F418703

General Info

Members Datasets Scaffolds Average Seq Length
351 218 702 211

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0000538|Ga0373934_0000538_8914_9669
Length 251
Sequence VGDQTGQESRSTGHRAFISVTVMTSIESVTLEVADLTAANRFYTTAFGSGTPVRLRASQAPATGFRGFTLSLTVSQPATVNGLIGAALDAGATPLKPAAKSFWGYGGVVQAPDGTIWKVATSAKKDTGPASWQIDEIVLLLGVADMAASKRFYVDRGLAVAKSFGRKYVEFATPSSPVRLALYGRRALAEDAGVPAEGTGSHRLTIASDAGSFTDPDGFAWEAADTGAEVGPAMALAQDATAVSSEITGRR

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 2508501039 Frankia saprophytica CN3 Isolate Nodule
198 2517572101 Frankia sp. DC12 Isolate Nodule
199 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
200 2643221576 Nocardioides sp. Root614 Isolate Unclassified
201 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
202 2643221590 Nocardioides sp. Root682 Isolate Unclassified
203 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
204 2687453737 Frankia sp. BMG5.36 Isolate Nodule
205 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
206 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
207 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
208 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
209 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
210 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
211 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
212 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
213 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
214 8002775197 Frankia nepalensis CN7 Isolate Nodule
215 8002784119 Frankia sp. AgB1.9 Isolate Nodule
216 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
217 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
218 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 1.42
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 2.28
Rhizoplane 7.41
Rhizosphere 82.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0000538 3300035086 Bacteria 13338
2 Ga0070658_10040594 3300005327 Bacteria 3754
3 Ga0070683_100019899 3300005329 Bacteria 5966
4 Ga0070680_100015032 3300005336 Bacteria 6060
5 Ga0070680_100281602 3300005336 Bacteria 1409
6 Ga0070660_100021304 3300005339 Bacteria 4778
7 Ga0070660_100615128 3300005339 Bacteria 909
8 Ga0070692_10108030 3300005345 Bacteria 1535
9 Ga0070659_100471539 3300005366 Bacteria 1067
10 Ga0070659_100640034 3300005366 Bacteria 916
11 Ga0070709_10045689 3300005434 Bacteria 2719
12 Ga0070709_10105056 3300005434 Bacteria 1888
13 Ga0070709_10266787 3300005434 Bacteria 1239
14 Ga0070714_100000095 3300005435 Bacteria 74697
15 Ga0070714_100043719 3300005435 Bacteria 3790
16 Ga0070714_100109751 3300005435 Bacteria 2441
17 Ga0070714_100109796 3300005435 Bacteria 2441
18 Ga0070714_100165256 3300005435 Bacteria 2005
19 Ga0070713_100012204 3300005436 Bacteria 6293
20 Ga0070713_100412283 3300005436 Bacteria 1263
21 Ga0070713_100522486 3300005436 Bacteria 1122
22 Ga0070708_100014483 3300005445 Bacteria 6490
23 Ga0070663_100393196 3300005455 Bacteria 1132
24 Ga0070685_10203197 3300005466 Bacteria 1289
25 Ga0070706_100775629 3300005467 Bacteria 888
26 Ga0070707_100025831 3300005468 Bacteria 5575
27 Ga0070707_100568649 3300005468 Bacteria 1096
28 Ga0070679_100038771 3300005530 Bacteria 4737
29 Ga0070665_100000718 3300005548 Bacteria 44076
30 Ga0070665_100312298 3300005548 Bacteria 1576
31 Ga0068857_100305499 3300005577 Bacteria 1467
32 Ga0068854_100486499 3300005578 Bacteria 1037
33 Ga0068856_100108873 3300005614 Bacteria 2767
34 Ga0068856_100410474 3300005614 Bacteria 1374
35 Ga0068856_101263420 3300005614 Bacteria 754
36 Ga0068864_100036539 3300005618 Bacteria 4187
37 Ga0068863_100445102 3300005841 Bacteria 1271
38 Ga0081455_10041761 3300005937 Bacteria 4030
39 Ga0081455_10255273 3300005937 Bacteria 1280
40 Ga0081538_10139974 3300005981 Bacteria 1118
41 Ga0070717_10146838 3300006028 Bacteria 2037
42 Ga0070717_10363094 3300006028 Bacteria 1296
43 Ga0075365_10077551 3300006038 Bacteria 2245
44 Ga0075368_10009277 3300006042 Bacteria 3536
45 Ga0070715_10003501 3300006163 Bacteria 5006
46 Ga0070712_100010361 3300006175 Bacteria 5879
47 Ga0075367_10021710 3300006178 Bacteria 3592
48 Ga0075428_100245180 3300006844 Bacteria 1932
49 Ga0075430_100098184 3300006846 Bacteria 2447
50 Ga0075430_100124109 3300006846 Bacteria 2152
51 Ga0068865_100065650 3300006881 Bacteria 2558
52 Ga0105240_11474685 3300009093 Bacteria 714
53 Ga0111539_10008746 3300009094 Bacteria 12843
54 Ga0111539_10049159 3300009094 Bacteria 5032
55 Ga0105245_10114423 3300009098 Bacteria 2513
56 Ga0114129_10056868 3300009147 Bacteria 5476
57 Ga0114129_10092075 3300009147 Bacteria 4200
58 Ga0114129_10136330 3300009147 Bacteria 3368
59 Ga0114129_10588698 3300009147 Bacteria 1443
60 Ga0114129_10735964 3300009147 Bacteria 1264
61 Ga0105243_10022856 3300009148 Bacteria 4753
62 Ga0105241_10451411 3300009174 Bacteria 1137
63 Ga0105242_10023936 3300009176 Bacteria 4819
64 Ga0105248_10931328 3300009177 Bacteria 981
65 Ga0105238_10268647 3300009551 Bacteria 1686
66 Ga0105246_10112740 3300011119 Bacteria 2001
67 Ga0105246_10827031 3300011119 Bacteria 824
68 Ga0157370_10010557 3300013104 Bacteria 9727
69 Ga0157369_10021105 3300013105 Bacteria 7281
70 Ga0157369_10560981 3300013105 Bacteria 1180
71 Ga0157378_10731090 3300013297 Bacteria 1011
72 Ga0157372_10109161 3300013307 Bacteria 3168
73 Ga0157372_10205718 3300013307 Bacteria 2281
74 Ga0157372_10239765 3300013307 Bacteria 2104
75 Ga0157372_10386881 3300013307 Bacteria 1630
76 Ga0163163_10049316 3300014325 Bacteria 4143
77 Ga0163163_10577220 3300014325 Bacteria 1187
78 Ga0163163_11352817 3300014325 Bacteria 774
79 Ga0182008_10292632 3300014497 Bacteria 850
80 Ga0157379_10065483 3300014968 Bacteria 3248
81 Ga0197907_10454805 3300020069 Bacteria 1028
82 Ga0206353_10916160 3300020082 Bacteria 1596
83 Ga0206353_11552679 3300020082 Bacteria 7367
84 Ga0213875_10000955 3300021388 Bacteria 20648
85 Ga0224712_10061150 3300022467 Bacteria 1501
86 Ga0207688_10038959 3300025901 Bacteria 2640
87 Ga0207647_10091740 3300025904 Bacteria 1811
88 Ga0207647_10342063 3300025904 Bacteria 848
89 Ga0207685_10011536 3300025905 Bacteria 2660
90 Ga0207699_10061659 3300025906 Bacteria 2257
91 Ga0207699_10080945 3300025906 Bacteria 2014
92 Ga0207699_10261443 3300025906 Bacteria 1196
93 Ga0207705_10018537 3300025909 Bacteria 4977
94 Ga0207707_10010203 3300025912 Bacteria 8153
95 Ga0207660_10069426 3300025917 Bacteria 2559
96 Ga0207657_10024483 3300025919 Bacteria 5586
97 Ga0207657_10467499 3300025919 Bacteria 989
98 Ga0207652_10015595 3300025921 Bacteria 6183
99 Ga0207652_10075154 3300025921 Bacteria 2944
100 Ga0207646_10114730 3300025922 Bacteria 2419
101 Ga0207687_10293679 3300025927 Bacteria 1307
102 Ga0207700_10007775 3300025928 Bacteria 6586
103 Ga0207700_10085843 3300025928 Bacteria 2471
104 Ga0207664_10000910 3300025929 Bacteria 19968
105 Ga0207664_10009673 3300025929 Bacteria 6777
106 Ga0207664_10019020 3300025929 Bacteria 5069
107 Ga0207664_10204442 3300025929 Bacteria 1706
108 Ga0207690_10436698 3300025932 Bacteria 1050
109 Ga0207709_10076262 3300025935 Bacteria 2146
110 Ga0207670_10565583 3300025936 Bacteria 930
111 Ga0207665_10001614 3300025939 Bacteria 15213
112 Ga0207711_10705940 3300025941 Bacteria 941
113 Ga0207661_10036497 3300025944 Bacteria 3837
114 Ga0207661_10121324 3300025944 Bacteria 2226
115 Ga0207661_10122617 3300025944 Bacteria 2215
116 Ga0207679_10365530 3300025945 Bacteria 1261
117 Ga0207712_11239446 3300025961 Bacteria 666
118 Ga0207678_10029509 3300026067 Bacteria 4787
119 Ga0207678_10282199 3300026067 Bacteria 1425
120 Ga0207678_11120275 3300026067 Bacteria 697
121 Ga0207702_10215450 3300026078 Bacteria 1787
122 Ga0207676_10013533 3300026095 Bacteria 5857
123 Ga0207676_10102072 3300026095 Bacteria 2380
124 Ga0207674_10026690 3300026116 Bacteria 6128
125 Ga0207674_10097412 3300026116 Bacteria 2925
126 Ga0207683_10205024 3300026121 Bacteria 1793
127 Ga0207428_10400910 3300027907 Bacteria 1004
128 Ga0268266_10004924 3300028379 Bacteria 12651
129 Ga0265336_10011455 3300028666 Bacteria 3014
130 Ga0265338_10000503 3300028800 Bacteria 69758
131 Ga0307513_10002850 3300031456 Bacteria 23690
132 Ga0307513_10135524 3300031456 Bacteria 2399
133 Ga0307508_10054302 3300031616 Bacteria 3553
134 Ga0307405_10153105 3300031731 Bacteria 1624
135 Ga0307410_10462570 3300031852 Bacteria 1037
136 Ga0307409_100030908 3300031995 Bacteria 3856
137 Ga0307416_100395283 3300032002 Bacteria 1418
138 Ga0316214_1002036 3300033545 Bacteria 2455
139 Ga0373953_0000941 3300035117 Bacteria 8168
140 Ga0373954_0001276 3300035118 Bacteria 10112
141 Ga0373956_0002203 3300035119 Bacteria 8040
142 Ga0373957_0000084 3300035120 Bacteria 22249
143 Ga0373955_0000067 3300035172 Bacteria 41250
144 Ga0373955_0035253 3300035172 Bacteria 2649
145 Ga0373924_0007369 3300035410 Bacteria 3970
146 Ga0373933_0000174 3300035724 Bacteria 42076
147 Ga0373933_0014122 3300035724 Bacteria 4435
148 Ga0373937_0001041 3300036401 Bacteria 23444
149 Ga0373937_0008808 3300036401 Bacteria 8753
150 Ga0373937_0508083 3300036401 Bacteria 1145
151 Ga0372808_002445 3300036459 Bacteria 2146
152 Ga0373925_0000168 3300037068 Bacteria 70746
153 Ga0373925_0002467 3300037068 Bacteria 14789
154 Ga0373925_0007347 3300037068 Bacteria 8043
155 Ga0373925_0009155 3300037068 Bacteria 7207
156 Ga0373925_0207282 3300037068 Bacteria 1561
157 Ga0395899_0019019 3300037312 Bacteria 5220
158 Ga0395899_0060432 3300037312 Bacteria 2792
159 Ga0395900_0059623 3300037418 Bacteria 3929
160 Ga0395900_0143528 3300037418 Bacteria 2443
161 Ga0395898_0018796 3300037466 Bacteria 7041
162 Ga0395898_0038704 3300037466 Bacteria 4725
163 Ga0395898_0039480 3300037466 Bacteria 4672
164 Ga0395898_0104001 3300037466 Bacteria 2724
165 Ga0395898_0378777 3300037466 Bacteria 1349
166 Ga0395905_0972434 3300037471 Bacteria 752
167 Ga0436364_0957642 3300037853 Bacteria 12578
168 Ga0395901_0009781 3300038443 Bacteria 9725
169 Ga0395901_0033489 3300038443 Bacteria 5304
170 Ga0395901_0080532 3300038443 Bacteria 3400
171 Ga0436365_0432624 3300039437 Bacteria 1915
172 Ga0439442_015802 3300042002 Bacteria 1555
173 Ga0439445_0031497 3300042004 Bacteria 1379
174 Ga0439446_0004104 3300042156 Bacteria 3673
175 Ga0450909_040989 3300042185 Bacteria 713
176 Ga0439434_0003361 3300042435 Bacteria 4690
177 Ga0466972_0100484 3300044658 Bacteria 1369
178 Ga0466966_0366403 3300044684 Bacteria 866
179 Ga0466961_0162756 3300044693 Bacteria 1390
180 Ga0466961_0293007 3300044693 Bacteria 995
181 Ga0466963_0003657 3300044694 Bacteria 8845
182 Ga0466963_0006356 3300044694 Bacteria 6988
183 Ga0466963_0353797 3300044694 Bacteria 1034
184 Ga0466963_0566747 3300044694 Bacteria 802
185 Ga0466963_0675771 3300044694 Bacteria 729
186 Ga0466971_0041436 3300044719 Bacteria 2068
187 Ga0466971_0062189 3300044719 Bacteria 1689
188 Ga0466971_0192544 3300044719 Bacteria 961
189 Ga0466957_0027080 3300044842 Bacteria 3405
190 Ga0466957_0050589 3300044842 Bacteria 2529
191 Ga0466960_0133503 3300044901 Bacteria 1313
192 Ga0466960_0155531 3300044901 Bacteria 1224
193 Ga0466960_0328021 3300044901 Bacteria 868
194 Ga0466960_0460915 3300044901 Bacteria 740
195 Ga0466959_0235915 3300045049 Bacteria 1265
196 Ga0466959_0358473 3300045049 Bacteria 994
197 Ga0466958_0009810 3300045836 Bacteria 5343
198 Ga0466958_0065007 3300045836 Bacteria 2226
199 Ga0466958_0077372 3300045836 Bacteria 2043
200 Ga0466958_0223649 3300045836 Bacteria 1201
201 Ga0466958_0378071 3300045836 Bacteria 913
202 Ga0466958_0402887 3300045836 Bacteria 883
203 Ga0466967_0011265 3300045976 Bacteria 6759
204 Ga0466967_0019827 3300045976 Bacteria 5418
205 Ga0466967_0057615 3300045976 Bacteria 3430
206 Ga0466967_0093925 3300045976 Bacteria 2730
207 Ga0466967_0142079 3300045976 Bacteria 2237
208 Ga0466967_0236415 3300045976 Bacteria 1741
209 Ga0466967_0278886 3300045976 Bacteria 1603
210 Ga0466967_0435290 3300045976 Bacteria 1280
211 Ga0495592_0000013 3300046454 Bacteria 151780
212 Ga0495592_0376205 3300046454 Bacteria 905
213 Ga0495603_0000550 3300046455 Bacteria 20947
214 Ga0495603_0002660 3300046455 Bacteria 10538
215 Ga0495629_0001975 3300046459 Bacteria 15979
216 Ga0495629_0002584 3300046459 Bacteria 13861
217 Ga0495629_0070719 3300046459 Bacteria 2435
218 Ga0495638_0113790 3300046460 Bacteria 1605
219 Ga0495651_0000022 3300046462 Bacteria 118601
220 Ga0495651_0008110 3300046462 Bacteria 8050
221 Ga0495653_0001833 3300046463 Bacteria 16750
222 Ga0495653_0018666 3300046463 Bacteria 5631
223 Ga0495650_0016885 3300046471 Bacteria 3676
224 Ga0495594_0001353 3300046499 Bacteria 12719
225 Ga0495608_0000029 3300046511 Bacteria 151790
226 Ga0495608_0011628 3300046511 Bacteria 6123
227 Ga0495628_0009881 3300046516 Bacteria 8123
228 Ga0495628_0014501 3300046516 Bacteria 6605
229 Ga0495632_0037682 3300046519 Bacteria 2452
230 Ga0495652_0000412 3300046529 Bacteria 49856
231 Ga0495652_0015048 3300046529 Bacteria 6929
232 Ga0495640_0033939 3300046533 Bacteria 3623
233 Ga0495586_0284344 3300046535 Bacteria 947
234 Ga0495587_0000022 3300046536 Bacteria 151790
235 Ga0495587_0015808 3300046536 Bacteria 4704
236 Ga0495587_0288274 3300046536 Bacteria 919
237 Ga0495645_0103793 3300046543 Bacteria 2019
238 Ga0495622_0033788 3300046557 Bacteria 2387
239 Ga0495667_0000028 3300046559 Bacteria 151705
240 Ga0495667_0004242 3300046559 Bacteria 9655
241 Ga0495634_0021419 3300046642 Bacteria 4570
242 Ga0495588_0025057 3300046674 Bacteria 2969
243 Ga0495657_0000036 3300046675 Bacteria 118645
244 Ga0495657_0004440 3300046675 Bacteria 11204
245 Ga0495599_0000131 3300046678 Bacteria 48587
246 Ga0495623_0000535 3300046679 Bacteria 25215
247 Ga0495623_0044124 3300046679 Bacteria 2834
248 Ga0495646_0015556 3300046680 Bacteria 4827
249 Ga0495658_0235032 3300046683 Bacteria 1150
250 Ga0495613_0004908 3300046689 Bacteria 10052
251 Ga0495600_0104194 3300046809 Bacteria 1848
252 Ga0495581_0446133 3300047315 Bacteria 754
253 Ga0495604_0000023 3300047317 Bacteria 151689
254 Ga0495604_0025253 3300047317 Bacteria 4735
255 Ga0495674_0036439 3300047319 Bacteria 4427
256 Ga0495674_0482940 3300047319 Bacteria 993
257 Ga0495674_0591629 3300047319 Bacteria 880
258 Ga0495676_0000150 3300047321 Bacteria 53407
259 Ga0495676_0009707 3300047321 Bacteria 8749
260 Ga0495680_0000232 3300047322 Bacteria 60902
261 Ga0495680_0000679 3300047322 Bacteria 38049
262 Ga0495680_0137041 3300047322 Bacteria 1794
263 Ga0495675_0000492 3300047444 Bacteria 25639
264 Ga0495675_0180532 3300047444 Bacteria 1292
265 Ga0495685_092395 3300047447 Bacteria 1002
266 Ga0495684_0004721 3300047471 Bacteria 10638
267 Ga0495684_0116862 3300047471 Bacteria 2011
268 Ga0495593_0087101 3300047673 Bacteria 1610
269 Ga0495602_0000653 3300048088 Bacteria 32538
270 Ga0495602_0026262 3300048088 Bacteria 5619
271 Ga0495602_0276508 3300048088 Bacteria 1239
272 Ga0495614_0003544 3300048089 Bacteria 6998
273 Ga0496100_0079004 3300048903 Bacteria 2216
274 Ga0496101_0531730 3300048904 Bacteria 929
275 Ga0496102_0000721 3300048905 Bacteria 32596
276 Ga0496102_1021444 3300048905 Bacteria 747
277 Ga0496104_0000996 3300048907 Bacteria 24228
278 Ga0496105_0014997 3300048908 Bacteria 6166
279 Ga0496105_0221596 3300048908 Bacteria 1540
280 Ga0496105_0428779 3300048908 Bacteria 1046
281 Ga0496106_0253043 3300048909 Bacteria 1409
282 Ga0496108_0050390 3300048911 Bacteria 3485
283 Ga0496108_0798842 3300048911 Bacteria 814
284 Ga0496109_0094369 3300048912 Bacteria 2769
285 Ga0496109_0107797 3300048912 Bacteria 2588
286 Ga0496109_0112173 3300048912 Bacteria 2536
287 Ga0496111_0134865 3300048914 Bacteria 1828
288 Ga0496112_0002003 3300048915 Bacteria 16109
289 Ga0496112_0031580 3300048915 Bacteria 5138
290 Ga0496112_0071751 3300048915 Bacteria 3423
291 Ga0496113_0034802 3300048916 Bacteria 3678
292 Ga0496113_0248070 3300048916 Bacteria 1421
293 Ga0496113_0616266 3300048916 Bacteria 869
294 Ga0496114_0149224 3300048917 Bacteria 2028
295 Ga0496114_0218342 3300048917 Bacteria 1673
296 Ga0496114_0237982 3300048917 Bacteria 1600
297 Ga0496114_0571391 3300048917 Bacteria 998
298 Ga0496115_0788088 3300048918 Bacteria 741
299 Ga0496121_0041382 3300048924 Bacteria 4027
300 Ga0496126_0523077 3300048929 Bacteria 945
301 Ga0501043_0003856 3300049579 Bacteria 12325
302 Ga0501048_0000047 3300049582 Bacteria 59594
303 Ga0501070_0088854 3300049586 Bacteria 2557
304 Ga0501072_0051528 3300049588 Bacteria 3240
305 Ga0501074_0197085 3300049590 Bacteria 1436
306 nmdc:mga03n38_25020_c1 3300050490 Bacteria 2447
307 nmdc:mga06z11_93926_c1 3300050494 Bacteria 1634
308 nmdc:mga07m45_14170_c1 3300050496 Bacteria 4241
309 nmdc:mga05p37_498561_c1 3300050507 Bacteria 1398
310 nmdc:mga05p37_500661_c1 3300050507 Bacteria 1394
311 nmdc:mga05p37_730314_c1 3300050507 Bacteria 1095
312 nmdc:mga05p37_821414_c1 3300050507 Bacteria 1014
313 nmdc:mga0qj67_273420_c1 3300050509 Bacteria 1370
314 nmdc:mga06r32_138727_c1 3300050510 Bacteria 2407
315 nmdc:mga06r32_263744_c1 3300050510 Bacteria 1710
316 nmdc:mga08y16_1217242_c1 3300050511 Bacteria 723
317 nmdc:mga08y16_142522_c1 3300050511 Bacteria 2491
318 nmdc:mga08y16_31253_c1 3300050511 Bacteria 5601
319 Ga0495595_0004078 3300053084 Bacteria 5851
320 Ga0495619_0292600 3300053085 Bacteria 1128
321 Ga0500646_0000134 3300053090 Bacteria 21323
322 Ga0500641_0002383 3300053096 Bacteria 6666
323 Ga0500559_0116019 3300053136 Bacteria 1243
324 Ga0500616_0000236 3300053153 Bacteria 86733
325 Ga0500616_0009146 3300053153 Bacteria 6052
326 Ga0500616_0077219 3300053153 Bacteria 1682
327 Ga0501082_0211771 3300060353 Bacteria 1686
328 Ga0466962_0071010 3300061719 Bacteria 1664
329 Ga0466962_0242927 3300061719 Bacteria 884
330 2508670933 2508501039 Bacteria 9978592
331 2517758895 2517572101 Bacteria 6884336
332 2523382712 2523231044 Bacteria 6434991
333 2643891131 2643221576 Bacteria 5214352
334 2643948098 2643221587 Bacteria 7586415
335 2643960187 2643221590 Bacteria 5214697
336 2676202468 2675902999 Bacteria 9438463
337 2689959287 2687453737 Bacteria 11203906
338 2739235220 2738543011 Bacteria 5731169
339 2753074793 2751185734 Bacteria 8863695
340 2768647621 2767802112 Bacteria 6465194
341 2774847044 2773857921 Bacteria 9435764
342 2862184136 2862178590 Bacteria 8583590
343 2870725945 2870721527 Bacteria 9689237
344 2889301781 2889300758 Bacteria 5690814
345 2918504881 2918501144 Bacteria 8668083
346 2939747219 2939743619 Bacteria 5762299
347 8002782433 8002775197 Bacteria 10728764
348 8002787867 8002784119 Bacteria 9788632
349 8055178263 8055172936 Bacteria 9305943
350 8055415027 8055412473 Bacteria 6257500
351 8056064002 8056060235 Bacteria 7259403
352 Ga0373934_0000538
353 Ga0070658_10040594
354 Ga0070683_100019899
355 Ga0070680_100015032
356 Ga0070680_100281602
357 Ga0070660_100021304
358 Ga0070660_100615128
359 Ga0070692_10108030
360 Ga0070659_100471539
361 Ga0070659_100640034
362 Ga0070709_10045689
363 Ga0070709_10105056
364 Ga0070709_10266787
365 Ga0070714_100000095
366 Ga0070714_100043719
367 Ga0070714_100109751
368 Ga0070714_100109796
369 Ga0070714_100165256
370 Ga0070713_100012204
371 Ga0070713_100412283
372 Ga0070713_100522486
373 Ga0070708_100014483
374 Ga0070663_100393196
375 Ga0070685_10203197
376 Ga0070706_100775629
377 Ga0070707_100025831
378 Ga0070707_100568649
379 Ga0070679_100038771
380 Ga0070665_100000718
381 Ga0070665_100312298
382 Ga0068857_100305499
383 Ga0068854_100486499
384 Ga0068856_100108873
385 Ga0068856_100410474
386 Ga0068856_101263420
387 Ga0068864_100036539
388 Ga0068863_100445102
389 Ga0081455_10041761
390 Ga0081455_10255273
391 Ga0081538_10139974
392 Ga0070717_10146838
393 Ga0070717_10363094
394 Ga0075365_10077551
395 Ga0075368_10009277
396 Ga0070715_10003501
397 Ga0070712_100010361
398 Ga0075367_10021710
399 Ga0075428_100245180
400 Ga0075430_100098184
401 Ga0075430_100124109
402 Ga0068865_100065650
403 Ga0105240_11474685
404 Ga0111539_10008746
405 Ga0111539_10049159
406 Ga0105245_10114423
407 Ga0114129_10056868
408 Ga0114129_10092075
409 Ga0114129_10136330
410 Ga0114129_10588698
411 Ga0114129_10735964
412 Ga0105243_10022856
413 Ga0105241_10451411
414 Ga0105242_10023936
415 Ga0105248_10931328
416 Ga0105238_10268647
417 Ga0105246_10112740
418 Ga0105246_10827031
419 Ga0157370_10010557
420 Ga0157369_10021105
421 Ga0157369_10560981
422 Ga0157378_10731090
423 Ga0157372_10109161
424 Ga0157372_10205718
425 Ga0157372_10239765
426 Ga0157372_10386881
427 Ga0163163_10049316
428 Ga0163163_10577220
429 Ga0163163_11352817
430 Ga0182008_10292632
431 Ga0157379_10065483
432 Ga0197907_10454805
433 Ga0206353_10916160
434 Ga0206353_11552679
435 Ga0213875_10000955
436 Ga0224712_10061150
437 Ga0207688_10038959
438 Ga0207647_10091740
439 Ga0207647_10342063
440 Ga0207685_10011536
441 Ga0207699_10061659
442 Ga0207699_10080945
443 Ga0207699_10261443
444 Ga0207705_10018537
445 Ga0207707_10010203
446 Ga0207660_10069426
447 Ga0207657_10024483
448 Ga0207657_10467499
449 Ga0207652_10015595
450 Ga0207652_10075154
451 Ga0207646_10114730
452 Ga0207687_10293679
453 Ga0207700_10007775
454 Ga0207700_10085843
455 Ga0207664_10000910
456 Ga0207664_10009673
457 Ga0207664_10019020
458 Ga0207664_10204442
459 Ga0207690_10436698
460 Ga0207709_10076262
461 Ga0207670_10565583
462 Ga0207665_10001614
463 Ga0207711_10705940
464 Ga0207661_10036497
465 Ga0207661_10121324
466 Ga0207661_10122617
467 Ga0207679_10365530
468 Ga0207712_11239446
469 Ga0207678_10029509
470 Ga0207678_10282199
471 Ga0207678_11120275
472 Ga0207702_10215450
473 Ga0207676_10013533
474 Ga0207676_10102072
475 Ga0207674_10026690
476 Ga0207674_10097412
477 Ga0207683_10205024
478 Ga0207428_10400910
479 Ga0268266_10004924
480 Ga0265336_10011455
481 Ga0265338_10000503
482 Ga0307513_10002850
483 Ga0307513_10135524
484 Ga0307508_10054302
485 Ga0307405_10153105
486 Ga0307410_10462570
487 Ga0307409_100030908
488 Ga0307416_100395283
489 Ga0316214_1002036
490 Ga0373953_0000941
491 Ga0373954_0001276
492 Ga0373956_0002203
493 Ga0373957_0000084
494 Ga0373955_0000067
495 Ga0373955_0035253
496 Ga0373924_0007369
497 Ga0373933_0000174
498 Ga0373933_0014122
499 Ga0373937_0001041
500 Ga0373937_0008808
501 Ga0373937_0508083
502 Ga0372808_002445
503 Ga0373925_0000168
504 Ga0373925_0002467
505 Ga0373925_0007347
506 Ga0373925_0009155
507 Ga0373925_0207282
508 Ga0395899_0019019
509 Ga0395899_0060432
510 Ga0395900_0059623
511 Ga0395900_0143528
512 Ga0395898_0018796
513 Ga0395898_0038704
514 Ga0395898_0039480
515 Ga0395898_0104001
516 Ga0395898_0378777
517 Ga0395905_0972434
518 Ga0436364_0957642
519 Ga0395901_0009781
520 Ga0395901_0033489
521 Ga0395901_0080532
522 Ga0436365_0432624
523 Ga0439442_015802
524 Ga0439445_0031497
525 Ga0439446_0004104
526 Ga0450909_040989
527 Ga0439434_0003361
528 Ga0466972_0100484
529 Ga0466966_0366403
530 Ga0466961_0162756
531 Ga0466961_0293007
532 Ga0466963_0003657
533 Ga0466963_0006356
534 Ga0466963_0353797
535 Ga0466963_0566747
536 Ga0466963_0675771
537 Ga0466971_0041436
538 Ga0466971_0062189
539 Ga0466971_0192544
540 Ga0466957_0027080
541 Ga0466957_0050589
542 Ga0466960_0133503
543 Ga0466960_0155531
544 Ga0466960_0328021
545 Ga0466960_0460915
546 Ga0466959_0235915
547 Ga0466959_0358473
548 Ga0466958_0009810
549 Ga0466958_0065007
550 Ga0466958_0077372
551 Ga0466958_0223649
552 Ga0466958_0378071
553 Ga0466958_0402887
554 Ga0466967_0011265
555 Ga0466967_0019827
556 Ga0466967_0057615
557 Ga0466967_0093925
558 Ga0466967_0142079
559 Ga0466967_0236415
560 Ga0466967_0278886
561 Ga0466967_0435290
562 Ga0495592_0000013
563 Ga0495592_0376205
564 Ga0495603_0000550
565 Ga0495603_0002660
566 Ga0495629_0001975
567 Ga0495629_0002584
568 Ga0495629_0070719
569 Ga0495638_0113790
570 Ga0495651_0000022
571 Ga0495651_0008110
572 Ga0495653_0001833
573 Ga0495653_0018666
574 Ga0495650_0016885
575 Ga0495594_0001353
576 Ga0495608_0000029
577 Ga0495608_0011628
578 Ga0495628_0009881
579 Ga0495628_0014501
580 Ga0495632_0037682
581 Ga0495652_0000412
582 Ga0495652_0015048
583 Ga0495640_0033939
584 Ga0495586_0284344
585 Ga0495587_0000022
586 Ga0495587_0015808
587 Ga0495587_0288274
588 Ga0495645_0103793
589 Ga0495622_0033788
590 Ga0495667_0000028
591 Ga0495667_0004242
592 Ga0495634_0021419
593 Ga0495588_0025057
594 Ga0495657_0000036
595 Ga0495657_0004440
596 Ga0495599_0000131
597 Ga0495623_0000535
598 Ga0495623_0044124
599 Ga0495646_0015556
600 Ga0495658_0235032
601 Ga0495613_0004908
602 Ga0495600_0104194
603 Ga0495581_0446133
604 Ga0495604_0000023
605 Ga0495604_0025253
606 Ga0495674_0036439
607 Ga0495674_0482940
608 Ga0495674_0591629
609 Ga0495676_0000150
610 Ga0495676_0009707
611 Ga0495680_0000232
612 Ga0495680_0000679
613 Ga0495680_0137041
614 Ga0495675_0000492
615 Ga0495675_0180532
616 Ga0495685_092395
617 Ga0495684_0004721
618 Ga0495684_0116862
619 Ga0495593_0087101
620 Ga0495602_0000653
621 Ga0495602_0026262
622 Ga0495602_0276508
623 Ga0495614_0003544
624 Ga0496100_0079004
625 Ga0496101_0531730
626 Ga0496102_0000721
627 Ga0496102_1021444
628 Ga0496104_0000996
629 Ga0496105_0014997
630 Ga0496105_0221596
631 Ga0496105_0428779
632 Ga0496106_0253043
633 Ga0496108_0050390
634 Ga0496108_0798842
635 Ga0496109_0094369
636 Ga0496109_0107797
637 Ga0496109_0112173
638 Ga0496111_0134865
639 Ga0496112_0002003
640 Ga0496112_0031580
641 Ga0496112_0071751
642 Ga0496113_0034802
643 Ga0496113_0248070
644 Ga0496113_0616266
645 Ga0496114_0149224
646 Ga0496114_0218342
647 Ga0496114_0237982
648 Ga0496114_0571391
649 Ga0496115_0788088
650 Ga0496121_0041382
651 Ga0496126_0523077
652 Ga0501043_0003856
653 Ga0501048_0000047
654 Ga0501070_0088854
655 Ga0501072_0051528
656 Ga0501074_0197085
657 nmdc:mga03n38_25020_c1
658 nmdc:mga06z11_93926_c1
659 nmdc:mga07m45_14170_c1
660 nmdc:mga05p37_498561_c1
661 nmdc:mga05p37_500661_c1
662 nmdc:mga05p37_730314_c1
663 nmdc:mga05p37_821414_c1
664 nmdc:mga0qj67_273420_c1
665 nmdc:mga06r32_138727_c1
666 nmdc:mga06r32_263744_c1
667 nmdc:mga08y16_1217242_c1
668 nmdc:mga08y16_142522_c1
669 nmdc:mga08y16_31253_c1
670 Ga0495595_0004078
671 Ga0495619_0292600
672 Ga0500646_0000134
673 Ga0500641_0002383
674 Ga0500559_0116019
675 Ga0500616_0000236
676 Ga0500616_0009146
677 Ga0500616_0077219
678 Ga0501082_0211771
679 Ga0466962_0071010
680 Ga0466962_0242927
681 2508670933
682 2517758895
683 2523382712
684 2643891131
685 2643948098
686 2643960187
687 2676202468
688 2689959287
689 2739235220
690 2753074793
691 2768647621
692 2774847044
693 2862184136
694 2870725945
695 2889301781
696 2918504881
697 2939747219
698 8002782433
699 8002787867
700 8055178263
701 8055415027
702 8056064002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8709 3 100
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.8526 111 162
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.8306 1 99
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8207 8 99
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8149 1 98
ID Description Score Start End Superfamily
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9052 47 99 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.875 47 105 3.30.720.110
2rbbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8554 3 100 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8345 47 99 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8292 47 99 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A3N4S069-F1-model_v4 Lactoylglutathione lyase 0.9917 3 201
AF-A0A7X7NKX7-F1-model_v4 Glyoxalase 0.9879 1 202
AF-A0A2U0X3W1-F1-model_v4 deleted 0.9871 1 203
AF-A0A1G8R981-F1-model_v4 Predicted lactoylglutathione lyase 0.987 1 204 GO:0016829
AF-E3IZC6-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.986 1 204

Map