F418762

General Info

Members Datasets Scaffolds Average Seq Length
351 206 702 150

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0144916|Ga0495651_0144916_629_1114
Length 161
Sequence MATRDNPYGAFNFMVQLGNTGGQDEIAAGFSDVSGLGNEVKYSEYRNGNDKANHVRKVPNTNTTDDVTLKRGLIGDLRLFDWLSSTRDGDFSPQTVTITLLDERRTAVCRWILQSAQPKKWVGPTLAAKGGGEVAMEELHLVAEQVDFESARRPGQARHDR

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
206 2895427314 Nonomuraea sp. PA05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.28
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 5.7
Rhizosphere 90.6
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0144916 3300046462 Bacteria 1718
2 rootL2_10121377 3300003322 Bacteria 1736
3 rootH1_10086556 3300003323 Bacteria 3847
4 Ga0070682_100494609 3300005337 Bacteria 946
5 Ga0070660_101602326 3300005339 Bacteria 554
6 Ga0070687_100386981 3300005343 Bacteria 913
7 Ga0070709_10006470 3300005434 Bacteria 6389
8 Ga0070709_10019932 3300005434 Bacteria 3886
9 Ga0070709_10300661 3300005434 Bacteria 1172
10 Ga0070714_100000279 3300005435 Bacteria 39198
11 Ga0070714_100000340 3300005435 Bacteria 35136
12 Ga0070714_100067897 3300005435 Bacteria 3076
13 Ga0070714_100646554 3300005435 Bacteria 1018
14 Ga0070713_100001606 3300005436 Bacteria 14472
15 Ga0070713_100003596 3300005436 Bacteria 10244
16 Ga0070713_100013340 3300005436 Bacteria 6065
17 Ga0070713_100210566 3300005436 Bacteria 1760
18 Ga0070710_10020820 3300005437 Bacteria 3409
19 Ga0070710_10026246 3300005437 Bacteria 3093
20 Ga0070711_100055189 3300005439 Bacteria 2743
21 Ga0070711_100098601 3300005439 Bacteria 2122
22 Ga0070711_100138133 3300005439 Bacteria 1824
23 Ga0070700_100000007 3300005441 Bacteria 198866
24 Ga0070708_100012689 3300005445 Bacteria 6881
25 Ga0070685_10087359 3300005466 Bacteria 1881
26 Ga0070706_100000450 3300005467 Bacteria 49224
27 Ga0070706_100009460 3300005467 Bacteria 9064
28 Ga0070706_100603149 3300005467 Bacteria 1020
29 Ga0070707_100000650 3300005468 Bacteria 34734
30 Ga0070707_100003157 3300005468 Bacteria 15602
31 Ga0070707_100287037 3300005468 Bacteria 1599
32 Ga0070698_100000767 3300005471 Bacteria 34734
33 Ga0070698_100007223 3300005471 Bacteria 12033
34 Ga0070699_100001774 3300005518 Bacteria 19648
35 Ga0070697_100002069 3300005536 Bacteria 15353
36 Ga0070686_100414806 3300005544 Bacteria 1027
37 Ga0070665_100163236 3300005548 Bacteria 2230
38 Ga0068857_100965904 3300005577 Bacteria 819
39 Ga0068857_101650111 3300005577 Bacteria 626
40 Ga0068854_100266172 3300005578 Bacteria 1374
41 Ga0068852_100355895 3300005616 Bacteria 1431
42 Ga0068859_100006275 3300005617 Bacteria 12060
43 Ga0068859_100456968 3300005617 Bacteria 1373
44 Ga0068866_10530208 3300005718 Bacteria 784
45 Ga0068858_101946053 3300005842 Bacteria 581
46 Ga0068860_100714762 3300005843 Bacteria 1012
47 Ga0068862_101457864 3300005844 Bacteria 689
48 Ga0081455_10121709 3300005937 Bacteria 2055
49 Ga0081455_10355553 3300005937 Bacteria 1032
50 Ga0081539_10120256 3300005985 Bacteria 1306
51 Ga0070717_10001507 3300006028 Bacteria 16127
52 Ga0070717_10012148 3300006028 Bacteria 6563
53 Ga0070717_10024201 3300006028 Bacteria 4819
54 Ga0070717_10151576 3300006028 Bacteria 2006
55 Ga0070717_10929889 3300006028 Bacteria 792
56 Ga0075363_100353161 3300006048 Bacteria 859
57 Ga0070716_100700209 3300006173 Bacteria 774
58 Ga0070712_100009503 3300006175 Bacteria 6130
59 Ga0070712_100012158 3300006175 Bacteria 5471
60 Ga0070712_100974695 3300006175 Bacteria 733
61 Ga0070712_101113192 3300006175 Bacteria 686
62 Ga0075367_10366110 3300006178 Bacteria 910
63 Ga0075429_100000079 3300006880 Bacteria 49596
64 Ga0097620_100006275 3300006931 Bacteria 12060
65 Ga0097620_100457010 3300006931 Bacteria 1373
66 Ga0105251_10371315 3300009011 Bacteria 655
67 Ga0105240_10477196 3300009093 Bacteria 1391
68 Ga0105245_10052582 3300009098 Bacteria 3653
69 Ga0105245_10218081 3300009098 Bacteria 1839
70 Ga0105243_10791738 3300009148 Bacteria 933
71 Ga0105243_11317857 3300009148 Bacteria 740
72 Ga0105242_11952924 3300009176 Bacteria 628
73 Ga0105237_10656096 3300009545 Bacteria 1056
74 Ga0105237_11305946 3300009545 Bacteria 732
75 Ga0105238_10466909 3300009551 Bacteria 1260
76 Ga0105238_10800238 3300009551 Bacteria 958
77 Ga0105246_10465160 3300011119 Bacteria 1066
78 Ga0157369_11218689 3300013105 Bacteria 768
79 Ga0157378_10558539 3300013297 Bacteria 1151
80 Ga0163162_10630495 3300013306 Bacteria 1197
81 Ga0157372_10469596 3300013307 Bacteria 1466
82 Ga0163163_10706418 3300014325 Bacteria 1072
83 Ga0157380_11110616 3300014326 Bacteria 830
84 Ga0157379_11205102 3300014968 Bacteria 728
85 Ga0163161_10791128 3300017792 Bacteria 796
86 Ga0197907_11036514 3300020069 Bacteria 620
87 Ga0207692_10006746 3300025898 Bacteria 4668
88 Ga0207692_10016272 3300025898 Bacteria 3289
89 Ga0207692_10665030 3300025898 Bacteria 674
90 Ga0207642_10456687 3300025899 Bacteria 775
91 Ga0207688_10098960 3300025901 Bacteria 1682
92 Ga0207688_10878217 3300025901 Bacteria 568
93 Ga0207699_10013766 3300025906 Bacteria 4150
94 Ga0207699_10041183 3300025906 Bacteria 2666
95 Ga0207699_10121459 3300025906 Bacteria 1690
96 Ga0207699_10188442 3300025906 Bacteria 1391
97 Ga0207684_10001525 3300025910 Bacteria 24821
98 Ga0207684_10011643 3300025910 Bacteria 7681
99 Ga0207684_10734732 3300025910 Bacteria 837
100 Ga0207695_10451511 3300025913 Bacteria 1168
101 Ga0207671_11495575 3300025914 Bacteria 521
102 Ga0207693_10004754 3300025915 Bacteria 11419
103 Ga0207693_10036245 3300025915 Bacteria 3888
104 Ga0207693_10224908 3300025915 Bacteria 1474
105 Ga0207693_10409350 3300025915 Bacteria 1060
106 Ga0207663_10020910 3300025916 Bacteria 3715
107 Ga0207663_10076293 3300025916 Bacteria 2178
108 Ga0207657_10939045 3300025919 Bacteria 665
109 Ga0207646_10001079 3300025922 Bacteria 34766
110 Ga0207646_10005597 3300025922 Bacteria 13192
111 Ga0207646_10181960 3300025922 Bacteria 1898
112 Ga0207694_10708743 3300025924 Bacteria 849
113 Ga0207687_10047652 3300025927 Bacteria 2972
114 Ga0207687_10144548 3300025927 Bacteria 1808
115 Ga0207700_10004862 3300025928 Bacteria 7979
116 Ga0207700_10005285 3300025928 Bacteria 7699
117 Ga0207700_10104969 3300025928 Bacteria 2262
118 Ga0207700_10499418 3300025928 Bacteria 1076
119 Ga0207700_11429630 3300025928 Bacteria 614
120 Ga0207664_10001065 3300025929 Bacteria 18291
121 Ga0207664_10005782 3300025929 Bacteria 8459
122 Ga0207664_10183320 3300025929 Bacteria 1798
123 Ga0207664_10242408 3300025929 Bacteria 1570
124 Ga0207709_10951575 3300025935 Bacteria 700
125 Ga0207665_10105511 3300025939 Bacteria 1973
126 Ga0207665_10199154 3300025939 Bacteria 1458
127 Ga0207712_10609286 3300025961 Bacteria 945
128 Ga0207640_10239980 3300025981 Bacteria 1400
129 Ga0207708_10000006 3300026075 Bacteria 266916
130 Ga0207702_10391692 3300026078 Bacteria 1338
131 Ga0207683_11166651 3300026121 Bacteria 714
132 Ga0207698_11983151 3300026142 Bacteria 596
133 Ga0268265_10515024 3300028380 Bacteria 1130
134 Ga0268264_10455123 3300028381 Bacteria 1241
135 Ga0307511_10000497 3300030521 Bacteria 42552
136 Ga0307513_10693778 3300031456 Bacteria 724
137 Ga0307408_100847482 3300031548 Bacteria 833
138 Ga0316576_10034743 3300031727 Bacteria 3595
139 Ga0307516_10243519 3300031730 Bacteria 1496
140 Ga0307413_10156490 3300031824 Bacteria 1595
141 Ga0307413_11345679 3300031824 Bacteria 626
142 Ga0307407_10060314 3300031903 Bacteria 2213
143 Ga0307409_100336452 3300031995 Bacteria 1418
144 Ga0307416_100451881 3300032002 Bacteria 1338
145 Ga0307416_102930617 3300032002 Bacteria 571
146 Ga0307414_11804676 3300032004 Bacteria 571
147 Ga0307411_10053695 3300032005 Bacteria 2642
148 Ga0373926_0002559 3300035083 Bacteria 5778
149 Ga0373934_0003432 3300035086 Bacteria 5813
150 Ga0373934_0482096 3300035086 Bacteria 521
151 Ga0373944_0001657 3300035089 Bacteria 5631
152 Ga0373923_0005267 3300035111 Bacteria 4383
153 Ga0373923_0217391 3300035111 Bacteria 887
154 Ga0373936_0000155 3300035113 Bacteria 22938
155 Ga0373936_0451745 3300035113 Bacteria 594
156 Ga0373945_0000499 3300035116 Bacteria 11134
157 Ga0373953_0012055 3300035117 Bacteria 3052
158 Ga0373956_0032668 3300035119 Bacteria 2284
159 Ga0373956_0348136 3300035119 Bacteria 706
160 Ga0373957_0025366 3300035120 Bacteria 2135
161 Ga0373960_0160253 3300035121 Bacteria 774
162 Ga0373943_0000039 3300035170 Bacteria 43910
163 Ga0373946_0000116 3300035171 Bacteria 23217
164 Ga0373955_0002245 3300035172 Bacteria 8391
165 Ga0373955_0075709 3300035172 Bacteria 1892
166 Ga0373924_0095462 3300035410 Bacteria 1275
167 Ga0373931_0576777 3300035691 Bacteria 733
168 Ga0373935_0000052 3300035692 Bacteria 47244
169 Ga0373935_0021755 3300035692 Bacteria 3926
170 Ga0373935_0243685 3300035692 Unclassified 1256
171 Ga0373927_0000466 3300035695 Bacteria 30969
172 Ga0373927_0190063 3300035695 Bacteria 1347
173 Ga0373933_0000712 3300035724 Bacteria 20454
174 Ga0373933_0285787 3300035724 Bacteria 1066
175 Ga0373933_0501714 3300035724 Bacteria 795
176 Ga0373947_0000059 3300035725 Bacteria 55078
177 Ga0373947_0026792 3300035725 Bacteria 3371
178 Ga0373937_0000580 3300036401 Bacteria 32451
179 Ga0373937_0023646 3300036401 Bacteria 5537
180 Ga0373937_0405159 3300036401 Bacteria 1294
181 Ga0373937_1418116 3300036401 Bacteria 642
182 Ga0373925_0000430 3300037068 Bacteria 42402
183 Ga0373925_0115545 3300037068 Bacteria 2078
184 Ga0373925_0764985 3300037068 Bacteria 796
185 Ga0395898_0942724 3300037466 Unclassified 800
186 Ga0395905_0000245 3300037471 Bacteria 82074
187 Ga0439448_0076548 3300042005 Bacteria 1119
188 Ga0439455_0022884 3300042012 Bacteria 1501
189 Ga0439455_0105502 3300042012 Bacteria 781
190 Ga0450903_000106 3300042138 Bacteria 17726
191 Ga0439458_0000747 3300042157 Bacteria 8308
192 Ga0450901_018311 3300042533 Bacteria 744
193 Ga0453683_0370210 3300044673 Bacteria 922
194 Ga0466963_0334466 3300044694 Bacteria 1066
195 Ga0466967_0001244 3300045976 Bacteria 14401
196 Ga0466967_0230805 3300045976 Bacteria 1762
197 Ga0466967_0636317 3300045976 Bacteria 1054
198 Ga0495592_0002019 3300046454 Bacteria 14298
199 Ga0495641_0012233 3300046461 Bacteria 4816
200 Ga0495651_0001058 3300046462 Bacteria 21264
201 Ga0495651_0042824 3300046462 Bacteria 3514
202 Ga0495651_0202553 3300046462 Bacteria 1388
203 Ga0495653_0000836 3300046463 Bacteria 23734
204 Ga0495653_0001240 3300046463 Bacteria 19742
205 Ga0495653_0041834 3300046463 Bacteria 3574
206 Ga0495582_0021037 3300046473 Bacteria 3573
207 Ga0495662_0343083 3300046476 Bacteria 734
208 Ga0495664_0001205 3300046477 Bacteria 13516
209 Ga0495664_0001776 3300046477 Bacteria 11442
210 Ga0495664_0096052 3300046477 Bacteria 1784
211 Ga0495594_0593962 3300046499 Bacteria 628
212 Ga0495608_0009249 3300046511 Bacteria 6893
213 Ga0495608_0069507 3300046511 Bacteria 2300
214 Ga0495618_0017637 3300046514 Bacteria 4379
215 Ga0495618_0022801 3300046514 Bacteria 3867
216 Ga0495618_0200139 3300046514 Bacteria 1264
217 Ga0495628_0004003 3300046516 Bacteria 13125
218 Ga0495628_0142832 3300046516 Bacteria 1826
219 Ga0495628_0544678 3300046516 Bacteria 834
220 Ga0495630_0001619 3300046517 Bacteria 15653
221 Ga0495630_0001831 3300046517 Bacteria 14835
222 Ga0495630_0025944 3300046517 Bacteria 4337
223 Ga0495652_0001153 3300046529 Bacteria 29755
224 Ga0495652_0002214 3300046529 Bacteria 20387
225 Ga0495665_0071832 3300046531 Bacteria 1822
226 Ga0495640_0001314 3300046533 Bacteria 19556
227 Ga0495640_0041643 3300046533 Bacteria 3209
228 Ga0495640_0122427 3300046533 Bacteria 1689
229 Ga0495587_0001539 3300046536 Bacteria 15320
230 Ga0495587_0332745 3300046536 Unclassified 848
231 Ga0495645_0001189 3300046543 Bacteria 17770
232 Ga0495645_0026398 3300046543 Bacteria 4216
233 Ga0495645_0247272 3300046543 Bacteria 1187
234 Ga0495645_0889748 3300046543 Unclassified 529
235 Ga0495667_0000467 3300046559 Bacteria 25794
236 Ga0495667_0003201 3300046559 Bacteria 10978
237 Ga0495667_0019045 3300046559 Bacteria 4632
238 Ga0495667_0417135 3300046559 Bacteria 845
239 Ga0495634_0004047 3300046642 Bacteria 11616
240 Ga0495634_0004057 3300046642 Bacteria 11597
241 Ga0495634_0118173 3300046642 Bacteria 1699
242 Ga0495635_0000090 3300046663 Bacteria 54062
243 Ga0495635_0001558 3300046663 Bacteria 15379
244 Ga0495635_0003441 3300046663 Bacteria 10952
245 Ga0495657_0002436 3300046675 Bacteria 15658
246 Ga0495657_0004959 3300046675 Bacteria 10583
247 Ga0495657_0068588 3300046675 Bacteria 2323
248 Ga0495657_0153546 3300046675 Bacteria 1428
249 Ga0495657_0401544 3300046675 Bacteria 806
250 Ga0495599_0002001 3300046678 Bacteria 11777
251 Ga0495599_0030501 3300046678 Bacteria 3383
252 Ga0495623_0055856 3300046679 Bacteria 2487
253 Ga0495646_0007179 3300046680 Bacteria 7075
254 Ga0495658_0108010 3300046683 Bacteria 1670
255 Ga0495624_0000660 3300046690 Bacteria 26972
256 Ga0495624_0135710 3300046690 Bacteria 1508
257 Ga0495600_0005604 3300046809 Bacteria 7579
258 Ga0495600_0209728 3300046809 Bacteria 1249
259 Ga0495600_0305833 3300046809 Unclassified 1002
260 Ga0495581_0087105 3300047315 Bacteria 1810
261 Ga0495604_0006110 3300047317 Bacteria 9559
262 Ga0495674_0000056 3300047319 Bacteria 73900
263 Ga0495674_0000522 3300047319 Bacteria 35370
264 Ga0495674_0007730 3300047319 Bacteria 10267
265 Ga0495676_0000535 3300047321 Bacteria 31105
266 Ga0495676_0080369 3300047321 Bacteria 2476
267 Ga0495680_0000397 3300047322 Bacteria 48712
268 Ga0495680_0001046 3300047322 Bacteria 30623
269 Ga0495680_0028800 3300047322 Bacteria 4552
270 Ga0495680_0068632 3300047322 Bacteria 2707
271 Ga0495675_0042563 3300047444 Bacteria 2893
272 Ga0495684_0000278 3300047471 Bacteria 41247
273 Ga0495684_0000931 3300047471 Bacteria 23773
274 Ga0495684_0014395 3300047471 Bacteria 6086
275 Ga0495593_0088940 3300047673 Bacteria 1592
276 Ga0495602_0000527 3300048088 Bacteria 35725
277 Ga0495602_0143438 3300048088 Bacteria 1888
278 Ga0495602_0501824 3300048088 Bacteria 848
279 Ga0495602_0951673 3300048088 Bacteria 569
280 Ga0496101_0440676 3300048904 Bacteria 1028
281 Ga0496102_0208027 3300048905 Bacteria 1845
282 Ga0496102_0322077 3300048905 Bacteria 1456
283 Ga0496104_0124815 3300048907 Bacteria 2472
284 Ga0496104_0144364 3300048907 Bacteria 2286
285 Ga0496104_0478153 3300048907 Bacteria 1157
286 Ga0496105_0071416 3300048908 Bacteria 2869
287 Ga0496105_0291468 3300048908 Bacteria 1314
288 Ga0496107_0611598 3300048910 Bacteria 805
289 Ga0496108_0107996 3300048911 Bacteria 2377
290 Ga0496108_0549114 3300048911 Bacteria 1008
291 Ga0496108_1429491 3300048911 Bacteria 578
292 Ga0496109_0204359 3300048912 Bacteria 1857
293 Ga0496109_1323567 3300048912 Bacteria 656
294 Ga0496110_1602042 3300048913 Bacteria 561
295 Ga0496112_0303768 3300048915 Bacteria 1541
296 Ga0496113_0001564 3300048916 Bacteria 12846
297 Ga0496113_0199289 3300048916 Bacteria 1591
298 Ga0496114_0088536 3300048917 Bacteria 2626
299 Ga0496115_0510655 3300048918 Bacteria 965
300 Ga0496119_0018789 3300048922 Bacteria 5125
301 Ga0496121_0005798 3300048924 Bacteria 15670
302 Ga0501031_0007516 3300049568 Bacteria 7096
303 Ga0501031_0011494 3300049568 Bacteria 5770
304 Ga0501036_0013741 3300049572 Bacteria 6732
305 Ga0501036_0038750 3300049572 Bacteria 4035
306 Ga0501037_0032279 3300049573 Bacteria 3867
307 Ga0501038_0410989 3300049574 Bacteria 1045
308 Ga0501039_0002068 3300049575 Bacteria 14866
309 Ga0501039_0008705 3300049575 Bacteria 7725
310 Ga0501040_0006469 3300049576 Bacteria 7607
311 Ga0501040_0130164 3300049576 Bacteria 1769
312 Ga0501041_0015332 3300049577 Bacteria 4550
313 Ga0501041_0125804 3300049577 Bacteria 1595
314 Ga0501042_0046297 3300049578 Bacteria 3101
315 Ga0501043_0009602 3300049579 Bacteria 7580
316 Ga0501043_0301646 3300049579 Bacteria 1224
317 Ga0501046_0001389 3300049580 Bacteria 23313
318 Ga0501046_0493116 3300049580 Bacteria 878
319 Ga0501048_0001386 3300049582 Bacteria 18363
320 Ga0501068_0029084 3300049584 Bacteria 3271
321 Ga0501071_0112022 3300049587 Bacteria 2017
322 Ga0501072_0015377 3300049588 Bacteria 5868
323 Ga0501072_0060687 3300049588 Bacteria 2981
324 Ga0501074_0008438 3300049590 Bacteria 7469
325 Ga0501074_0315135 3300049590 Bacteria 1111
326 Ga0501075_0007541 3300049591 Bacteria 7547
327 Ga0501076_0008223 3300049592 Bacteria 7643
328 Ga0501076_0094036 3300049592 Bacteria 2413
329 Ga0501207_015568 3300049654 Bacteria 1172
330 Ga0501079_0002199 3300049741 Bacteria 14068
331 Ga0501080_0040558 3300049742 Bacteria 4342
332 Ga0501081_0001164 3300049743 Bacteria 15925
333 Ga0501081_0128619 3300049743 Bacteria 1808
334 Ga0501035_0011164 3300049822 Bacteria 8317
335 Ga0501045_0003630 3300049824 Bacteria 10609
336 Ga0501045_0253449 3300049824 Bacteria 1310
337 nmdc:mga03n38_8300_c1 3300050490 Bacteria 3720
338 nmdc:mga06z11_164975_c1 3300050494 Bacteria 1268
339 nmdc:mga09592_13352_c1 3300050508 Bacteria 6708
340 nmdc:mga0rr50_1633428_c1 3300050513 Bacteria 544
341 Ga0495601_0357379 3300053077 Bacteria 949
342 Ga0495595_0056217 3300053084 Bacteria 1834
343 Ga0495619_0043007 3300053085 Bacteria 2960
344 Ga0501084_0008318 3300054114 Bacteria 8563
345 Ga0501084_0067120 3300054114 Bacteria 3002
346 Ga0501082_0001854 3300060353 Bacteria 18612
347 Ga0501082_0283684 3300060353 Bacteria 1441
348 Ga0530510_0001029 3300061734 Bacteria 18446
349 Ga0530510_0013257 3300061734 Bacteria 5795
350 2574430875 2574179768 Bacteria 4907129
351 2895428594 2895427314 Bacteria 13147766
352 Ga0495651_0144916
353 rootL2_10121377
354 rootH1_10086556
355 Ga0070682_100494609
356 Ga0070660_101602326
357 Ga0070687_100386981
358 Ga0070709_10006470
359 Ga0070709_10019932
360 Ga0070709_10300661
361 Ga0070714_100000279
362 Ga0070714_100000340
363 Ga0070714_100067897
364 Ga0070714_100646554
365 Ga0070713_100001606
366 Ga0070713_100003596
367 Ga0070713_100013340
368 Ga0070713_100210566
369 Ga0070710_10020820
370 Ga0070710_10026246
371 Ga0070711_100055189
372 Ga0070711_100098601
373 Ga0070711_100138133
374 Ga0070700_100000007
375 Ga0070708_100012689
376 Ga0070685_10087359
377 Ga0070706_100000450
378 Ga0070706_100009460
379 Ga0070706_100603149
380 Ga0070707_100000650
381 Ga0070707_100003157
382 Ga0070707_100287037
383 Ga0070698_100000767
384 Ga0070698_100007223
385 Ga0070699_100001774
386 Ga0070697_100002069
387 Ga0070686_100414806
388 Ga0070665_100163236
389 Ga0068857_100965904
390 Ga0068857_101650111
391 Ga0068854_100266172
392 Ga0068852_100355895
393 Ga0068859_100006275
394 Ga0068859_100456968
395 Ga0068866_10530208
396 Ga0068858_101946053
397 Ga0068860_100714762
398 Ga0068862_101457864
399 Ga0081455_10121709
400 Ga0081455_10355553
401 Ga0081539_10120256
402 Ga0070717_10001507
403 Ga0070717_10012148
404 Ga0070717_10024201
405 Ga0070717_10151576
406 Ga0070717_10929889
407 Ga0075363_100353161
408 Ga0070716_100700209
409 Ga0070712_100009503
410 Ga0070712_100012158
411 Ga0070712_100974695
412 Ga0070712_101113192
413 Ga0075367_10366110
414 Ga0075429_100000079
415 Ga0097620_100006275
416 Ga0097620_100457010
417 Ga0105251_10371315
418 Ga0105240_10477196
419 Ga0105245_10052582
420 Ga0105245_10218081
421 Ga0105243_10791738
422 Ga0105243_11317857
423 Ga0105242_11952924
424 Ga0105237_10656096
425 Ga0105237_11305946
426 Ga0105238_10466909
427 Ga0105238_10800238
428 Ga0105246_10465160
429 Ga0157369_11218689
430 Ga0157378_10558539
431 Ga0163162_10630495
432 Ga0157372_10469596
433 Ga0163163_10706418
434 Ga0157380_11110616
435 Ga0157379_11205102
436 Ga0163161_10791128
437 Ga0197907_11036514
438 Ga0207692_10006746
439 Ga0207692_10016272
440 Ga0207692_10665030
441 Ga0207642_10456687
442 Ga0207688_10098960
443 Ga0207688_10878217
444 Ga0207699_10013766
445 Ga0207699_10041183
446 Ga0207699_10121459
447 Ga0207699_10188442
448 Ga0207684_10001525
449 Ga0207684_10011643
450 Ga0207684_10734732
451 Ga0207695_10451511
452 Ga0207671_11495575
453 Ga0207693_10004754
454 Ga0207693_10036245
455 Ga0207693_10224908
456 Ga0207693_10409350
457 Ga0207663_10020910
458 Ga0207663_10076293
459 Ga0207657_10939045
460 Ga0207646_10001079
461 Ga0207646_10005597
462 Ga0207646_10181960
463 Ga0207694_10708743
464 Ga0207687_10047652
465 Ga0207687_10144548
466 Ga0207700_10004862
467 Ga0207700_10005285
468 Ga0207700_10104969
469 Ga0207700_10499418
470 Ga0207700_11429630
471 Ga0207664_10001065
472 Ga0207664_10005782
473 Ga0207664_10183320
474 Ga0207664_10242408
475 Ga0207709_10951575
476 Ga0207665_10105511
477 Ga0207665_10199154
478 Ga0207712_10609286
479 Ga0207640_10239980
480 Ga0207708_10000006
481 Ga0207702_10391692
482 Ga0207683_11166651
483 Ga0207698_11983151
484 Ga0268265_10515024
485 Ga0268264_10455123
486 Ga0307511_10000497
487 Ga0307513_10693778
488 Ga0307408_100847482
489 Ga0316576_10034743
490 Ga0307516_10243519
491 Ga0307413_10156490
492 Ga0307413_11345679
493 Ga0307407_10060314
494 Ga0307409_100336452
495 Ga0307416_100451881
496 Ga0307416_102930617
497 Ga0307414_11804676
498 Ga0307411_10053695
499 Ga0373926_0002559
500 Ga0373934_0003432
501 Ga0373934_0482096
502 Ga0373944_0001657
503 Ga0373923_0005267
504 Ga0373923_0217391
505 Ga0373936_0000155
506 Ga0373936_0451745
507 Ga0373945_0000499
508 Ga0373953_0012055
509 Ga0373956_0032668
510 Ga0373956_0348136
511 Ga0373957_0025366
512 Ga0373960_0160253
513 Ga0373943_0000039
514 Ga0373946_0000116
515 Ga0373955_0002245
516 Ga0373955_0075709
517 Ga0373924_0095462
518 Ga0373931_0576777
519 Ga0373935_0000052
520 Ga0373935_0021755
521 Ga0373935_0243685
522 Ga0373927_0000466
523 Ga0373927_0190063
524 Ga0373933_0000712
525 Ga0373933_0285787
526 Ga0373933_0501714
527 Ga0373947_0000059
528 Ga0373947_0026792
529 Ga0373937_0000580
530 Ga0373937_0023646
531 Ga0373937_0405159
532 Ga0373937_1418116
533 Ga0373925_0000430
534 Ga0373925_0115545
535 Ga0373925_0764985
536 Ga0395898_0942724
537 Ga0395905_0000245
538 Ga0439448_0076548
539 Ga0439455_0022884
540 Ga0439455_0105502
541 Ga0450903_000106
542 Ga0439458_0000747
543 Ga0450901_018311
544 Ga0453683_0370210
545 Ga0466963_0334466
546 Ga0466967_0001244
547 Ga0466967_0230805
548 Ga0466967_0636317
549 Ga0495592_0002019
550 Ga0495641_0012233
551 Ga0495651_0001058
552 Ga0495651_0042824
553 Ga0495651_0202553
554 Ga0495653_0000836
555 Ga0495653_0001240
556 Ga0495653_0041834
557 Ga0495582_0021037
558 Ga0495662_0343083
559 Ga0495664_0001205
560 Ga0495664_0001776
561 Ga0495664_0096052
562 Ga0495594_0593962
563 Ga0495608_0009249
564 Ga0495608_0069507
565 Ga0495618_0017637
566 Ga0495618_0022801
567 Ga0495618_0200139
568 Ga0495628_0004003
569 Ga0495628_0142832
570 Ga0495628_0544678
571 Ga0495630_0001619
572 Ga0495630_0001831
573 Ga0495630_0025944
574 Ga0495652_0001153
575 Ga0495652_0002214
576 Ga0495665_0071832
577 Ga0495640_0001314
578 Ga0495640_0041643
579 Ga0495640_0122427
580 Ga0495587_0001539
581 Ga0495587_0332745
582 Ga0495645_0001189
583 Ga0495645_0026398
584 Ga0495645_0247272
585 Ga0495645_0889748
586 Ga0495667_0000467
587 Ga0495667_0003201
588 Ga0495667_0019045
589 Ga0495667_0417135
590 Ga0495634_0004047
591 Ga0495634_0004057
592 Ga0495634_0118173
593 Ga0495635_0000090
594 Ga0495635_0001558
595 Ga0495635_0003441
596 Ga0495657_0002436
597 Ga0495657_0004959
598 Ga0495657_0068588
599 Ga0495657_0153546
600 Ga0495657_0401544
601 Ga0495599_0002001
602 Ga0495599_0030501
603 Ga0495623_0055856
604 Ga0495646_0007179
605 Ga0495658_0108010
606 Ga0495624_0000660
607 Ga0495624_0135710
608 Ga0495600_0005604
609 Ga0495600_0209728
610 Ga0495600_0305833
611 Ga0495581_0087105
612 Ga0495604_0006110
613 Ga0495674_0000056
614 Ga0495674_0000522
615 Ga0495674_0007730
616 Ga0495676_0000535
617 Ga0495676_0080369
618 Ga0495680_0000397
619 Ga0495680_0001046
620 Ga0495680_0028800
621 Ga0495680_0068632
622 Ga0495675_0042563
623 Ga0495684_0000278
624 Ga0495684_0000931
625 Ga0495684_0014395
626 Ga0495593_0088940
627 Ga0495602_0000527
628 Ga0495602_0143438
629 Ga0495602_0501824
630 Ga0495602_0951673
631 Ga0496101_0440676
632 Ga0496102_0208027
633 Ga0496102_0322077
634 Ga0496104_0124815
635 Ga0496104_0144364
636 Ga0496104_0478153
637 Ga0496105_0071416
638 Ga0496105_0291468
639 Ga0496107_0611598
640 Ga0496108_0107996
641 Ga0496108_0549114
642 Ga0496108_1429491
643 Ga0496109_0204359
644 Ga0496109_1323567
645 Ga0496110_1602042
646 Ga0496112_0303768
647 Ga0496113_0001564
648 Ga0496113_0199289
649 Ga0496114_0088536
650 Ga0496115_0510655
651 Ga0496119_0018789
652 Ga0496121_0005798
653 Ga0501031_0007516
654 Ga0501031_0011494
655 Ga0501036_0013741
656 Ga0501036_0038750
657 Ga0501037_0032279
658 Ga0501038_0410989
659 Ga0501039_0002068
660 Ga0501039_0008705
661 Ga0501040_0006469
662 Ga0501040_0130164
663 Ga0501041_0015332
664 Ga0501041_0125804
665 Ga0501042_0046297
666 Ga0501043_0009602
667 Ga0501043_0301646
668 Ga0501046_0001389
669 Ga0501046_0493116
670 Ga0501048_0001386
671 Ga0501068_0029084
672 Ga0501071_0112022
673 Ga0501072_0015377
674 Ga0501072_0060687
675 Ga0501074_0008438
676 Ga0501074_0315135
677 Ga0501075_0007541
678 Ga0501076_0008223
679 Ga0501076_0094036
680 Ga0501207_015568
681 Ga0501079_0002199
682 Ga0501080_0040558
683 Ga0501081_0001164
684 Ga0501081_0128619
685 Ga0501035_0011164
686 Ga0501045_0003630
687 Ga0501045_0253449
688 nmdc:mga03n38_8300_c1
689 nmdc:mga06z11_164975_c1
690 nmdc:mga09592_13352_c1
691 nmdc:mga0rr50_1633428_c1
692 Ga0495601_0357379
693 Ga0495595_0056217
694 Ga0495619_0043007
695 Ga0501084_0008318
696 Ga0501084_0067120
697 Ga0501082_0001854
698 Ga0501082_0283684
699 Ga0530510_0001029
700 Ga0530510_0013257
701 2574430875
702 2895428594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

9

147

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.7561 12 149
6j0n-assembly1.cif.gz_n cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.7503 13 149
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.7425 12 149
6rao-assembly1.cif.gz_F cryo-em structure of the anti-feeding prophage (afp) baseplate, 6-fold symmetrised 0.7353 12 149
7aeb-assembly1.cif.gz_Y cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.7341 12 149
ID Description Score Start End Superfamily
af_P46855_3_149_2.30.110.20 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.61 38 149 2.30.110.20
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5818 34 64 3.40.50.880
5xhhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5734 12 149 2.30.110.20
af_Q2FYR1_1_132_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5648 80 113 3.40.630.30
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5587 12 148 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.8658 12 149 GO:0005198
AF-A0A3E1Q701-F1-model_v4 Glycerol acyltransferase 0.863 14 149 GO:0005198
GO:0016746
AF-A0A6F8Q2P4-F1-model_v4 deleted 0.842 14 149
AF-A0A2Z3Z8M6-F1-model_v4 deleted 0.8387 29 149
AF-A0A7X3D8I7-F1-model_v4 Phage tail protein 0.8315 24 149 GO:0005198

Map