 Bacteria 2735
131 Ga0207661_11167029 3300025944 Bacteria 709
132 Ga0207667_10055025 3300025949 Bacteria 4184
133 Ga0207667_10747884 3300025949 Bacteria 977
134 Ga0207667_10822104 3300025949 Bacteria 925
135 Ga0207640_10301523 3300025981 Bacteria 1268
136 Ga0207639_10163381 3300026041 Bacteria 1879
137 Ga0207639_10317197 3300026041 Bacteria 1383
138 Ga0207678_10436406 3300026067 Bacteria 1137
139 Ga0207702_10153637 3300026078 Bacteria 2096
140 Ga0207702_10305412 3300026078 Bacteria 1511
141 Ga0207683_10503334 3300026121 Bacteria 1119
142 Ga0207698_10132422 3300026142 Bacteria 2133
143 Ga0268266_10071825 3300028379 Bacteria 3000
144 Ga0265318_10118383 3300028577 Bacteria 974
145 Ga0307409_100318709 3300031995 Bacteria 1454
146 Ga0307416_100414256 3300032002 Bacteria 1389
147 Ga0307415_100126038 3300032126 Bacteria 1930
148 Ga0307415_100453382 3300032126 Bacteria 1109
149 Ga0373936_0014215 3300035113 Bacteria 3041
150 Ga0373945_0005723 3300035116 Bacteria 3988
151 Ga0373943_0006142 3300035170 Bacteria 5394
152 Ga0373935_0017374 3300035692 Bacteria 4364
153 Ga0373927_0428289 3300035695 Bacteria 873
154 Ga0373947_0004933 3300035725 Bacteria 7803
155 Ga0373925_0024826 3300037068 Bacteria 4378
156 Ga0395899_0030367 3300037312 Bacteria 4065
157 Ga0395899_0163549 3300037312 Bacteria 1571
158 Ga0395900_0043420 3300037418 Bacteria 4634
159 Ga0395900_0072926 3300037418 Bacteria 3529
160 Ga0395900_0158409 3300037418 Bacteria 2311
161 Ga0395900_0228263 3300037418 Bacteria 1873
162 Ga0395900_0284537 3300037418 Bacteria 1644
163 Ga0395900_0411791 3300037418 Bacteria 1314
164 Ga0395900_0422275 3300037418 Bacteria 1294
165 Ga0395900_0675733 3300037418 Bacteria 968
166 Ga0395898_0007099 3300037466 Bacteria 11895
167 Ga0395898_0011441 3300037466 Bacteria 9216
168 Ga0395898_0013971 3300037466 Bacteria 8251
169 Ga0395898_0092303 3300037466 Bacteria 2912
170 Ga0395898_0604371 3300037466 Bacteria 1039
171 Ga0395898_0610621 3300037466 Bacteria 1033
172 Ga0395898_0831372 3300037466 Bacteria 863
173 Ga0395905_0087695 3300037471 Bacteria 2917
174 Ga0395905_0102377 3300037471 Bacteria 2688
175 Ga0395905_0166308 3300037471 Bacteria 2073
176 Ga0395905_0283746 3300037471 Bacteria 1542
177 Ga0395905_0321990 3300037471 Bacteria 1436
178 Ga0395901_0001204 3300038443 Bacteria 27493
179 Ga0395901_0025018 3300038443 Bacteria 6128
180 Ga0395901_0043546 3300038443 Bacteria 4656
181 Ga0395901_0077724 3300038443 Bacteria 3464
182 Ga0395901_0144088 3300038443 Bacteria 2504
183 Ga0395901_0677195 3300038443 Bacteria 1032
184 Ga0395901_1260930 3300038443 Bacteria 702
185 Ga0436363_0342979 3300039450 Bacteria 1070
186 Ga0436362_1025071 3300039453 Bacteria 1180
187 Ga0439437_001709 3300042000 Bacteria 2328
188 Ga0439448_0032476 3300042005 Bacteria 1662
189 Ga0450920_026672 3300042122 Bacteria 1128
190 Ga0439446_0080343 3300042156 Bacteria 1009
191 Ga0439434_0084267 3300042435 Bacteria 1011
192 Ga0466969_0070540 3300044656 Bacteria 1681
193 Ga0466972_0226080 3300044658 Bacteria 876
194 Ga0466965_0132816 3300044683 Bacteria 1292
195 Ga0466965_0151859 3300044683 Bacteria 1211
196 Ga0466966_0024335 3300044684 Bacteria 3961
197 Ga0466961_0046217 3300044693 Bacteria 2785
198 Ga0466961_0185617 3300044693 Bacteria 1290
199 Ga0466963_0006965 3300044694 Bacteria 6727
200 Ga0466963_0007998 3300044694 Bacteria 6329
201 Ga0466963_0024285 3300044694 Bacteria 3858
202 Ga0466963_0026555 3300044694 Bacteria 3704
203 Ga0466963_0059773 3300044694 Bacteria 2544
204 Ga0466963_0073956 3300044694 Bacteria 2298
205 Ga0466963_0100012 3300044694 Bacteria 1984
206 Ga0466964_0013045 3300044706 Bacteria 3148
207 Ga0466964_0032061 3300044706 Bacteria 2087
208 Ga0466964_0059031 3300044706 Bacteria 1592
209 Ga0466971_0043673 3300044719 Bacteria 2013
210 Ga0466968_0003510 3300044735 Bacteria 5797
211 Ga0466968_0042256 3300044735 Bacteria 1927
212 Ga0466957_0000919 3300044842 Bacteria 15079
213 Ga0466957_0214077 3300044842 Bacteria 1270
214 Ga0466959_0015233 3300045049 Bacteria 5600
215 Ga0466959_0096481 3300045049 Bacteria 2119
216 Ga0466959_0609154 3300045049 Bacteria 734
217 Ga0466958_0003287 3300045836 Bacteria 8364
218 Ga0466958_0089318 3300045836 Bacteria 1905
219 Ga0466967_0003690 3300045976 Bacteria 10078
220 Ga0466967_0015428 3300045976 Bacteria 5988
221 Ga0466967_0040641 3300045976 Bacteria 4005
222 Ga0466967_0091844 3300045976 Bacteria 2759
223 Ga0466967_0148642 3300045976 Bacteria 2187
224 Ga0466967_0150080 3300045976 Bacteria 2177
225 Ga0466967_0241572 3300045976 Bacteria 1723
226 Ga0466967_0365929 3300045976 Bacteria 1398
227 Ga0466967_0380458 3300045976 Bacteria 1370
228 Ga0466967_0603559 3300045976 Bacteria 1083
229 Ga0466967_1481178 3300045976 Bacteria 676
230 Ga0495641_0035436 3300046461 Bacteria 2352
231 Ga0495653_0177004 3300046463 Bacteria 1467
232 Ga0495664_0068393 3300046477 Bacteria 2119
233 Ga0495608_0001775 3300046511 Bacteria 15412
234 Ga0495618_0037295 3300046514 Bacteria 3052
235 Ga0495628_0059886 3300046516 Bacteria 2988
236 Ga0495630_0040355 3300046517 Bacteria 3488
237 Ga0495630_0044691 3300046517 Bacteria 3310
238 Ga0495652_0021368 3300046529 Bacteria 5755
239 Ga0495665_0092549 3300046531 Bacteria 1589
240 Ga0495665_0305053 3300046531 Bacteria 815
241 Ga0495645_0077968 3300046543 Bacteria 2382
242 Ga0495667_0012048 3300046559 Bacteria 5856
243 Ga0495634_0092743 3300046642 Bacteria 1959
244 Ga0495635_0535981 3300046663 Bacteria 768
245 Ga0495657_0080009 3300046675 Bacteria 2116
246 Ga0495599_0016130 3300046678 Bacteria 4637
247 Ga0495646_0054317 3300046680 Bacteria 2410
248 Ga0495646_0208313 3300046680 Bacteria 1062
249 Ga0495658_0021410 3300046683 Bacteria 3408
250 Ga0495658_0434225 3300046683 Bacteria 838
251 Ga0495613_0122471 3300046689 Bacteria 1867
252 Ga0495624_0127554 3300046690 Bacteria 1561
253 Ga0495600_0260631 3300046809 Bacteria 1101
254 Ga0495604_0172301 3300047317 Bacteria 1520
255 Ga0495674_0002518 3300047319 Bacteria 17826
256 Ga0495676_0126879 3300047321 Bacteria 1848
257 Ga0495676_0308785 3300047321 Bacteria 1065
258 Ga0495680_0016894 3300047322 Bacteria 6249
259 Ga0495684_0116625 3300047471 Bacteria 2013
260 Ga0495593_0041695 3300047673 Bacteria 2467
261 Ga0496100_0009203 3300048903 Bacteria 5542
262 Ga0496100_0023134 3300048903 Bacteria 3770
263 Ga0496100_0061790 3300048903 Bacteria 2469
264 Ga0496101_0005743 3300048904 Bacteria 7927
265 Ga0496101_0045270 3300048904 Bacteria 3151
266 Ga0496102_0018265 3300048905 Bacteria 6160
267 Ga0496102_0907391 3300048905 Bacteria 803
268 Ga0496104_0184306 3300048907 Bacteria 1998
269 Ga0496104_0552844 3300048907 Bacteria 1062
270 Ga0496105_0001009 3300048908 Bacteria 19456
271 Ga0496107_0014643 3300048910 Bacteria 5491
272 Ga0496108_0061961 3300048911 Bacteria 3149
273 Ga0496109_0001990 3300048912 Bacteria 16940
274 Ga0496109_0232777 3300048912 Bacteria 1733
275 Ga0496110_0023459 3300048913 Bacteria 5248
276 Ga0496110_0232404 3300048913 Bacteria 1677
277 Ga0496111_0026001 3300048914 Bacteria 4131
278 Ga0496111_0104636 3300048914 Bacteria 2082
279 Ga0496112_0012934 3300048915 Bacteria 7689
280 Ga0496112_0600291 3300048915 Bacteria 1033
281 Ga0496114_0015726 3300048917 Bacteria 6088
282 Ga0496114_0101610 3300048917 Bacteria 2455
283 Ga0496114_0102488 3300048917 Bacteria 2445
284 Ga0496114_0575260 3300048917 Bacteria 994
285 Ga0496115_0051118 3300048918 Bacteria 3313
286 Ga0496115_0118015 3300048918 Bacteria 2182
287 Ga0496115_0197159 3300048918 Bacteria 1664
288 Ga0501031_0001922 3300049568 Bacteria 13097
289 Ga0501031_0015638 3300049568 Bacteria 4926
290 Ga0501033_0224681 3300049570 Bacteria 1335
291 Ga0501036_0018253 3300049572 Bacteria 5875
292 Ga0501038_0022475 3300049574 Bacteria 5651
293 Ga0501038_0076183 3300049574 Bacteria 2834
294 Ga0501039_0085083 3300049575 Bacteria 2463
295 Ga0501040_0005865 3300049576 Bacteria 7951
296 Ga0501040_0223178 3300049576 Bacteria 1341
297 Ga0501041_0006113 3300049577 Bacteria 7037
298 Ga0501041_0100289 3300049577 Bacteria 1792
299 Ga0501042_0002773 3300049578 Bacteria 10825
300 Ga0501042_0299247 3300049578 Bacteria 1162
301 Ga0501046_0028347 3300049580 Bacteria 4560
302 Ga0501046_0231827 3300049580 Bacteria 1364
303 Ga0501047_0142421 3300049581 Bacteria 2275
304 Ga0501048_0007642 3300049582 Bacteria 8194
305 Ga0501048_0873270 3300049582 Bacteria 647
306 Ga0501067_0002828 3300049583 Bacteria 9552
307 Ga0501069_0002252 3300049585 Bacteria 9730
308 Ga0501069_0083221 3300049585 Bacteria 1804
309 Ga0501070_0028334 3300049586 Bacteria 4697
310 Ga0501070_0118844 3300049586 Bacteria 2184
311 Ga0501071_0016500 3300049587 Bacteria 5079
312 Ga0501071_0675096 3300049587 Bacteria 795
313 Ga0501071_0787264 3300049587 Bacteria 733
314 Ga0501072_0016030 3300049588 Bacteria 5746
315 Ga0501072_0114695 3300049588 Bacteria 2145
316 Ga0501073_0081949 3300049589 Bacteria 2244
317 Ga0501073_0853219 3300049589 Bacteria 627
318 Ga0501074_0010787 3300049590 Bacteria 6635
319 Ga0501074_0104098 3300049590 Bacteria 2032
320 Ga0501074_0553715 3300049590 Bacteria 814
321 Ga0501075_0006812 3300049591 Bacteria 7889
322 Ga0501075_0049791 3300049591 Bacteria 3149
323 Ga0501075_0364308 3300049591 Bacteria 1102
324 Ga0501076_0004097 3300049592 Bacteria 10304
325 Ga0501076_0089528 3300049592 Bacteria 2474
326 Ga0501076_0172163 3300049592 Bacteria 1765
327 Ga0501077_0042599 3300049593 Bacteria 2886
328 Ga0501077_0197325 3300049593 Bacteria 1278
329 Ga0501079_0356048 3300049741 Bacteria 1147
330 Ga0501079_0413166 3300049741 Bacteria 1059
331 Ga0501079_0477211 3300049741 Bacteria 980
332 Ga0501080_0028576 3300049742 Bacteria 5190
333 Ga0501080_0247334 3300049742 Bacteria 1626
334 Ga0501080_0259053 3300049742 Bacteria 1585
335 Ga0501081_0006736 3300049743 Bacteria 7470
336 Ga0501083_0090028 3300049744 Bacteria 2027
337 Ga0501035_0038050 3300049822 Bacteria 4356
338 Ga0501044_0120027 3300049823 Bacteria 2631
339 Ga0501045_0003822 3300049824 Bacteria 10359
340 Ga0501045_0065409 3300049824 Bacteria 2669
341 nmdc:mga0rr50_167480_c1 3300050513 Bacteria 1788
342 Ga0495619_0058198 3300053085 Bacteria 2565
343 Ga0501084_0031596 3300054114 Bacteria 4425
344 Ga0590074_034502 3300059423 Bacteria 900
345 Ga0590075_005809 3300059424 Bacteria 2917
346 Ga0587114_000674 3300059655 Bacteria 2449
347 Ga0501082_0017573 3300060353 Bacteria 6160
348 Ga0501082_0093300 3300060353 Bacteria 2601
349 Ga0501082_0245858 3300060353 Bacteria 1557
350 Ga0466962_0003534 3300061719 Bacteria 7448
351 Ga0530510_0004925 3300061734 Bacteria 9224
352 Ga0530510_0407510 3300061734 Bacteria 1025
353 Ga0070660_100263912
354 Ga0070683_100084911
355 Ga0070683_100267939
356 Ga0070683_100357260
357 Ga0070680_100027192
358 Ga0070680_100129870
359 Ga0070680_100183748
360 Ga0070682_100094288
361 Ga0070682_100160399
362 Ga0070660_100029341
363 Ga0070660_100146289
364 Ga0070660_100460532
365 Ga0070661_100089624
366 Ga0070661_100113024
367 Ga0070659_100083907
368 Ga0070659_100091648
369 Ga0070710_10160160
370 Ga0070711_100058315
371 Ga0070711_100700325
372 Ga0070663_100524488
373 Ga0070681_10027829
374 Ga0070681_10052601
375 Ga0068867_101153248
376 Ga0070685_10084460
377 Ga0070698_100369875
378 Ga0070699_100043214
379 Ga0070679_100051789
380 Ga0070679_100075358
381 Ga0070679_100191234
382 Ga0070684_100078006
383 Ga0070684_100534012
384 Ga0068853_100372415
385 Ga0068853_100386495
386 Ga0070672_100398007
387 Ga0070696_100354669
388 Ga0070665_100097262
389 Ga0070665_100221231
390 Ga0068855_100094532
391 Ga0068855_100101880
392 Ga0068855_100161946
393 Ga0068855_100848020
394 Ga0068857_100209290
395 Ga0068857_101385968
396 Ga0068854_100123809
397 Ga0068854_100457827
398 Ga0068856_100436006
399 Ga0068856_100596463
400 Ga0068856_100913834
401 Ga0068852_100079590
402 Ga0068852_100085766
403 Ga0068852_100468904
404 Ga0068852_100472695
405 Ga0081538_10177099
406 Ga0070712_100074651
407 Ga0068871_101274938
408 Ga0075435_100162652
409 Ga0105240_10087972
410 Ga0105245_10740147
411 Ga0105245_10782933
412 Ga0105245_10886589
413 Ga0114129_11046595
414 Ga0105242_10435966
415 Ga0105237_10208869
416 Ga0105237_10460064
417 Ga0105238_10054126
418 Ga0105238_10622888
419 Ga0157373_10410293
420 Ga0157371_10254608
421 Ga0157370_10029142
422 Ga0157370_10298371
423 Ga0157370_10680877
424 Ga0157370_10745372
425 Ga0157369_10035022
426 Ga0157369_10146313
427 Ga0157369_10174557
428 Ga0157369_10736692
429 Ga0157374_10230547
430 Ga0157374_10382116
431 Ga0157374_10396050
432 Ga0157378_10234775
433 Ga0163162_11178320
434 Ga0157372_10242332
435 Ga0157372_10417534
436 Ga0157372_11216040
437 Ga0163163_11109360
438 Ga0182008_10069535
439 Ga0157376_10089762
440 Ga0197907_11119596
441 Ga0206356_10332808
442 Ga0206356_11002308
443 Ga0206352_10733436
444 Ga0206354_10208290
445 Ga0206354_10928898
446 Ga0206354_11004249
447 Ga0206353_10374620
448 Ga0206353_11804933
449 Ga0213874_10060064
450 Ga0213876_10168007
451 Ga0224712_10006954
452 Ga0207705_10063270
453 Ga0207705_10300500
454 Ga0207684_10115764
455 Ga0207707_10048324
456 Ga0207707_10054518
457 Ga0207695_10230438
458 Ga0207671_10124536
459 Ga0207693_10166125
460 Ga0207693_10235151
461 Ga0207663_10045021
462 Ga0207663_10604867
463 Ga0207660_10024815
464 Ga0207660_10097980
465 Ga0207660_10770574
466 Ga0207657_10034817
467 Ga0207657_10062710
468 Ga0207652_10005753
469 Ga0207652_10196885
470 Ga0207652_10201917
471 Ga0207652_10375138
472 Ga0207646_10218243
473 Ga0207694_10077497
474 Ga0207687_10291751
475 Ga0207687_10896538
476 Ga0207664_10133092
477 Ga0207690_10066811
478 Ga0207690_10265823
479 Ga0207686_10436340
480 Ga0207711_10416032
481 Ga0207661_10043744
482 Ga0207661_10077408
483 Ga0207661_11167029
484 Ga0207667_10055025
485 Ga0207667_10747884
486 Ga0207667_10822104
487 Ga0207640_10301523
488 Ga0207639_10163381
489 Ga0207639_10317197
490 Ga0207678_10436406
491 Ga0207702_10153637
492 Ga0207702_10305412
493 Ga0207683_10503334
494 Ga0207698_10132422
495 Ga0268266_10071825
496 Ga0265318_10118383
497 Ga0307409_100318709
498 Ga0307416_100414256
499 Ga0307415_100126038
500 Ga0307415_100453382
501 Ga0373936_0014215
502 Ga0373945_0005723
503 Ga0373943_0006142
504 Ga0373935_0017374
505 Ga0373927_0428289
506 Ga0373947_0004933
507 Ga0373925_0024826
508 Ga0395899_0030367
509 Ga0395899_0163549
510 Ga0395900_0043420
511 Ga0395900_0072926
512 Ga0395900_0158409
513 Ga0395900_0228263
514 Ga0395900_0284537
515 Ga0395900_0411791
516 Ga0395900_0422275
517 Ga0395900_0675733
518 Ga0395898_0007099
519 Ga0395898_0011441
520 Ga0395898_0013971
521 Ga0395898_0092303
522 Ga0395898_0604371
523 Ga0395898_0610621
524 Ga0395898_0831372
525 Ga0395905_0087695
526 Ga0395905_0102377
527 Ga0395905_0166308
528 Ga0395905_0283746
529 Ga0395905_0321990
530 Ga0395901_0001204
531 Ga0395901_0025018
532 Ga0395901_0043546
533 Ga0395901_0077724
534 Ga0395901_0144088
535 Ga0395901_0677195
536 Ga0395901_1260930
537 Ga0436363_0342979
538 Ga0436362_1025071
539 Ga0439437_001709
540 Ga0439448_0032476
541 Ga0450920_026672
542 Ga0439446_0080343
543 Ga0439434_0084267
544 Ga0466969_0070540
545 Ga0466972_0226080
546 Ga0466965_0132816
547 Ga0466965_0151859
548 Ga0466966_0024335
549 Ga0466961_0046217
550 Ga0466961_0185617
551 Ga0466963_0006965
552 Ga0466963_0007998
553 Ga0466963_0024285
554 Ga0466963_0026555
555 Ga0466963_0059773
556 Ga0466963_0073956
557 Ga0466963_0100012
558 Ga0466964_0013045
559 Ga0466964_0032061
560 Ga0466964_0059031
561 Ga0466971_0043673
562 Ga0466968_0003510
563 Ga0466968_0042256
564 Ga0466957_0000919
565 Ga0466957_0214077
566 Ga0466959_0015233
567 Ga0466959_0096481
568 Ga0466959_0609154
569 Ga0466958_0003287
570 Ga0466958_0089318
571 Ga0466967_0003690
572 Ga0466967_0015428
573 Ga0466967_0040641
574 Ga0466967_0091844
575 Ga0466967_0148642
576 Ga0466967_0150080
577 Ga0466967_0241572
578 Ga0466967_0365929
579 Ga0466967_0380458
580 Ga0466967_0603559
581 Ga0466967_1481178
582 Ga0495641_0035436
583 Ga0495653_0177004
584 Ga0495664_0068393
585 Ga0495608_0001775
586 Ga0495618_0037295
587 Ga0495628_0059886
588 Ga0495630_0040355
589 Ga0495630_0044691
590 Ga0495652_0021368
591 Ga0495665_0092549
592 Ga0495665_0305053
593 Ga0495645_0077968
594 Ga0495667_0012048
595 Ga0495634_0092743
596 Ga0495635_0535981
597 Ga0495657_0080009
598 Ga0495599_0016130
599 Ga0495646_0054317
600 Ga0495646_0208313
601 Ga0495658_0021410
602 Ga0495658_0434225
603 Ga0495613_0122471
604 Ga0495624_0127554
605 Ga0495600_0260631
606 Ga0495604_0172301
607 Ga0495674_0002518
608 Ga0495676_0126879
609 Ga0495676_0308785
610 Ga0495680_0016894
611 Ga0495684_0116625
612 Ga0495593_0041695
613 Ga0496100_0009203
614 Ga0496100_0023134
615 Ga0496100_0061790
616 Ga0496101_0005743
617 Ga0496101_0045270
618 Ga0496102_0018265
619 Ga0496102_0907391
620 Ga0496104_0184306
621 Ga0496104_0552844
622 Ga0496105_0001009
623 Ga0496107_0014643
624 Ga0496108_0061961
625 Ga0496109_0001990
626 Ga0496109_0232777
627 Ga0496110_0023459
628 Ga0496110_0232404
629 Ga0496111_0026001
630 Ga0496111_0104636
631 Ga0496112_0012934
632 Ga0496112_0600291
633 Ga0496114_0015726
634 Ga0496114_0101610
635 Ga0496114_0102488
636 Ga0496114_0575260
637 Ga0496115_0051118
638 Ga0496115_0118015
639 Ga0496115_0197159
640 Ga0501031_0001922
641 Ga0501031_0015638
642 Ga0501033_0224681
643 Ga0501036_0018253
644 Ga0501038_0022475
645 Ga0501038_0076183
646 Ga0501039_0085083
647 Ga0501040_0005865
648 Ga0501040_0223178
649 Ga0501041_0006113
650 Ga0501041_0100289
651 Ga0501042_0002773
652 Ga0501042_0299247
653 Ga0501046_0028347
654 Ga0501046_0231827
655 Ga0501047_0142421
656 Ga0501048_0007642
657 Ga0501048_0873270
658 Ga0501067_0002828
659 Ga0501069_0002252
660 Ga0501069_0083221
661 Ga0501070_0028334
662 Ga0501070_0118844
663 Ga0501071_0016500
664 Ga0501071_0675096
665 Ga0501071_0787264
666 Ga0501072_0016030
667 Ga0501072_0114695
668 Ga0501073_0081949
669 Ga0501073_0853219
670 Ga0501074_0010787
671 Ga0501074_0104098
672 Ga0501074_0553715
673 Ga0501075_0006812
674 Ga0501075_0049791
675 Ga0501075_0364308
676 Ga0501076_0004097
677 Ga0501076_0089528
678 Ga0501076_0172163
679 Ga0501077_0042599
680 Ga0501077_0197325
681 Ga0501079_0356048
682 Ga0501079_0413166
683 Ga0501079_0477211
684 Ga0501080_0028576
685 Ga0501080_0247334
686 Ga0501080_0259053
687 Ga0501081_0006736
688 Ga0501083_0090028
689 Ga0501035_0038050
690 Ga0501044_0120027
691 Ga0501045_0003822
692 Ga0501045_0065409
693 nmdc:mga0rr50_167480_c1
694 Ga0495619_0058198
695 Ga0501084_0031596
696 Ga0590074_034502
697 Ga0590075_005809
698 Ga0587114_000674
699 Ga0501082_0017573
700 Ga0501082_0093300
701 Ga0501082_0245858
702 Ga0466962_0003534
703 Ga0530510_0004925
704 Ga0530510_0407510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

5

163

0.97

PF13207

AAA_17

AAA domain

6

141

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3adk-assembly1.cif.gz_A refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution 0.9117 2 186
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.9068 1 189
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.8902 1 189
4w5h-assembly1.cif.gz_A new structural conformations of adenylate kinase from streptococcus pneumoniae d39 0.8823 1 186
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.8802 1 189
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9488 2 126 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8898 1 189 3.40.50.300
af_A0A2R9YJL3_1233_1444_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8798 1 183 3.40.50.300
1tevA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8702 3 186 3.40.50.300
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8665 1 185 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A536D8R8-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.988 1 126 GO:0004017
GO:0005524
GO:0005737
AF-A0A536AU27-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9851 1 120 GO:0004017
GO:0005524
GO:0005737
AF-A0A3M1LX35-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9726 1 191 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A086BP25-F1-model_v4 Multifunctional fusion protein [Includes: Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase); Protein translocase subunit SecY] 0.9698 1 188 GO:0004017
GO:0005524
GO:0005737
GO:0005886
GO:0006605
GO:0043952
GO:0044209
GO:0065002
AF-A0A381Y3G3-F1-model_v4 Adenylate kinase active site lid domain-containing protein 0.9698 1 123 GO:0005524
GO:0005737
GO:0050145

Map