F418620

General Info

Members Datasets Scaffolds Average Seq Length
351 227 320 268

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10687250|Ga0105248_106872502
Length 296
Sequence MSGALAAPLPGTAAAPSSSRGGSRKVLPGFKLTLGFTIFYLCLIVLIPLSALVLKTFALSWDQFWAAVASPRVLAAYRLTFGASFLAALVNVVFGLLVAWVLVRYEFPGKRVVDALVDLPFALPTAVAGISLTALLAGNGWIGQYLEPHGIKLAFNPAGVVIALIFIGMPFVVRTVQPVLEESEKELEEAAMCLGATRLQTFTKVIFPSIAPALLTGFAMAFARAIGEYGSVIFIAGNVPMVSEITPLIIIGKLEQYDYAGATALAVVMLSGSFLLLFVVNMLQAWSRRRSGGVHG

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2643221683 Variovorax sp. Root473 Isolate Unclassified
5 2738541277 Variovorax sp. GV051 Isolate Unclassified
6 2738543013 Variovorax sp. BT01 Isolate Unclassified
7 2738543019 Variovorax sp. GV040 Isolate Unclassified
8 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
9 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
10 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
11 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
12 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
13 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
14 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
15 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
16 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
17 2899924645 Variovorax sp. 369 Isolate Unclassified
18 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
19 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
20 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
21 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
22 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
23 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
24 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
25 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
26 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
27 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
28 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
29 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
30 2929520902 Variovorax beijingensis 502 Isolate Unclassified
31 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
34 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
35 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.17
Metatranscriptomes 0
Isolates 8.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 0
Rhizoplane 3.13
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10030150 3300003320 Bacteria 1434
2 Ga0055527_1010753 3300003760 Bacteria 1054
3 Ga0055535_1000330 3300003761 Bacteria 47889
4 Ga0055542_1000039 3300003762 Bacteria 215126
5 Ga0055526_1000523 3300003771 Bacteria 30490
6 Ga0055526_1004476 3300003771 Bacteria 8379
7 Ga0055537_1000111 3300003773 Bacteria 61884
8 Ga0055524_1004885 3300003775 Bacteria 6089
9 Ga0055536_1009209 3300003781 Bacteria 4121
10 Ga0055534_1000509 3300003784 Bacteria 21144
11 Ga0055534_1005996 3300003784 Bacteria 3142
12 Ga0055528_1000178 3300003790 Bacteria 53709
13 Ga0055528_1005582 3300003790 Bacteria 5822
14 Ga0055540_1009322 3300003792 Bacteria 3404
15 Ga0055531_10006766 3300003794 Bacteria 6412
16 Ga0070658_10269870 3300005327 Bacteria 1447
17 Ga0070690_100167970 3300005330 Bacteria 1508
18 Ga0070670_100121995 3300005331 Bacteria 2248
19 Ga0070670_100163298 3300005331 Bacteria 1931
20 Ga0070705_100050567 3300005440 Bacteria 2418
21 Ga0070694_100271846 3300005444 Bacteria 1289
22 Ga0070708_100303666 3300005445 Bacteria 1503
23 Ga0070698_100373104 3300005471 Bacteria 1359
24 Ga0070679_100172600 3300005530 Bacteria 2135
25 Ga0070679_100353557 3300005530 Bacteria 1417
26 Ga0068855_100000072 3300005563 Bacteria 121486
27 Ga0068855_100007253 3300005563 Bacteria 13442
28 Ga0068855_100119351 3300005563 Bacteria 3019
29 Ga0068855_100153299 3300005563 Bacteria 2619
30 Ga0068855_100991441 3300005563 Bacteria 883
31 Ga0068857_100136353 3300005577 Bacteria 2216
32 Ga0068854_100138584 3300005578 Bacteria 1864
33 Ga0068859_100275941 3300005617 Bacteria 1773
34 Ga0068864_100251168 3300005618 Bacteria 1642
35 Ga0068870_10234276 3300005840 Bacteria 1130
36 Ga0068860_100418943 3300005843 Bacteria 1327
37 Ga0075365_10032053 3300006038 Bacteria 3376
38 Ga0075364_10059375 3300006051 Bacteria 2507
39 Ga0075362_10175784 3300006177 Bacteria 1036
40 Ga0075366_10009650 3300006195 Bacteria 5395
41 Ga0075366_10079312 3300006195 Bacteria 1960
42 Ga0075370_10245900 3300006353 Bacteria 1060
43 Ga0075428_100032046 3300006844 Bacteria 5807
44 Ga0075428_100044773 3300006844 Bacteria 4862
45 Ga0075430_100374180 3300006846 Bacteria 1176
46 Ga0075429_100008176 3300006880 Bacteria 9092
47 Ga0097620_100275931 3300006931 Bacteria 1773
48 Ga0105240_10012766 3300009093 Bacteria 11577
49 Ga0111539_10016326 3300009094 Bacteria 9205
50 Ga0111539_10358559 3300009094 Bacteria 1697
51 Ga0111539_10385759 3300009094 Bacteria 1631
52 Ga0105247_10021003 3300009101 Bacteria 3928
53 Ga0114129_10011822 3300009147 Bacteria 12417
54 Ga0105243_10321056 3300009148 Bacteria 1411
55 Ga0105248_10041536 3300009177 Bacteria 5156
56 Ga0105248_10687250 3300009177 Bacteria 1154
57 Ga0105238_10000318 3300009551 Bacteria 52620
58 Ga0105238_10049198 3300009551 Bacteria 4247
59 Ga0105238_10071941 3300009551 Bacteria 3455
60 Ga0105238_10326500 3300009551 Bacteria 1521
61 Ga0105249_10061434 3300009553 Bacteria 3448
62 Ga0105239_10109056 3300010375 Bacteria 3067
63 Ga0163163_10248594 3300014325 Bacteria 1829
64 Ga0157380_10460634 3300014326 Bacteria 1224
65 Ga0157379_10218316 3300014968 Bacteria 1727
66 Ga0182006_1004807 3300015261 Bacteria 6570
67 Ga0182007_10019887 3300015262 Bacteria 2406
68 Ga0209148_1001908 3300025254 Bacteria 8536
69 Ga0209565_1000009 3300025263 Bacteria 751701
70 Ga0209673_1000036 3300025273 Bacteria 323162
71 Ga0209130_1014551 3300025284 Bacteria 1969
72 Ga0209675_1000013 3300025291 Bacteria 448220
73 Ga0209675_1000923 3300025291 Bacteria 18751
74 Ga0209676_1000301 3300025292 Bacteria 99952
75 Ga0209025_1000073 3300025294 Bacteria 282133
76 Ga0209564_1000122 3300025295 Bacteria 203709
77 Ga0209256_1000106 3300025299 Bacteria 187258
78 Ga0209051_1000406 3300025303 Bacteria 59626
79 Ga0209051_1000907 3300025303 Bacteria 29475
80 Ga0209051_1013448 3300025303 Bacteria 3894
81 Ga0209257_1000012 3300025304 Bacteria 1111138
82 Ga0209257_1005066 3300025304 Bacteria 9567
83 Ga0209257_1012144 3300025304 Bacteria 4028
84 Ga0207705_10074170 3300025909 Bacteria 2469
85 Ga0207705_10098846 3300025909 Bacteria 2145
86 Ga0207684_10031183 3300025910 Bacteria 4536
87 Ga0207695_10149060 3300025913 Bacteria 2280
88 Ga0207671_10058384 3300025914 Bacteria 2860
89 Ga0207652_10038159 3300025921 Bacteria 4070
90 Ga0207652_10395464 3300025921 Bacteria 1247
91 Ga0207681_10024600 3300025923 Bacteria 3866
92 Ga0207694_10026618 3300025924 Bacteria 4402
93 Ga0207650_10119120 3300025925 Bacteria 2053
94 Ga0207670_10390069 3300025936 Bacteria 1111
95 Ga0207711_10022130 3300025941 Bacteria 5314
96 Ga0207661_10047779 3300025944 Bacteria 3399
97 Ga0207667_10000055 3300025949 Bacteria 223770
98 Ga0207667_10005517 3300025949 Bacteria 15432
99 Ga0207667_10030522 3300025949 Bacteria 5831
100 Ga0207667_10187531 3300025949 Bacteria 2123
101 Ga0207712_10027650 3300025961 Bacteria 3788
102 Ga0207640_10095129 3300025981 Bacteria 2073
103 Ga0207703_10815908 3300026035 Bacteria 891
104 Ga0207676_10058317 3300026095 Bacteria 3045
105 Ga0207676_10135118 3300026095 Bacteria 2103
106 Ga0207674_10302419 3300026116 Bacteria 1549
107 Ga0207674_10510378 3300026116 Bacteria 1161
108 Ga0207675_100445232 3300026118 Bacteria 1283
109 Ga0207428_10248452 3300027907 Bacteria 1327
110 Ga0265337_1000950 3300028556 Bacteria 15167
111 Ga0265337_1029590 3300028556 Bacteria 1637
112 Ga0265326_10001112 3300028558 Bacteria 9574
113 Ga0265326_10003826 3300028558 Bacteria 4897
114 Ga0265319_1000174 3300028563 Bacteria 48778
115 Ga0265319_1000210 3300028563 Bacteria 44286
116 Ga0265319_1001367 3300028563 Bacteria 14673
117 Ga0265334_10002316 3300028573 Bacteria 8962
118 Ga0265334_10007345 3300028573 Bacteria 4729
119 Ga0265318_10001007 3300028577 Bacteria 17999
120 Ga0265318_10002070 3300028577 Bacteria 10989
121 Ga0265318_10003116 3300028577 Bacteria 8493
122 Ga0265323_10000255 3300028653 Bacteria 31257
123 Ga0265322_10000317 3300028654 Bacteria 20284
124 Ga0265322_10003443 3300028654 Bacteria 4779
125 Ga0265336_10000830 3300028666 Bacteria 16104
126 Ga0265336_10005140 3300028666 Bacteria 4864
127 Ga0265338_10001141 3300028800 Bacteria 43920
128 Ga0265338_10001712 3300028800 Bacteria 34790
129 Ga0265338_10004754 3300028800 Bacteria 18166
130 Ga0265338_10008339 3300028800 Bacteria 12603
131 Ga0265338_10024276 3300028800 Bacteria 6198
132 Ga0265338_10049198 3300028800 Bacteria 3824
133 Ga0265324_10000323 3300029957 Bacteria 35199
134 Ga0265330_10000076 3300031235 Bacteria 84642
135 Ga0265330_10000797 3300031235 Bacteria 19849
136 Ga0265332_10000002 3300031238 Bacteria 709510
137 Ga0265332_10000015 3300031238 Bacteria 243944
138 Ga0265332_10002710 3300031238 Bacteria 8850
139 Ga0265328_10000914 3300031239 Bacteria 13626
140 Ga0265320_10000569 3300031240 Bacteria 28515
141 Ga0265320_10005104 3300031240 Bacteria 8481
142 Ga0265325_10035809 3300031241 Bacteria 2633
143 Ga0265329_10000496 3300031242 Bacteria 20364
144 Ga0265340_10004206 3300031247 Bacteria 8071
145 Ga0265340_10068309 3300031247 Bacteria 1688
146 Ga0265339_10000994 3300031249 Bacteria 21727
147 Ga0265339_10050157 3300031249 Bacteria 2283
148 Ga0265331_10008126 3300031250 Bacteria 5992
149 Ga0265316_10002027 3300031344 Bacteria 21327
150 Ga0265316_10010948 3300031344 Bacteria 8231
151 Ga0265316_10365145 3300031344 Bacteria 1043
152 Ga0307509_10000543 3300031507 Bacteria 64572
153 Ga0265313_10002936 3300031595 Bacteria 14236
154 Ga0265313_10023181 3300031595 Bacteria 3349
155 Ga0316579_10152379 3300031691 Bacteria 1116
156 Ga0265314_10000066 3300031711 Bacteria 156399
157 Ga0265314_10000970 3300031711 Bacteria 33717
158 Ga0265342_10001043 3300031712 Bacteria 27135
159 Ga0265342_10013233 3300031712 Bacteria 5547
160 Ga0373924_0181548 3300035410 Bacteria 926
161 Ga0373933_0002411 3300035724 Bacteria 10539
162 Ga0373937_0000240 3300036401 Bacteria 53719
163 Ga0373937_0171768 3300036401 Bacteria 2034
164 Ga0395899_0017831 3300037312 Bacteria 5405
165 Ga0395900_0008029 3300037418 Bacteria 10862
166 Ga0395900_0062043 3300037418 Bacteria 3843
167 Ga0395900_0242069 3300037418 Bacteria 1809
168 Ga0395905_0000339 3300037471 Bacteria 66527
169 Ga0395905_0000472 3300037471 Bacteria 55579
170 Ga0395905_0004574 3300037471 Bacteria 14314
171 Ga0395905_0027546 3300037471 Bacteria 5359
172 Ga0395905_0046316 3300037471 Bacteria 4077
173 Ga0395905_0053882 3300037471 Bacteria 3764
174 Ga0395905_0223645 3300037471 Bacteria 1761
175 Ga0395905_0264738 3300037471 Bacteria 1604
176 Ga0395905_0389996 3300037471 Bacteria 1287
177 Ga0395901_0116493 3300038443 Bacteria 2807
178 Ga0395901_0226149 3300038443 Bacteria 1954
179 Ga0395901_0323109 3300038443 Bacteria 1596
180 Ga0436365_0096061 3300039437 Bacteria 1323
181 Ga0436365_1542265 3300039437 Bacteria 2197
182 Ga0439431_0040076 3300041997 Bacteria 1190
183 Ga0439445_0003999 3300042004 Bacteria 3327
184 Ga0439460_0029705 3300042461 Bacteria 1549
185 Ga0451577_0002542 3300042876 Bacteria 21559
186 Ga0451577_0084624 3300042876 Bacteria 2830
187 Ga0451577_0371461 3300042876 Bacteria 1297
188 Ga0451577_0374606 3300042876 Bacteria 1292
189 Ga0466969_0037501 3300044656 Bacteria 2444
190 Ga0453683_0000458 3300044673 Bacteria 46966
191 Ga0453683_0003282 3300044673 Bacteria 12011
192 Ga0466965_0028556 3300044683 Bacteria 2710
193 Ga0466965_0058368 3300044683 Bacteria 1924
194 Ga0466965_0064076 3300044683 Bacteria 1839
195 Ga0453684_0000499 3300044712 Bacteria 153532
196 Ga0453684_0003915 3300044712 Bacteria 32723
197 Ga0453684_0011748 3300044712 Bacteria 14602
198 Ga0453684_0099393 3300044712 Bacteria 3564
199 Ga0453684_0144470 3300044712 Bacteria 2836
200 Ga0453684_0274292 3300044712 Bacteria 1926
201 Ga0466968_0119222 3300044735 Bacteria 1193
202 Ga0466957_0003058 3300044842 Bacteria 9098
203 Ga0466960_0055928 3300044901 Bacteria 1919
204 Ga0466960_0166981 3300044901 Bacteria 1185
205 Ga0466959_0085138 3300045049 Bacteria 2275
206 Ga0466959_0171568 3300045049 Bacteria 1521
207 Ga0451576_0291430 3300045051 Bacteria 1706
208 Ga0451576_0423308 3300045051 Bacteria 1397
209 Ga0451576_0425573 3300045051 Bacteria 1393
210 Ga0495617_000574 3300046452 Bacteria 18841
211 Ga0495651_0004031 3300046462 Bacteria 11225
212 Ga0495653_0000011 3300046463 Bacteria 272314
213 Ga0495584_0000017 3300046491 Bacteria 149686
214 Ga0495585_0000064 3300046492 Bacteria 109302
215 Ga0495585_0033102 3300046492 Bacteria 2927
216 Ga0495596_0002227 3300046500 Bacteria 10557
217 Ga0495606_0014675 3300046507 Bacteria 6093
218 Ga0495616_0000727 3300046513 Bacteria 24274
219 Ga0495631_0007050 3300046518 Bacteria 5747
220 Ga0495648_0000007 3300046524 Bacteria 347305
221 Ga0495642_0005062 3300046528 Bacteria 5077
222 Ga0495642_0018943 3300046528 Bacteria 2696
223 Ga0495642_0096128 3300046528 Bacteria 1257
224 Ga0495587_0000456 3300046536 Bacteria 28557
225 Ga0495621_0076213 3300046539 Bacteria 1244
226 Ga0495597_0059369 3300046542 Bacteria 1670
227 Ga0495597_0169880 3300046542 Bacteria 885
228 Ga0495633_0033082 3300046558 Bacteria 2495
229 Ga0495633_0042273 3300046558 Bacteria 2165
230 Ga0495633_0063633 3300046558 Bacteria 1725
231 Ga0495656_0001328 3300046615 Bacteria 8056
232 Ga0495611_0110147 3300046648 Bacteria 1281
233 Ga0495661_0001107 3300046665 Bacteria 23635
234 Ga0495661_0087541 3300046665 Bacteria 1780
235 Ga0495661_0126553 3300046665 Bacteria 1405
236 Ga0495669_0003709 3300046684 Bacteria 6282
237 Ga0495670_0129190 3300046691 Bacteria 1316
238 Ga0495670_0253952 3300046691 Bacteria 937
239 Ga0495671_0021731 3300046692 Bacteria 3367
240 Ga0495649_0062873 3300046694 Bacteria 1995
241 Ga0495604_0058082 3300047317 Bacteria 2972
242 Ga0495687_017729 3300047443 Bacteria 3539
243 Ga0495675_0000308 3300047444 Bacteria 35025
244 Ga0495681_0016407 3300047470 Bacteria 4153
245 Ga0495602_0002185 3300048088 Bacteria 19759
246 Ga0496101_0130787 3300048904 Bacteria 1906
247 Ga0496101_0220608 3300048904 Bacteria 1471
248 Ga0496102_0096186 3300048905 Bacteria 2745
249 Ga0496102_0187957 3300048905 Bacteria 1947
250 Ga0496104_0190033 3300048907 Bacteria 1965
251 Ga0496108_0017854 3300048911 Bacteria 5803
252 Ga0496109_0092061 3300048912 Bacteria 2804
253 Ga0496109_0171537 3300048912 Bacteria 2035
254 Ga0496114_0023733 3300048917 Bacteria 5005
255 Ga0496114_0043321 3300048917 Bacteria 3732
256 Ga0496114_0068891 3300048917 Bacteria 2970
257 Ga0496122_0000274 3300048925 Bacteria 115100
258 Ga0496122_0008269 3300048925 Bacteria 11284
259 Ga0496123_0003708 3300048926 Bacteria 16801
260 Ga0496124_0009111 3300048927 Bacteria 10260
261 Ga0496124_0041731 3300048927 Bacteria 3956
262 Ga0496126_0081477 3300048929 Bacteria 2861
263 Ga0496126_0214903 3300048929 Bacteria 1618
264 Ga0501031_0011088 3300049568 Bacteria 5875
265 Ga0501031_0013178 3300049568 Bacteria 5396
266 Ga0501031_0048661 3300049568 Bacteria 2762
267 Ga0501032_0009353 3300049569 Bacteria 7099
268 Ga0501032_0013437 3300049569 Bacteria 5822
269 Ga0501032_0139007 3300049569 Bacteria 1600
270 Ga0501033_0001146 3300049570 Bacteria 23949
271 Ga0501034_0011043 3300049571 Bacteria 9377
272 Ga0501034_0024084 3300049571 Bacteria 6194
273 Ga0501036_0000415 3300049572 Bacteria 30126
274 Ga0501036_0004424 3300049572 Bacteria 11348
275 Ga0501036_0017772 3300049572 Bacteria 5954
276 Ga0501036_0224169 3300049572 Bacteria 1578
277 Ga0501036_0428226 3300049572 Bacteria 1103
278 Ga0501037_0000255 3300049573 Bacteria 45740
279 Ga0501037_0053277 3300049573 Bacteria 2959
280 Ga0501038_0003901 3300049574 Bacteria 13868
281 Ga0501038_0035136 3300049574 Bacteria 4402
282 Ga0501038_0047113 3300049574 Bacteria 3735
283 Ga0501038_0158313 3300049574 Bacteria 1842
284 Ga0501039_0009357 3300049575 Bacteria 7467
285 Ga0501039_0160882 3300049575 Bacteria 1765
286 Ga0501041_0032932 3300049577 Bacteria 3133
287 Ga0501042_0010196 3300049578 Bacteria 6288
288 Ga0501043_0011449 3300049579 Bacteria 6945
289 Ga0501043_0012162 3300049579 Bacteria 6726
290 Ga0501046_0031969 3300049580 Bacteria 4263
291 Ga0501047_0087724 3300049581 Bacteria 2989
292 Ga0501048_0344560 3300049582 Bacteria 1062
293 Ga0501068_0001727 3300049584 Bacteria 11618
294 Ga0501072_0012997 3300049588 Bacteria 6371
295 Ga0501073_0228671 3300049589 Bacteria 1285
296 Ga0501075_0040323 3300049591 Bacteria 3497
297 Ga0501075_0165371 3300049591 Bacteria 1688
298 Ga0501076_0002950 3300049592 Bacteria 11791
299 Ga0501080_0059083 3300049742 Bacteria 3569
300 Ga0501035_0003494 3300049822 Bacteria 15025
301 Ga0501035_0030051 3300049822 Bacteria 4954
302 Ga0501044_0000323 3300049823 Bacteria 60420
303 Ga0501044_0001314 3300049823 Bacteria 29300
304 Ga0501044_0029398 3300049823 Bacteria 5795
305 Ga0501044_0254127 3300049823 Bacteria 1697
306 Ga0501044_0311694 3300049823 Bacteria 1500
307 Ga0501045_0001764 3300049824 Bacteria 14594
308 Ga0501045_0053078 3300049824 Bacteria 2961
309 nmdc:mga0yw44_28977_c1 3300050492 Bacteria 3191
310 nmdc:mga06z11_191354_c1 3300050494 Bacteria 1184
311 nmdc:mga07m45_103139_c1 3300050496 Bacteria 1639
312 nmdc:mga05p37_3727_c1 3300050507 Bacteria 17834
313 nmdc:mga09592_12583_c1 3300050508 Bacteria 6895
314 nmdc:mga0qj67_97713_c1 3300050509 Bacteria 2365
315 nmdc:mga08y16_185197_c1 3300050511 Bacteria 2161
316 nmdc:mga08y16_202985_c1 3300050511 Bacteria 2054
317 Ga0500634_0042665 3300053161 Bacteria 2460
318 Ga0501084_0154781 3300054114 Bacteria 1933
319 Ga0530510_0063811 3300061734 Bacteria 2667
320 Ga0530510_0492143 3300061734 Bacteria 929

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0224169 Ga0501036_0224169_835_1566 213
2 3300037471 Ga0395905_0004574 Ga0395905_0004574_6144_6983 218
3 3300035410 Ga0373924_0181548 Ga0373924_0181548_21_773 220
4 3300006353 Ga0075370_10245900 Ga0075370_102459002 230
5 3300050496 nmdc:mga07m45_103139_c1 nmdc:mga07m45_103139_c1_683_1516 230
6 3300005563 Ga0068855_100007253 Ga0068855_1000072536 233
7 3300025949 Ga0207667_10005517 Ga0207667_100055177 233
8 3300046500 Ga0495596_0002227 Ga0495596_0002227_9268_10116 233
9 3300046558 Ga0495633_0042273 Ga0495633_0042273_55_903 233
10 3300046665 Ga0495661_0126553 Ga0495661_0126553_402_1250 233
11 3300046684 Ga0495669_0003709 Ga0495669_0003709_4921_5769 233
12 3300046691 Ga0495670_0129190 Ga0495670_0129190_49_897 233
13 3300049568 Ga0501031_0011088 Ga0501031_0011088_4670_5500 233
14 3300009551 Ga0105238_10071941 Ga0105238_100719413 234
15 3300053161 Ga0500634_0042665 Ga0500634_0042665_1227_2108 234
16 3300006051 Ga0075364_10059375 Ga0075364_100593752 235
17 3300009551 Ga0105238_10326500 Ga0105238_103265002 235
18 3300037471 Ga0395905_0000472 Ga0395905_0000472_28377_29243 235
19 3300049569 Ga0501032_0139007 Ga0501032_0139007_119_949 236
20 3300049570 Ga0501033_0001146 Ga0501033_0001146_3052_3882 236
21 3300049572 Ga0501036_0000415 Ga0501036_0000415_29203_30033 236
22 3300049573 Ga0501037_0053277 Ga0501037_0053277_1496_2326 236
23 3300049574 Ga0501038_0035136 Ga0501038_0035136_3473_4303 236
24 3300049581 Ga0501047_0087724 Ga0501047_0087724_775_1605 236
25 3300049823 Ga0501044_0311694 Ga0501044_0311694_261_1091 237
26 3300049823 Ga0501044_0254127 Ga0501044_0254127_130_966 238
27 3300005843 Ga0068860_100418943 Ga0068860_1004189432 239
28 3300046528 Ga0495642_0018943 Ga0495642_0018943_1232_2083 239
29 3300049591 Ga0501075_0165371 Ga0501075_0165371_23_832 239
30 3300050494 nmdc:mga06z11_191354_c1 nmdc:mga06z11_191354_c1_26_868 239
31 3300009094 Ga0111539_10358559 Ga0111539_103585592 240
32 3300027907 Ga0207428_10248452 Ga0207428_102484522 240
33 3300041997 Ga0439431_0040076 Ga0439431_0040076_75_911 240
34 3300048911 Ga0496108_0017854 Ga0496108_0017854_2503_3336 240
35 3300048912 Ga0496109_0171537 Ga0496109_0171537_58_891 240
36 3300048917 Ga0496114_0068891 Ga0496114_0068891_2030_2863 240
37 3300050511 nmdc:mga08y16_185197_c1 nmdc:mga08y16_185197_c1_1143_1976 240
38 3300025909 Ga0207705_10074170 Ga0207705_100741701 242
39 3300006177 Ga0075362_10175784 Ga0075362_101757842 243
40 3300028556 Ga0265337_1029590 Ga0265337_10295902 243
41 3300046528 Ga0495642_0096128 Ga0495642_0096128_126_932 243
42 3300026116 Ga0207674_10510378 Ga0207674_105103782 244
43 3300048925 Ga0496122_0008269 Ga0496122_0008269_5009_5860 244
44 3300048929 Ga0496126_0214903 Ga0496126_0214903_476_1327 244
45 3300009101 Ga0105247_10021003 Ga0105247_100210033 245
46 3300009148 Ga0105243_10321056 Ga0105243_103210561 245
47 3300009177 Ga0105248_10041536 Ga0105248_100415365 245
48 3300009553 Ga0105249_10061434 Ga0105249_100614343 245
49 3300014968 Ga0157379_10218316 Ga0157379_102183161 245
50 3300026035 Ga0207703_10815908 Ga0207703_108159081 245
51 3300037418 Ga0395900_0008029 Ga0395900_0008029_5727_6566 245
52 3300037418 Ga0395900_0062043 Ga0395900_0062043_294_1136 245
53 3300037418 Ga0395900_0242069 Ga0395900_0242069_616_1455 245
54 3300037471 Ga0395905_0223645 Ga0395905_0223645_849_1688 245
55 3300037471 Ga0395905_0389996 Ga0395905_0389996_193_1035 245
56 3300038443 Ga0395901_0226149 Ga0395901_0226149_68_907 245
57 3300038443 Ga0395901_0323109 Ga0395901_0323109_322_1161 245
58 3300028666 Ga0265336_10005140 Ga0265336_100051403 246
59 3300042876 Ga0451577_0371461 Ga0451577_0371461_106_939 246
60 3300044712 Ga0453684_0000499 Ga0453684_0000499_125337_126170 246
61 3300044712 Ga0453684_0099393 Ga0453684_0099393_544_1377 246
62 3300049568 Ga0501031_0013178 Ga0501031_0013178_1292_2122 246
63 3300049568 Ga0501031_0048661 Ga0501031_0048661_823_1653 246
64 3300049569 Ga0501032_0009353 Ga0501032_0009353_2560_3390 246
65 3300049569 Ga0501032_0013437 Ga0501032_0013437_1192_2022 246
66 3300049571 Ga0501034_0011043 Ga0501034_0011043_959_1789 246
67 3300049571 Ga0501034_0024084 Ga0501034_0024084_1192_2022 246
68 3300049572 Ga0501036_0004424 Ga0501036_0004424_8113_8943 246
69 3300049572 Ga0501036_0017772 Ga0501036_0017772_4078_4908 246
70 3300049573 Ga0501037_0000255 Ga0501037_0000255_39188_40018 246
71 3300049574 Ga0501038_0003901 Ga0501038_0003901_10633_11463 246
72 3300049574 Ga0501038_0158313 Ga0501038_0158313_590_1420 246
73 3300049575 Ga0501039_0009357 Ga0501039_0009357_2701_3531 246
74 3300049578 Ga0501042_0010196 Ga0501042_0010196_1017_1847 246
75 3300049579 Ga0501043_0011449 Ga0501043_0011449_3710_4540 246
76 3300049579 Ga0501043_0012162 Ga0501043_0012162_1223_2053 246
77 3300049580 Ga0501046_0031969 Ga0501046_0031969_691_1521 246
78 3300049584 Ga0501068_0001727 Ga0501068_0001727_2677_3507 246
79 3300049822 Ga0501035_0030051 Ga0501035_0030051_850_1680 246
80 3300049823 Ga0501044_0000323 Ga0501044_0000323_55561_56391 246
81 3300049823 Ga0501044_0029398 Ga0501044_0029398_4012_4842 246
82 3300049824 Ga0501045_0001764 Ga0501045_0001764_2712_3542 246
83 3300005471 Ga0070698_100373104 Ga0070698_1003731042 247
84 3300046558 Ga0495633_0033082 Ga0495633_0033082_249_1061 247
85 3300047317 Ga0495604_0058082 Ga0495604_0058082_18_887 247
86 3300003784 Ga0055534_1005996 Ga0055534_10059964 248
87 3300025284 Ga0209130_1014551 Ga0209130_10145512 248
88 3300025291 Ga0209675_1000923 Ga0209675_100092315 248
89 3300025303 Ga0209051_1013448 Ga0209051_10134482 248
90 3300025304 Ga0209257_1012144 Ga0209257_10121443 248
91 3300031595 Ga0265313_10023181 Ga0265313_100231813 248
92 3300031691 Ga0316579_10152379 Ga0316579_101523791 249
93 3300046452 Ga0495617_000574 Ga0495617_000574_9163_9975 249
94 3300046491 Ga0495584_0000017 Ga0495584_0000017_125386_126198 249
95 3300046492 Ga0495585_0000064 Ga0495585_0000064_50626_51438 249
96 3300046507 Ga0495606_0014675 Ga0495606_0014675_4934_5746 249
97 3300046513 Ga0495616_0000727 Ga0495616_0000727_8867_9679 249
98 3300046524 Ga0495648_0000007 Ga0495648_0000007_280939_281751 249
99 3300049574 Ga0501038_0047113 Ga0501038_0047113_1127_1957 250
100 3300049822 Ga0501035_0003494 Ga0501035_0003494_12763_13593 250
101 3300049823 Ga0501044_0001314 Ga0501044_0001314_2874_3704 250
102 3300042876 Ga0451577_0084624 Ga0451577_0084624_1758_2600 251
103 3300045051 Ga0451576_0423308 Ga0451576_0423308_160_1032 251
104 3300045051 Ga0451576_0425573 Ga0451576_0425573_571_1326 251
105 3300005331 Ga0070670_100121995 Ga0070670_1001219952 254
106 3300005618 Ga0068864_100251168 Ga0068864_1002511681 254
107 3300025925 Ga0207650_10119120 Ga0207650_101191202 254
108 3300026095 Ga0207676_10058317 Ga0207676_100583171 254
109 3300046694 Ga0495649_0062873 Ga0495649_0062873_389_1198 254
110 3300039437 Ga0436365_1542265 Ga0436365_1542265_745_1569 256
111 3300044673 Ga0453683_0003282 Ga0453683_0003282_4286_5173 256
112 3300045051 Ga0451576_0291430 Ga0451576_0291430_234_1121 256
113 3300009094 Ga0111539_10016326 Ga0111539_100163266 257
114 3300025923 Ga0207681_10024600 Ga0207681_100246005 257
115 3300048925 Ga0496122_0000274 Ga0496122_0000274_18991_19887 257
116 3300048926 Ga0496123_0003708 Ga0496123_0003708_5503_6399 257
117 3300050508 nmdc:mga09592_12583_c1 nmdc:mga09592_12583_c1_225_1037 257
118 3300035724 Ga0373933_0002411 Ga0373933_0002411_8334_9236 258
119 3300036401 Ga0373937_0000240 Ga0373937_0000240_8831_9733 258
120 3300046462 Ga0495651_0004031 Ga0495651_0004031_4277_5179 258
121 3300046536 Ga0495587_0000456 Ga0495587_0000456_14204_15106 258
122 3300047444 Ga0495675_0000308 Ga0495675_0000308_31872_32774 258
123 3300048088 Ga0495602_0002185 Ga0495602_0002185_13932_14834 258
124 3300005577 Ga0068857_100136353 Ga0068857_1001363532 259
125 3300044656 Ga0466969_0037501 Ga0466969_0037501_199_1032 259
126 3300044683 Ga0466965_0058368 Ga0466965_0058368_607_1440 259
127 3300044735 Ga0466968_0119222 Ga0466968_0119222_307_1140 259
128 3300045049 Ga0466959_0085138 Ga0466959_0085138_1412_2245 259
129 3300037471 Ga0395905_0046316 Ga0395905_0046316_2815_3696 260
130 3300037471 Ga0395905_0264738 Ga0395905_0264738_694_1578 260
131 3300044901 Ga0466960_0166981 Ga0466960_0166981_51_887 260
132 3300048917 Ga0496114_0043321 Ga0496114_0043321_691_1473 260
133 3300005563 Ga0068855_100000072 Ga0068855_10000007280 261
134 3300005563 Ga0068855_100153299 Ga0068855_1001532992 261
135 3300005578 Ga0068854_100138584 Ga0068854_1001385842 261
136 3300009551 Ga0105238_10000318 Ga0105238_100003183 261
137 3300010375 Ga0105239_10109056 Ga0105239_101090565 261
138 3300015261 Ga0182006_1004807 Ga0182006_10048072 261
139 3300015262 Ga0182007_10019887 Ga0182007_100198873 261
140 3300025914 Ga0207671_10058384 Ga0207671_100583843 261
141 3300025924 Ga0207694_10026618 Ga0207694_100266182 261
142 3300025949 Ga0207667_10000055 Ga0207667_10000055143 261
143 3300025949 Ga0207667_10030522 Ga0207667_100305223 261
144 3300025981 Ga0207640_10095129 Ga0207640_100951292 261
145 3300028563 Ga0265319_1000174 Ga0265319_100017445 261
146 3300028573 Ga0265334_10007345 Ga0265334_100073452 261
147 3300028577 Ga0265318_10001007 Ga0265318_1000100718 261
148 3300028800 Ga0265338_10008339 Ga0265338_100083398 261
149 3300037471 Ga0395905_0053882 Ga0395905_0053882_1565_2401 261
150 3300046463 Ga0495653_0000011 Ga0495653_0000011_240835_241713 261
151 3300046528 Ga0495642_0005062 Ga0495642_0005062_594_1457 261
152 3300046539 Ga0495621_0076213 Ga0495621_0076213_134_997 261
153 3300046665 Ga0495661_0001107 Ga0495661_0001107_21050_21913 261
154 3300047443 Ga0495687_017729 Ga0495687_017729_379_1242 261
155 3300048904 Ga0496101_0130787 Ga0496101_0130787_520_1383 261
156 3300048905 Ga0496102_0096186 Ga0496102_0096186_1471_2334 261
157 3300048912 Ga0496109_0092061 Ga0496109_0092061_248_1111 261
158 3300005840 Ga0068870_10234276 Ga0068870_102342761 262
159 3300026116 Ga0207674_10302419 Ga0207674_103024191 262
160 3300028800 Ga0265338_10001712 Ga0265338_100017126 262
161 3300031344 Ga0265316_10365145 Ga0265316_103651452 262
162 3300042461 Ga0439460_0029705 Ga0439460_0029705_691_1527 262
163 3300048929 Ga0496126_0081477 Ga0496126_0081477_620_1456 262
164 3300003771 Ga0055526_1004476 Ga0055526_10044763 263
165 3300003773 Ga0055537_1000111 Ga0055537_100011150 263
166 3300003775 Ga0055524_1004885 Ga0055524_10048852 263
167 3300003784 Ga0055534_1000509 Ga0055534_100050912 263
168 3300003790 Ga0055528_1000178 Ga0055528_10001782 263
169 3300003790 Ga0055528_1005582 Ga0055528_10055825 263
170 3300005330 Ga0070690_100167970 Ga0070690_1001679701 263
171 3300005331 Ga0070670_100163298 Ga0070670_1001632981 263
172 3300005440 Ga0070705_100050567 Ga0070705_1000505672 263
173 3300005445 Ga0070708_100303666 Ga0070708_1003036661 263
174 3300005617 Ga0068859_100275941 Ga0068859_1002759411 263
175 3300006931 Ga0097620_100275931 Ga0097620_1002759311 263
176 3300014325 Ga0163163_10248594 Ga0163163_102485942 263
177 3300025263 Ga0209565_1000009 Ga0209565_1000009549 263
178 3300025273 Ga0209673_1000036 Ga0209673_1000036133 263
179 3300025291 Ga0209675_1000013 Ga0209675_1000013133 263
180 3300025295 Ga0209564_1000122 Ga0209564_1000122133 263
181 3300025299 Ga0209256_1000106 Ga0209256_100010642 263
182 3300025936 Ga0207670_10390069 Ga0207670_103900692 263
183 3300025941 Ga0207711_10022130 Ga0207711_100221303 263
184 3300025944 Ga0207661_10047779 Ga0207661_100477794 263
185 3300025961 Ga0207712_10027650 Ga0207712_100276501 263
186 3300026095 Ga0207676_10135118 Ga0207676_101351182 263
187 3300031238 Ga0265332_10000015 Ga0265332_10000015115 263
188 3300044673 Ga0453683_0000458 Ga0453683_0000458_26332_27159 263
189 3300044712 Ga0453684_0011748 Ga0453684_0011748_1128_1967 263
190 3300009147 Ga0114129_10011822 Ga0114129_100118225 264
191 3300042004 Ga0439445_0003999 Ga0439445_0003999_1560_2441 264
192 3300044683 Ga0466965_0064076 Ga0466965_0064076_969_1805 264
193 3300044901 Ga0466960_0055928 Ga0466960_0055928_679_1515 264
194 3300048927 Ga0496124_0009111 Ga0496124_0009111_3796_4665 264
195 3300050507 nmdc:mga05p37_3727_c1 nmdc:mga05p37_3727_c1_14894_15724 264
196 iso_pu_bacteria 2643221683 2644468163 264
197 iso_pu_bacteria 2899924645 2899924715 264
198 iso_pu_bacteria 2929520902 2929522749 264
199 iso_pu_bacteria 2945984333 2945986060 264
200 3300026118 Ga0207675_100445232 Ga0207675_1004452322 265
201 3300039437 Ga0436365_0096061 Ga0436365_0096061_468_1304 265
202 3300044712 Ga0453684_0003915 Ga0453684_0003915_2831_3634 265
203 iso_pu_bacteria 2928115317 2928119924 265
204 3300031507 Ga0307509_10000543 Ga0307509_1000054332 266
205 3300006844 Ga0075428_100032046 Ga0075428_1000320464 267
206 3300006846 Ga0075430_100374180 Ga0075430_1003741802 267
207 3300006880 Ga0075429_100008176 Ga0075429_1000081765 267
208 3300028556 Ga0265337_1000950 Ga0265337_10009503 267
209 3300028558 Ga0265326_10003826 Ga0265326_100038262 267
210 3300028563 Ga0265319_1001367 Ga0265319_10013677 267
211 3300028573 Ga0265334_10002316 Ga0265334_100023166 267
212 3300028577 Ga0265318_10002070 Ga0265318_100020708 267
213 3300028654 Ga0265322_10003443 Ga0265322_100034432 267
214 3300028666 Ga0265336_10000830 Ga0265336_1000083015 267
215 3300028800 Ga0265338_10004754 Ga0265338_1000475416 267
216 3300031240 Ga0265320_10005104 Ga0265320_100051043 267
217 3300031247 Ga0265340_10004206 Ga0265340_100042066 267
218 3300031249 Ga0265339_10050157 Ga0265339_100501572 267
219 3300031344 Ga0265316_10010948 Ga0265316_100109483 267
220 3300031595 Ga0265313_10002936 Ga0265313_100029369 267
221 3300031712 Ga0265342_10013233 Ga0265342_100132333 267
222 3300050509 nmdc:mga0qj67_97713_c1 nmdc:mga0qj67_97713_c1_1492_2334 267
223 3300003760 Ga0055527_1010753 Ga0055527_10107531 268
224 3300003761 Ga0055535_1000330 Ga0055535_100033035 268
225 3300003762 Ga0055542_1000039 Ga0055542_100003971 268
226 3300003781 Ga0055536_1009209 Ga0055536_10092094 268
227 3300009094 Ga0111539_10385759 Ga0111539_103857592 268
228 3300025921 Ga0207652_10395464 Ga0207652_103954641 268
229 3300048927 Ga0496124_0041731 Ga0496124_0041731_307_1113 268
230 3300050511 nmdc:mga08y16_202985_c1 nmdc:mga08y16_202985_c1_596_1402 268
231 3300003792 Ga0055540_1009322 Ga0055540_10093224 269
232 3300003794 Ga0055531_10006766 Ga0055531_100067665 269
233 3300005327 Ga0070658_10269870 Ga0070658_102698702 269
234 3300037471 Ga0395905_0000339 Ga0395905_0000339_34651_35529 269
235 3300046492 Ga0495585_0033102 Ga0495585_0033102_2056_2865 269
236 3300046542 Ga0495597_0169880 Ga0495597_0169880_14_823 269
237 3300046558 Ga0495633_0063633 Ga0495633_0063633_31_840 269
238 3300046665 Ga0495661_0087541 Ga0495661_0087541_958_1767 269
239 3300047470 Ga0495681_0016407 Ga0495681_0016407_1276_2085 269
240 3300048907 Ga0496104_0190033 Ga0496104_0190033_13_822 269
241 3300048917 Ga0496114_0023733 Ga0496114_0023733_2877_3686 269
242 3300049575 Ga0501039_0160882 Ga0501039_0160882_401_1237 269
243 3300054114 Ga0501084_0154781 Ga0501084_0154781_438_1274 269
244 3300005563 Ga0068855_100991441 Ga0068855_1009914411 270
245 3300009093 Ga0105240_10012766 Ga0105240_100127668 270
246 3300009551 Ga0105238_10049198 Ga0105238_100491984 270
247 3300028800 Ga0265338_10024276 Ga0265338_100242763 270
248 3300048904 Ga0496101_0220608 Ga0496101_0220608_513_1355 270
249 iso_pu_bacteria 2738541277 2738717727 270
250 iso_pu_bacteria 2738543019 2739278413 270
251 iso_pu_bacteria 2808606418 2809144609 270
252 iso_pu_bacteria 2904541872 2904548167 270
253 iso_pu_bacteria 2929160207 2929163096 270
254 3300038443 Ga0395901_0116493 Ga0395901_0116493_1502_2368 271
255 3300025254 Ga0209148_1001908 Ga0209148_10019083 272
256 3300037312 Ga0395899_0017831 Ga0395899_0017831_4475_5317 272
257 3300037471 Ga0395905_0027546 Ga0395905_0027546_1443_2291 272
258 3300044683 Ga0466965_0028556 Ga0466965_0028556_1249_2091 272
259 3300044842 Ga0466957_0003058 Ga0466957_0003058_3644_4486 272
260 3300045049 Ga0466959_0171568 Ga0466959_0171568_74_916 272
261 iso_pu_bacteria 2521172590 2521557610 272
262 iso_pu_bacteria 2551306416 2553006639 272
263 iso_pu_bacteria 2738543013 2739251420 272
264 iso_pu_bacteria 2808606386 2808984364 272
265 iso_pu_bacteria 2808606415 2809130718 272
266 iso_pu_bacteria 2808606419 2809149804 272
267 iso_pu_bacteria 2818991449 2819615250 272
268 iso_pu_bacteria 2852618963 2852620055 272
269 iso_pu_bacteria 2857604169 2857609105 272
270 iso_pu_bacteria 2904439833 2904441675 272
271 iso_pu_bacteria 2904530477 2904531403 272
272 iso_pu_bacteria 2904584206 2904586942 272
273 iso_pu_bacteria 2904589729 2904593025 272
274 iso_pu_bacteria 2904601388 2904603165 272
275 iso_pu_bacteria 2919046199 2919050961 272
276 iso_pu_bacteria 2919079590 2919082013 272
277 iso_pu_bacteria 2923510766 2923510782 272
278 iso_pu_bacteria 2928130867 2928135101 272
279 3300006844 Ga0075428_100044773 Ga0075428_1000447734 273
280 3300046518 Ga0495631_0007050 Ga0495631_0007050_4123_4971 273
281 3300046542 Ga0495597_0059369 Ga0495597_0059369_497_1348 273
282 3300046615 Ga0495656_0001328 Ga0495656_0001328_6044_6892 273
283 3300046648 Ga0495611_0110147 Ga0495611_0110147_350_1198 273
284 3300046691 Ga0495670_0253952 Ga0495670_0253952_79_927 273
285 3300046692 Ga0495671_0021731 Ga0495671_0021731_829_1677 273
286 3300003771 Ga0055526_1000523 Ga0055526_100052313 274
287 3300005530 Ga0070679_100172600 Ga0070679_1001726003 274
288 3300005563 Ga0068855_100119351 Ga0068855_1001193513 274
289 3300006038 Ga0075365_10032053 Ga0075365_100320533 274
290 3300025292 Ga0209676_1000301 Ga0209676_100030138 274
291 3300025294 Ga0209025_1000073 Ga0209025_1000073123 274
292 3300025303 Ga0209051_1000907 Ga0209051_100090712 274
293 3300025304 Ga0209257_1005066 Ga0209257_10050663 274
294 3300025910 Ga0207684_10031183 Ga0207684_100311833 274
295 3300025913 Ga0207695_10149060 Ga0207695_101490601 274
296 3300025949 Ga0207667_10187531 Ga0207667_101875312 274
297 3300050492 nmdc:mga0yw44_28977_c1 nmdc:mga0yw44_28977_c1_1585_2460 274
298 iso_pu_bacteria 2898907183 2898908457 274
299 3300005530 Ga0070679_100353557 Ga0070679_1003535571 275
300 3300006195 Ga0075366_10009650 Ga0075366_100096502 275
301 3300025303 Ga0209051_1000406 Ga0209051_100040621 275
302 3300025304 Ga0209257_1000012 Ga0209257_1000012487 275
303 3300025909 Ga0207705_10098846 Ga0207705_100988461 275
304 3300025921 Ga0207652_10038159 Ga0207652_100381595 275
305 iso_pu_bacteria 2524023129 2524191762 275
306 3300005444 Ga0070694_100271846 Ga0070694_1002718462 276
307 3300009177 Ga0105248_10687250 Ga0105248_106872502 276
308 3300031235 Ga0265330_10000076 Ga0265330_1000007652 276
309 3300031238 Ga0265332_10000002 Ga0265332_10000002438 276
310 3300031247 Ga0265340_10068309 Ga0265340_100683092 276
311 3300031711 Ga0265314_10000066 Ga0265314_10000066104 276
312 3300042876 Ga0451577_0374606 Ga0451577_0374606_357_1193 276
313 3300049572 Ga0501036_0428226 Ga0501036_0428226_127_957 276
314 3300049577 Ga0501041_0032932 Ga0501041_0032932_1856_2686 276
315 3300049582 Ga0501048_0344560 Ga0501048_0344560_100_930 276
316 3300049588 Ga0501072_0012997 Ga0501072_0012997_1302_2132 276
317 3300049589 Ga0501073_0228671 Ga0501073_0228671_369_1199 276
318 3300049591 Ga0501075_0040323 Ga0501075_0040323_2502_3332 276
319 3300049592 Ga0501076_0002950 Ga0501076_0002950_3378_4208 276
320 3300049742 Ga0501080_0059083 Ga0501080_0059083_1406_2236 276
321 3300049824 Ga0501045_0053078 Ga0501045_0053078_716_1546 276
322 3300061734 Ga0530510_0492143 Ga0530510_0492143_76_906 276
323 3300006195 Ga0075366_10079312 Ga0075366_100793123 277
324 3300042876 Ga0451577_0002542 Ga0451577_0002542_17231_18100 278
325 3300044712 Ga0453684_0144470 Ga0453684_0144470_589_1458 278
326 3300048905 Ga0496102_0187957 Ga0496102_0187957_682_1518 278
327 3300014326 Ga0157380_10460634 Ga0157380_104606342 279
328 3300028558 Ga0265326_10001112 Ga0265326_100011122 279
329 3300028563 Ga0265319_1000210 Ga0265319_100021016 279
330 3300028577 Ga0265318_10003116 Ga0265318_100031162 279
331 3300028653 Ga0265323_10000255 Ga0265323_1000025516 279
332 3300028654 Ga0265322_10000317 Ga0265322_100003174 279
333 3300028800 Ga0265338_10001141 Ga0265338_1000114118 279
334 3300028800 Ga0265338_10049198 Ga0265338_100491982 279
335 3300029957 Ga0265324_10000323 Ga0265324_1000032318 279
336 3300031235 Ga0265330_10000797 Ga0265330_1000079716 279
337 3300031238 Ga0265332_10002710 Ga0265332_100027106 279
338 3300031239 Ga0265328_10000914 Ga0265328_1000091410 279
339 3300031240 Ga0265320_10000569 Ga0265320_1000056919 279
340 3300031241 Ga0265325_10035809 Ga0265325_100358093 279
341 3300031242 Ga0265329_10000496 Ga0265329_1000049616 279
342 3300031249 Ga0265339_10000994 Ga0265339_1000099411 279
343 3300031250 Ga0265331_10008126 Ga0265331_100081264 279
344 3300031344 Ga0265316_10002027 Ga0265316_100020274 279
345 3300031711 Ga0265314_10000970 Ga0265314_1000097024 279
346 3300031712 Ga0265342_10001043 Ga0265342_1000104318 279
347 3300061734 Ga0530510_0063811 Ga0530510_0063811_526_1365 279
348 3300003320 rootH2_10030150 rootH2_100301502 280
349 3300036401 Ga0373937_0171768 Ga0373937_0171768_873_1715 280
350 3300044712 Ga0453684_0274292 Ga0453684_0274292_461_1318 280
351 iso_pu_bacteria 2881927736 2881928382 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

91

291

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.869 17 269
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8633 16 265
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8564 16 268
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8507 16 265
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8432 15 268
ID Description Score Start End Superfamily
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8982 17 274 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8904 18 275 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8887 17 274 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8883 18 272 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.887 54 272 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3N5LMD0-F1-model_v4 Sulfate transport system permease protein CysT 0.9377 54 274 GO:0005886
GO:0015419
AF-A0A3L7PFA0-F1-model_v4 Sulfate transport system permease protein CysT 0.9359 21 275 GO:0005886
GO:0015419
AF-A0A6P2BBW2-F1-model_v4 Sulfate transport system permease protein CysT 0.9331 52 275 GO:0005886
GO:0015419
AF-A0A2A5K5L0-F1-model_v4 deleted 0.9315 37 278
AF-A0A0J6LE06-F1-model_v4 Sulfate transport system permease protein CysT 0.9302 24 277 GO:0005886
GO:0015419

Feature Viewer

pLDDT pTM Quality
86.17 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map