F418726

General Info

Members Datasets Scaffolds Average Seq Length
351 282 702 116

Family's Representative Sequence

Representative Sequence 3300041441|Ga0451787_746705|Ga0451787_746705_243_626
Length 127
Sequence MTLNPYVPIVGLLILGMLFALFSVSIAPIVGPKRYNRAKLEAYECGIEPTPHAIGGGRFPIKYYLVAMTFIIFDIEVVFLYPWAVNFTQMLKSHGSTIFWSMAGFLSLVTVGYVYAIRKGVLDWKKG

Samples

Sample ID Description Type Environment
1 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
76 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
190 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
193 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
194 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
204 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
205 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
206 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
207 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
208 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
209 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
210 2643221548 Streptomyces sp. Root55 Isolate Unclassified
211 2643221578 Streptomyces sp. Root63 Isolate Unclassified
212 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
213 2643221613 Oerskovia sp. Root22 Isolate Unclassified
214 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
215 2643221647 Streptomyces sp. Root369 Isolate Unclassified
216 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
217 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
218 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
219 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
220 2643221714 Streptomyces sp. Root264 Isolate Unclassified
221 2643221721 Oerskovia sp. Root918 Isolate Unclassified
222 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
223 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
224 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
225 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
226 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
227 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
228 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
229 2808606448 Streptomyces sp. 193411 Isolate Unclassified
230 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
231 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
232 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
233 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
234 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
235 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
236 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
237 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
238 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
239 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
240 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
241 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
242 2862574272 Streptomyces sp. AcE210 Isolate Nodule
243 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
244 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
245 2867428634 Streptomyces sp. RP5T Isolate Unclassified
246 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
247 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
248 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
249 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
250 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
251 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
252 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
253 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
254 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
255 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
256 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
257 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
258 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
259 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
260 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
261 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
262 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
263 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
264 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
265 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
266 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
267 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
268 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
269 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
270 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
271 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
272 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
273 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
274 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
275 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
276 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
277 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
278 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
279 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
280 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
281 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
282 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.5
Metatranscriptomes 1.42
Isolates 23.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 5.13
Nodule 1.14
Rhizoplane 4.27
Rhizosphere 72.93
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451787_746705 3300041441 Bacteria 670
2 LJNas_1001813 3300000546 Bacteria 2825
3 Ga0070683_100407492 3300005329 Bacteria 1297
4 Ga0070683_101532207 3300005329 Bacteria 641
5 Ga0068869_100796339 3300005334 Bacteria 812
6 Ga0070666_11037378 3300005335 Bacteria 609
7 Ga0070682_100013171 3300005337 Bacteria 4751
8 Ga0070682_100464474 3300005337 Bacteria 972
9 Ga0070682_100594767 3300005337 Bacteria 872
10 Ga0068868_100074799 3300005338 Bacteria 2706
11 Ga0070689_101544142 3300005340 Bacteria 602
12 Ga0070691_10074313 3300005341 Bacteria 1654
13 Ga0070687_101207216 3300005343 Bacteria 558
14 Ga0070661_100988268 3300005344 Bacteria 698
15 Ga0070671_100811401 3300005355 Bacteria 815
16 Ga0070674_101663062 3300005356 Bacteria 577
17 Ga0070711_100227492 3300005439 Bacteria 1453
18 Ga0070663_100017692 3300005455 Bacteria 4657
19 Ga0070663_100707406 3300005455 Bacteria 857
20 Ga0070663_101103461 3300005455 Bacteria 694
21 Ga0070678_100180182 3300005456 Bacteria 1729
22 Ga0070684_100847090 3300005535 Bacteria 856
23 Ga0068853_100000015 3300005539 Bacteria 226965
24 Ga0068853_102224017 3300005539 Bacteria 532
25 Ga0070672_100796847 3300005543 Unclassified 831
26 Ga0070672_100888514 3300005543 Bacteria 787
27 Ga0070672_102060333 3300005543 Bacteria 514
28 Ga0068855_100038437 3300005563 Bacteria 5687
29 Ga0070664_100573799 3300005564 Bacteria 1045
30 Ga0068857_100488850 3300005577 Bacteria 1154
31 Ga0068854_100649104 3300005578 Bacteria 906
32 Ga0070702_100799441 3300005615 Bacteria 729
33 Ga0068852_100185295 3300005616 Bacteria 1960
34 Ga0068859_100897515 3300005617 Bacteria 971
35 Ga0068864_100499625 3300005618 Bacteria 1170
36 Ga0068864_101328953 3300005618 Bacteria 720
37 Ga0068864_101465608 3300005618 Bacteria 685
38 Ga0068870_11069145 3300005840 Bacteria 579
39 Ga0068862_101605588 3300005844 Unclassified 657
40 Ga0081539_10005222 3300005985 Bacteria 13439
41 Ga0075363_100014983 3300006048 Bacteria 3801
42 Ga0075363_100215728 3300006048 Bacteria 1099
43 Ga0075364_10100164 3300006051 Bacteria 1929
44 Ga0075366_10305363 3300006195 Bacteria 974
45 Ga0075428_100007414 3300006844 Bacteria 12158
46 Ga0075428_100124352 3300006844 Bacteria 2807
47 Ga0075428_100892401 3300006844 Bacteria 943
48 Ga0075428_101850925 3300006844 Bacteria 628
49 Ga0075430_100015607 3300006846 Bacteria 6467
50 Ga0075430_100125344 3300006846 Bacteria 2141
51 Ga0075431_100068233 3300006847 Bacteria 3669
52 Ga0075431_101137844 3300006847 Bacteria 744
53 Ga0075429_100009820 3300006880 Bacteria 8298
54 Ga0075429_101854338 3300006880 Bacteria 523
55 Ga0097620_100897593 3300006931 Bacteria 971
56 Ga0099826_10348722 3300006948 Bacteria 737
57 Ga0105245_10085855 3300009098 Bacteria 2885
58 Ga0105245_12126429 3300009098 Bacteria 615
59 Ga0114129_10072142 3300009147 Bacteria 4814
60 Ga0114129_10235665 3300009147 Bacteria 2463
61 Ga0114129_10857389 3300009147 Bacteria 1154
62 Ga0105243_10214048 3300009148 Bacteria 1699
63 Ga0105243_10300960 3300009148 Bacteria 1453
64 Ga0105243_10928212 3300009148 Bacteria 868
65 Ga0105241_10267771 3300009174 Bacteria 1454
66 Ga0105241_10361154 3300009174 Bacteria 1264
67 Ga0105242_10160534 3300009176 Bacteria 1967
68 Ga0105238_10117057 3300009551 Bacteria 2645
69 Ga0105249_11473973 3300009553 Bacteria 753
70 Ga0157371_10531170 3300013102 Bacteria 871
71 Ga0157369_10161249 3300013105 Bacteria 2367
72 Ga0157374_10693352 3300013296 Bacteria 1031
73 Ga0157374_11377547 3300013296 Bacteria 728
74 Ga0157378_10882554 3300013297 Bacteria 924
75 Ga0163162_11039406 3300013306 Bacteria 927
76 Ga0157375_10813709 3300013308 Bacteria 1082
77 Ga0157375_11300354 3300013308 Bacteria 855
78 Ga0157375_11992382 3300013308 Bacteria 690
79 Ga0163163_10811666 3300014325 Bacteria 999
80 Ga0163163_12630819 3300014325 Bacteria 561
81 Ga0157380_10798335 3300014326 Bacteria 961
82 Ga0157380_11009813 3300014326 Bacteria 866
83 Ga0157377_10375312 3300014745 Bacteria 961
84 Ga0163161_10237853 3300017792 Bacteria 1415
85 Ga0163161_10237987 3300017792 Bacteria 1415
86 Ga0163161_10261898 3300017792 Bacteria 1350
87 Ga0213876_10319113 3300021384 Bacteria 826
88 Ga0207656_10288421 3300025321 Bacteria 811
89 Ga0207643_10737284 3300025908 Bacteria 638
90 Ga0207663_10185977 3300025916 Bacteria 1487
91 Ga0207649_10823690 3300025920 Bacteria 725
92 Ga0207650_10307235 3300025925 Bacteria 1297
93 Ga0207687_10056378 3300025927 Bacteria 2756
94 Ga0207644_10890095 3300025931 Bacteria 746
95 Ga0207644_11094525 3300025931 Bacteria 670
96 Ga0207691_11208086 3300025940 Unclassified 627
97 Ga0207689_10430621 3300025942 Bacteria 1101
98 Ga0207640_10576138 3300025981 Bacteria 949
99 Ga0207677_10089049 3300026023 Bacteria 2240
100 Ga0207639_10000022 3300026041 Bacteria 226983
101 Ga0207678_10963571 3300026067 Bacteria 755
102 Ga0207676_10915136 3300026095 Bacteria 861
103 Ga0207676_11314693 3300026095 Bacteria 718
104 Ga0207676_12385272 3300026095 Bacteria 526
105 Ga0207683_10245056 3300026121 Bacteria 1635
106 Ga0268266_12008009 3300028379 Bacteria 552
107 Ga0268265_12666026 3300028380 Bacteria 505
108 Ga0316177_1075624 3300030731 Bacteria 4244
109 Ga0314311_1069726 3300030733 Bacteria 1368
110 Ga0307508_10046127 3300031616 Bacteria 3892
111 Ga0316575_10000004 3300031665 Bacteria 116505
112 Ga0307413_10506706 3300031824 Bacteria 970
113 Ga0307410_10845990 3300031852 Bacteria 781
114 Ga0307406_11412339 3300031901 Bacteria 610
115 Ga0307406_11630783 3300031901 Bacteria 570
116 Ga0307415_100227104 3300032126 Bacteria 1501
117 Ga0307510_10116989 3300033180 Bacteria 2385
118 Ga0373945_0149188 3300035116 Bacteria 947
119 Ga0373955_0113393 3300035172 Bacteria 1569
120 Ga0373935_0520283 3300035692 Bacteria 865
121 Ga0373927_0450411 3300035695 Bacteria 850
122 Ga0395899_0337634 3300037312 Bacteria 1011
123 Ga0395900_0008791 3300037418 Bacteria 10378
124 Ga0395900_0080690 3300037418 Bacteria 3343
125 Ga0395898_0011400 3300037466 Bacteria 9232
126 Ga0395898_0035335 3300037466 Bacteria 4971
127 Ga0395905_0060113 3300037471 Bacteria 3553
128 Ga0395905_0082226 3300037471 Bacteria 3018
129 Ga0395901_0003772 3300038443 Bacteria 15271
130 Ga0436365_1894754 3300039437 Bacteria 1135
131 Ga0439453_0047983 3300041408 Bacteria 856
132 Ga0451802_2138939 3300041460 Bacteria 605
133 Ga0451833_1487888 3300041491 Bacteria 581
134 Ga0451843_1731857 3300041509 Bacteria 616
135 Ga0451853_0245141 3300041512 Bacteria 858
136 Ga0451853_1117672 3300041512 Bacteria 598
137 Ga0439433_0174710 3300041999 Bacteria 560
138 Ga0450900_004844 3300042136 Bacteria 1566
139 Ga0450905_064303 3300042142 Bacteria 617
140 Ga0450901_012578 3300042533 Bacteria 884
141 Ga0453683_0968184 3300044673 Bacteria 564
142 Ga0466966_0568175 3300044684 Bacteria 682
143 Ga0466961_0072917 3300044693 Bacteria 2177
144 Ga0466964_0355862 3300044706 Bacteria 754
145 Ga0495627_110592 3300046453 Bacteria 780
146 Ga0495603_0292308 3300046455 Bacteria 936
147 Ga0495603_0521297 3300046455 Bacteria 681
148 Ga0495641_0310527 3300046461 Bacteria 711
149 Ga0495639_0090199 3300046475 Bacteria 1437
150 Ga0495662_0017622 3300046476 Bacteria 3457
151 Ga0495594_0053335 3300046499 Bacteria 2227
152 Ga0495606_0042582 3300046507 Bacteria 3035
153 Ga0495606_0218988 3300046507 Bacteria 1074
154 Ga0495610_0365742 3300046512 Bacteria 540
155 Ga0495620_0212580 3300046515 Bacteria 742
156 Ga0495628_0387827 3300046516 Bacteria 1022
157 Ga0495630_0512827 3300046517 Bacteria 919
158 Ga0495630_0859023 3300046517 Bacteria 692
159 Ga0495652_0297046 3300046529 Bacteria 1176
160 Ga0495665_0011099 3300046531 Bacteria 4876
161 Ga0495640_0086582 3300046533 Bacteria 2074
162 Ga0495586_0196497 3300046535 Bacteria 1143
163 Ga0495587_0549605 3300046536 Bacteria 637
164 Ga0495668_0167989 3300046616 Bacteria 1202
165 Ga0495625_0900082 3300046660 Bacteria 507
166 Ga0495588_0027474 3300046674 Bacteria 2844
167 Ga0495599_0688846 3300046678 Bacteria 590
168 Ga0495613_0406023 3300046689 Bacteria 929
169 Ga0495624_0113962 3300046690 Bacteria 1662
170 Ga0495600_0082971 3300046809 Bacteria 2092
171 Ga0495604_0001536 3300047317 Bacteria 19010
172 Ga0495636_0116931 3300047318 Bacteria 1177
173 Ga0495674_0055153 3300047319 Bacteria 3487
174 Ga0495672_0122768 3300047320 Bacteria 1378
175 Ga0495676_0173648 3300047321 Bacteria 1515
176 Ga0495675_0000675 3300047444 Bacteria 21516
177 Ga0495685_020602 3300047447 Bacteria 2266
178 Ga0495593_0005482 3300047673 Bacteria 7490
179 Ga0496102_0759836 3300048905 Bacteria 892
180 Ga0496108_0014028 3300048911 Bacteria 6538
181 Ga0496109_1025962 3300048912 Bacteria 762
182 Ga0496110_0197749 3300048913 Bacteria 1826
183 Ga0496110_0616877 3300048913 Bacteria 983
184 Ga0496111_0840896 3300048914 Bacteria 663
185 Ga0496112_0004865 3300048915 Bacteria 11480
186 Ga0496112_0117572 3300048915 Bacteria 2629
187 Ga0496112_0201784 3300048915 Bacteria 1948
188 Ga0496112_0917514 3300048915 Bacteria 797
189 Ga0496112_1540421 3300048915 Bacteria 578
190 Ga0496113_0036685 3300048916 Bacteria 3593
191 Ga0496113_1067901 3300048916 Bacteria 634
192 Ga0496117_0292410 3300048920 Bacteria 866
193 Ga0496118_0037955 3300048921 Bacteria 3867
194 Ga0496119_0014512 3300048922 Bacteria 6157
195 Ga0496122_0001064 3300048925 Bacteria 47739
196 Ga0496122_0001068 3300048925 Bacteria 47630
197 Ga0496123_0000612 3300048926 Bacteria 60039
198 Ga0496123_0266625 3300048926 Bacteria 836
199 Ga0496124_0014789 3300048927 Bacteria 7526
200 Ga0496124_0381342 3300048927 Bacteria 986
201 Ga0496125_0005134 3300048928 Bacteria 14728
202 Ga0496126_0036432 3300048929 Bacteria 4600
203 Ga0501031_0064207 3300049568 Bacteria 2391
204 Ga0501031_0396787 3300049568 Bacteria 892
205 Ga0501032_0001522 3300049569 Bacteria 18477
206 Ga0501034_0024576 3300049571 Bacteria 6128
207 Ga0501034_0033852 3300049571 Bacteria 5180
208 Ga0501034_0044734 3300049571 Bacteria 4476
209 Ga0501034_0075736 3300049571 Bacteria 3372
210 Ga0501034_0320116 3300049571 Bacteria 1484
211 Ga0501034_0578868 3300049571 Bacteria 1030
212 Ga0501034_0844857 3300049571 Bacteria 806
213 Ga0501036_0091993 3300049572 Bacteria 2562
214 Ga0501036_0539812 3300049572 Bacteria 969
215 Ga0501037_0080775 3300049573 Bacteria 2358
216 Ga0501038_0001100 3300049574 Bacteria 24469
217 Ga0501041_0313966 3300049577 Bacteria 988
218 Ga0501043_0029105 3300049579 Bacteria 4338
219 Ga0501046_0004881 3300049580 Bacteria 12082
220 Ga0501047_0031600 3300049581 Bacteria 5107
221 Ga0501048_0125981 3300049582 Bacteria 1811
222 Ga0501048_0144532 3300049582 Bacteria 1682
223 Ga0501067_0103937 3300049583 Bacteria 1578
224 Ga0501068_0136793 3300049584 Bacteria 1534
225 Ga0501070_0028520 3300049586 Bacteria 4683
226 Ga0501073_0307588 3300049589 Bacteria 1093
227 Ga0501075_0217980 3300049591 Bacteria 1456
228 Ga0501075_1492202 3300049591 Bacteria 512
229 Ga0501207_121616 3300049654 Bacteria 542
230 Ga0501079_0094040 3300049741 Bacteria 2323
231 Ga0501079_0524577 3300049741 Bacteria 931
232 Ga0501080_0293181 3300049742 Bacteria 1477
233 Ga0501081_0379524 3300049743 Bacteria 1044
234 Ga0501083_0019557 3300049744 Bacteria 4716
235 Ga0501035_0015420 3300049822 Bacteria 7050
236 Ga0501044_0011995 3300049823 Bacteria 9389
237 nmdc:mga03683_13553_c1 3300050489 Bacteria 3003
238 nmdc:mga03n38_20294_c1 3300050490 Bacteria 2657
239 nmdc:mga00v17_261321_c1 3300050491 Bacteria 1123
240 nmdc:mga0yw44_962193_c1 3300050492 Bacteria 578
241 nmdc:mga07m45_446257_c1 3300050496 Bacteria 750
242 nmdc:mga05p37_1179070_c1 3300050507 Bacteria 794
243 nmdc:mga05p37_642059_c1 3300050507 Bacteria 1190
244 nmdc:mga05p37_833389_c1 3300050507 Bacteria 1004
245 nmdc:mga05p37_865139_c1 3300050507 Bacteria 980
246 nmdc:mga09592_16095_c1 3300050508 Bacteria 6113
247 nmdc:mga09592_356929_c1 3300050508 Bacteria 1265
248 nmdc:mga0qj67_1590588_c1 3300050509 Bacteria 501
249 nmdc:mga0qj67_64120_c1 3300050509 Bacteria 2922
250 nmdc:mga06r32_126013_c1 3300050510 Bacteria 2530
251 nmdc:mga06r32_199480_c1 3300050510 Bacteria 1989
252 Ga0495655_0062186 3300053083 Bacteria 1021
253 Ga0500646_0000357 3300053090 Bacteria 13753
254 Ga0500583_0003525 3300053092 Bacteria 4939
255 Ga0500641_0007568 3300053096 Bacteria 3874
256 Ga0500650_0241748 3300053098 Bacteria 812
257 Ga0500654_171914 3300053099 Bacteria 710
258 Ga0500614_217605 3300053123 Bacteria 591
259 Ga0500588_0020075 3300053146 Bacteria 1786
260 Ga0500590_337300 3300053148 Bacteria 546
261 Ga0500630_165199 3300053159 Bacteria 916
262 Ga0501084_0389478 3300054114 Bacteria 1178
263 Ga0587082_089324 3300059504 Bacteria 655
264 Ga0587128_034900 3300059630 Bacteria 853
265 Ga0587067_125725 3300059640 Bacteria 620
266 Ga0587079_113877 3300059647 Bacteria 661
267 Ga0587108_022978 3300059653 Bacteria 602
268 Ga0501082_0005169 3300060353 Bacteria 11353
269 Ga0501082_0009930 3300060353 Bacteria 8207
270 Ga0530510_0361883 3300061734 Bacteria 1090
271 2547410074 2547132111 Bacteria 8013147
272 2558912598 2558860112 Bacteria 9931328
273 2585299409 2582581312 Bacteria 7308206
274 2585308206 2582581313 Bacteria 10042643
275 2585319170 2582581314 Bacteria 11452267
276 2616696897 2616644814 Bacteria 11555299
277 2616902036 2616644941 Bacteria 8510691
278 2643764868 2643221548 Bacteria 8053412
279 2643902791 2643221578 Bacteria 9213798
280 2644017230 2643221601 Bacteria 7493239
281 2644082756 2643221613 Bacteria 4622396
282 2644173809 2643221631 Bacteria 8168043
283 2644261711 2643221647 Bacteria 10741251
284 2644404700 2643221673 Bacteria 9196637
285 2644439214 2643221678 Bacteria 9540101
286 2644461292 2643221682 Bacteria 6743283
287 2644525128 2643221694 Bacteria 4392972
288 2644633401 2643221714 Bacteria 9015452
289 2644665618 2643221721 Bacteria 4486924
290 2644669216 2643221722 Bacteria 4247614
291 2784589619 2784132148 Bacteria 8627943
292 2785341984 2784746763 Bacteria 9783172
293 2785370663 2784746768 Bacteria 10036182
294 2786671846 2786546132 Bacteria 10419719
295 2808843219 2808606359 Bacteria 9866990
296 2808912804 2808606375 Bacteria 9466072
297 2808921567 2808606375 Bacteria 9466072
298 2809233299 2808606448 Bacteria 8656184
299 2811845206 2808606982 Bacteria 7791042
300 2812356829 2811994879 Bacteria 9313447
301 2812364296 2811994880 Bacteria 4147780
302 2819695319 2818991463 Bacteria 7948711
303 2819741117 2818991472 Bacteria 10089953
304 2835191129 2835188231 Bacteria 3476928
305 2837268950 2837268691 Bacteria 7850704
306 2839989609 2839986021 Bacteria 3685650
307 2852640443 2852635781 Bacteria 8251373
308 2862286748 2862281513 Bacteria 9621493
309 2862387245 2862382967 Bacteria 10317375
310 2862514397 2862507626 Bacteria 9425308
311 2862578288 2862574272 Bacteria 10567477
312 2863411675 2863404153 Bacteria 9672205
313 2866555680 2866552031 Bacteria 5824618
314 2867434721 2867428634 Bacteria 9590268
315 2868090618 2868088558 Bacteria 7609351
316 2873154786 2873151551 Bacteria 8625867
317 2875395925 2875391855 Bacteria 7600475
318 2877679925 2877676314 Bacteria 9512378
319 2884996519 2884994152 Bacteria 4492978
320 2912718571 2912715099 Bacteria 9460473
321 2919475434 2919468124 Bacteria 9133025
322 2932432110 2932431166 Bacteria 4215299
323 2935892201 2935890801 Bacteria 4593001
324 2946048710 2946045630 Bacteria 8527308
325 2946069042 2946064051 Bacteria 8957905
326 2946076990 2946072368 Bacteria 8999607
327 2947227895 2947224130 Bacteria 9938529
328 2954003022 2954002825 Bacteria 9173742
329 2954384880 2954380949 Bacteria 10050426
330 2954678123 2954673503 Bacteria 9685905
331 2954686035 2954682443 Bacteria 9862841
332 2954695693 2954691527 Bacteria 10720516
333 2954710887 2954701450 Bacteria 10834262
334 2954715109 2954711539 Bacteria 10867210
335 2954725051 2954721474 Bacteria 10456478
336 2954736767 2954731030 Bacteria 10243860
337 2954743984 2954740390 Bacteria 10229294
338 2954755614 2954749733 Bacteria 10366972
339 2954762924 2954759201 Bacteria 9358192
340 2966601553 2966598605 Bacteria 7676064
341 2984577690 2984576629 Bacteria 4248407
342 2990062195 2990059506 Bacteria 9321252
343 2990260611 2990256926 Bacteria 4252839
344 3006397702 3006393351 Bacteria 6615579
345 3006492622 3006486233 Bacteria 8157040
346 3006499687 3006493962 Bacteria 8825450
347 8008566428 8008558824 Bacteria 10610750
348 8008577899 8008574985 Bacteria 7815457
349 8023626414 8023623736 Bacteria 8593882
350 8048410724 8048406513 Bacteria 8936924
351 8056833862 8056829672 Bacteria 9045328
352 Ga0451787_746705
353 LJNas_1001813
354 Ga0070683_100407492
355 Ga0070683_101532207
356 Ga0068869_100796339
357 Ga0070666_11037378
358 Ga0070682_100013171
359 Ga0070682_100464474
360 Ga0070682_100594767
361 Ga0068868_100074799
362 Ga0070689_101544142
363 Ga0070691_10074313
364 Ga0070687_101207216
365 Ga0070661_100988268
366 Ga0070671_100811401
367 Ga0070674_101663062
368 Ga0070711_100227492
369 Ga0070663_100017692
370 Ga0070663_100707406
371 Ga0070663_101103461
372 Ga0070678_100180182
373 Ga0070684_100847090
374 Ga0068853_100000015
375 Ga0068853_102224017
376 Ga0070672_100796847
377 Ga0070672_100888514
378 Ga0070672_102060333
379 Ga0068855_100038437
380 Ga0070664_100573799
381 Ga0068857_100488850
382 Ga0068854_100649104
383 Ga0070702_100799441
384 Ga0068852_100185295
385 Ga0068859_100897515
386 Ga0068864_100499625
387 Ga0068864_101328953
388 Ga0068864_101465608
389 Ga0068870_11069145
390 Ga0068862_101605588
391 Ga0081539_10005222
392 Ga0075363_100014983
393 Ga0075363_100215728
394 Ga0075364_10100164
395 Ga0075366_10305363
396 Ga0075428_100007414
397 Ga0075428_100124352
398 Ga0075428_100892401
399 Ga0075428_101850925
400 Ga0075430_100015607
401 Ga0075430_100125344
402 Ga0075431_100068233
403 Ga0075431_101137844
404 Ga0075429_100009820
405 Ga0075429_101854338
406 Ga0097620_100897593
407 Ga0099826_10348722
408 Ga0105245_10085855
409 Ga0105245_12126429
410 Ga0114129_10072142
411 Ga0114129_10235665
412 Ga0114129_10857389
413 Ga0105243_10214048
414 Ga0105243_10300960
415 Ga0105243_10928212
416 Ga0105241_10267771
417 Ga0105241_10361154
418 Ga0105242_10160534
419 Ga0105238_10117057
420 Ga0105249_11473973
421 Ga0157371_10531170
422 Ga0157369_10161249
423 Ga0157374_10693352
424 Ga0157374_11377547
425 Ga0157378_10882554
426 Ga0163162_11039406
427 Ga0157375_10813709
428 Ga0157375_11300354
429 Ga0157375_11992382
430 Ga0163163_10811666
431 Ga0163163_12630819
432 Ga0157380_10798335
433 Ga0157380_11009813
434 Ga0157377_10375312
435 Ga0163161_10237853
436 Ga0163161_10237987
437 Ga0163161_10261898
438 Ga0213876_10319113
439 Ga0207656_10288421
440 Ga0207643_10737284
441 Ga0207663_10185977
442 Ga0207649_10823690
443 Ga0207650_10307235
444 Ga0207687_10056378
445 Ga0207644_10890095
446 Ga0207644_11094525
447 Ga0207691_11208086
448 Ga0207689_10430621
449 Ga0207640_10576138
450 Ga0207677_10089049
451 Ga0207639_10000022
452 Ga0207678_10963571
453 Ga0207676_10915136
454 Ga0207676_11314693
455 Ga0207676_12385272
456 Ga0207683_10245056
457 Ga0268266_12008009
458 Ga0268265_12666026
459 Ga0316177_1075624
460 Ga0314311_1069726
461 Ga0307508_10046127
462 Ga0316575_10000004
463 Ga0307413_10506706
464 Ga0307410_10845990
465 Ga0307406_11412339
466 Ga0307406_11630783
467 Ga0307415_100227104
468 Ga0307510_10116989
469 Ga0373945_0149188
470 Ga0373955_0113393
471 Ga0373935_0520283
472 Ga0373927_0450411
473 Ga0395899_0337634
474 Ga0395900_0008791
475 Ga0395900_0080690
476 Ga0395898_0011400
477 Ga0395898_0035335
478 Ga0395905_0060113
479 Ga0395905_0082226
480 Ga0395901_0003772
481 Ga0436365_1894754
482 Ga0439453_0047983
483 Ga0451802_2138939
484 Ga0451833_1487888
485 Ga0451843_1731857
486 Ga0451853_0245141
487 Ga0451853_1117672
488 Ga0439433_0174710
489 Ga0450900_004844
490 Ga0450905_064303
491 Ga0450901_012578
492 Ga0453683_0968184
493 Ga0466966_0568175
494 Ga0466961_0072917
495 Ga0466964_0355862
496 Ga0495627_110592
497 Ga0495603_0292308
498 Ga0495603_0521297
499 Ga0495641_0310527
500 Ga0495639_0090199
501 Ga0495662_0017622
502 Ga0495594_0053335
503 Ga0495606_0042582
504 Ga0495606_0218988
505 Ga0495610_0365742
506 Ga0495620_0212580
507 Ga0495628_0387827
508 Ga0495630_0512827
509 Ga0495630_0859023
510 Ga0495652_0297046
511 Ga0495665_0011099
512 Ga0495640_0086582
513 Ga0495586_0196497
514 Ga0495587_0549605
515 Ga0495668_0167989
516 Ga0495625_0900082
517 Ga0495588_0027474
518 Ga0495599_0688846
519 Ga0495613_0406023
520 Ga0495624_0113962
521 Ga0495600_0082971
522 Ga0495604_0001536
523 Ga0495636_0116931
524 Ga0495674_0055153
525 Ga0495672_0122768
526 Ga0495676_0173648
527 Ga0495675_0000675
528 Ga0495685_020602
529 Ga0495593_0005482
530 Ga0496102_0759836
531 Ga0496108_0014028
532 Ga0496109_1025962
533 Ga0496110_0197749
534 Ga0496110_0616877
535 Ga0496111_0840896
536 Ga0496112_0004865
537 Ga0496112_0117572
538 Ga0496112_0201784
539 Ga0496112_0917514
540 Ga0496112_1540421
541 Ga0496113_0036685
542 Ga0496113_1067901
543 Ga0496117_0292410
544 Ga0496118_0037955
545 Ga0496119_0014512
546 Ga0496122_0001064
547 Ga0496122_0001068
548 Ga0496123_0000612
549 Ga0496123_0266625
550 Ga0496124_0014789
551 Ga0496124_0381342
552 Ga0496125_0005134
553 Ga0496126_0036432
554 Ga0501031_0064207
555 Ga0501031_0396787
556 Ga0501032_0001522
557 Ga0501034_0024576
558 Ga0501034_0033852
559 Ga0501034_0044734
560 Ga0501034_0075736
561 Ga0501034_0320116
562 Ga0501034_0578868
563 Ga0501034_0844857
564 Ga0501036_0091993
565 Ga0501036_0539812
566 Ga0501037_0080775
567 Ga0501038_0001100
568 Ga0501041_0313966
569 Ga0501043_0029105
570 Ga0501046_0004881
571 Ga0501047_0031600
572 Ga0501048_0125981
573 Ga0501048_0144532
574 Ga0501067_0103937
575 Ga0501068_0136793
576 Ga0501070_0028520
577 Ga0501073_0307588
578 Ga0501075_0217980
579 Ga0501075_1492202
580 Ga0501207_121616
581 Ga0501079_0094040
582 Ga0501079_0524577
583 Ga0501080_0293181
584 Ga0501081_0379524
585 Ga0501083_0019557
586 Ga0501035_0015420
587 Ga0501044_0011995
588 nmdc:mga03683_13553_c1
589 nmdc:mga03n38_20294_c1
590 nmdc:mga00v17_261321_c1
591 nmdc:mga0yw44_962193_c1
592 nmdc:mga07m45_446257_c1
593 nmdc:mga05p37_1179070_c1
594 nmdc:mga05p37_642059_c1
595 nmdc:mga05p37_833389_c1
596 nmdc:mga05p37_865139_c1
597 nmdc:mga09592_16095_c1
598 nmdc:mga09592_356929_c1
599 nmdc:mga0qj67_1590588_c1
600 nmdc:mga0qj67_64120_c1
601 nmdc:mga06r32_126013_c1
602 nmdc:mga06r32_199480_c1
603 Ga0495655_0062186
604 Ga0500646_0000357
605 Ga0500583_0003525
606 Ga0500641_0007568
607 Ga0500650_0241748
608 Ga0500654_171914
609 Ga0500614_217605
610 Ga0500588_0020075
611 Ga0500590_337300
612 Ga0500630_165199
613 Ga0501084_0389478
614 Ga0587082_089324
615 Ga0587128_034900
616 Ga0587067_125725
617 Ga0587079_113877
618 Ga0587108_022978
619 Ga0501082_0005169
620 Ga0501082_0009930
621 Ga0530510_0361883
622 2547410074
623 2558912598
624 2585299409
625 2585308206
626 2585319170
627 2616696897
628 2616902036
629 2643764868
630 2643902791
631 2644017230
632 2644082756
633 2644173809
634 2644261711
635 2644404700
636 2644439214
637 2644461292
638 2644525128
639 2644633401
640 2644665618
641 2644669216
642 2784589619
643 2785341984
644 2785370663
645 2786671846
646 2808843219
647 2808912804
648 2808921567
649 2809233299
650 2811845206
651 2812356829
652 2812364296
653 2819695319
654 2819741117
655 2835191129
656 2837268950
657 2839989609
658 2852640443
659 2862286748
660 2862387245
661 2862514397
662 2862578288
663 2863411675
664 2866555680
665 2867434721
666 2868090618
667 2873154786
668 2875395925
669 2877679925
670 2884996519
671 2912718571
672 2919475434
673 2932432110
674 2935892201
675 2946048710
676 2946069042
677 2946076990
678 2947227895
679 2954003022
680 2954384880
681 2954678123
682 2954686035
683 2954695693
684 2954710887
685 2954715109
686 2954725051
687 2954736767
688 2954743984
689 2954755614
690 2954762924
691 2966601553
692 2984577690
693 2990062195
694 2990260611
695 3006397702
696 3006492622
697 3006499687
698 8008566428
699 8008577899
700 8023626414
701 8048410724
702 8056833862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

20

124

0.94

Map