F418620
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 227 | 320 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10687250|Ga0105248_106872502 |
| Length | 296 |
| Sequence | MSGALAAPLPGTAAAPSSSRGGSRKVLPGFKLTLGFTIFYLCLIVLIPLSALVLKTFALSWDQFWAAVASPRVLAAYRLTFGASFLAALVNVVFGLLVAWVLVRYEFPGKRVVDALVDLPFALPTAVAGISLTALLAGNGWIGQYLEPHGIKLAFNPAGVVIALIFIGMPFVVRTVQPVLEESEKELEEAAMCLGATRLQTFTKVIFPSIAPALLTGFAMAFARAIGEYGSVIFIAGNVPMVSEITPLIIIGKLEQYDYAGATALAVVMLSGSFLLLFVVNMLQAWSRRRSGGVHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 2 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 3 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 4 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 5 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 6 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 7 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 8 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 9 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 10 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 11 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 12 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 13 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 14 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 15 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 16 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 17 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 18 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 19 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 20 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 21 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 22 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 23 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 24 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 25 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 26 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 27 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 28 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 29 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 30 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 31 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 146 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 147 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 226 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.17 |
| Metatranscriptomes | 0 |
| Isolates | 8.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.4 |
| Nodule | 0 |
| Rhizoplane | 3.13 |
| Rhizosphere | 77.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10030150 | 3300003320 | Bacteria | 1434 |
| 2 | Ga0055527_1010753 | 3300003760 | Bacteria | 1054 |
| 3 | Ga0055535_1000330 | 3300003761 | Bacteria | 47889 |
| 4 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 5 | Ga0055526_1000523 | 3300003771 | Bacteria | 30490 |
| 6 | Ga0055526_1004476 | 3300003771 | Bacteria | 8379 |
| 7 | Ga0055537_1000111 | 3300003773 | Bacteria | 61884 |
| 8 | Ga0055524_1004885 | 3300003775 | Bacteria | 6089 |
| 9 | Ga0055536_1009209 | 3300003781 | Bacteria | 4121 |
| 10 | Ga0055534_1000509 | 3300003784 | Bacteria | 21144 |
| 11 | Ga0055534_1005996 | 3300003784 | Bacteria | 3142 |
| 12 | Ga0055528_1000178 | 3300003790 | Bacteria | 53709 |
| 13 | Ga0055528_1005582 | 3300003790 | Bacteria | 5822 |
| 14 | Ga0055540_1009322 | 3300003792 | Bacteria | 3404 |
| 15 | Ga0055531_10006766 | 3300003794 | Bacteria | 6412 |
| 16 | Ga0070658_10269870 | 3300005327 | Bacteria | 1447 |
| 17 | Ga0070690_100167970 | 3300005330 | Bacteria | 1508 |
| 18 | Ga0070670_100121995 | 3300005331 | Bacteria | 2248 |
| 19 | Ga0070670_100163298 | 3300005331 | Bacteria | 1931 |
| 20 | Ga0070705_100050567 | 3300005440 | Bacteria | 2418 |
| 21 | Ga0070694_100271846 | 3300005444 | Bacteria | 1289 |
| 22 | Ga0070708_100303666 | 3300005445 | Bacteria | 1503 |
| 23 | Ga0070698_100373104 | 3300005471 | Bacteria | 1359 |
| 24 | Ga0070679_100172600 | 3300005530 | Bacteria | 2135 |
| 25 | Ga0070679_100353557 | 3300005530 | Bacteria | 1417 |
| 26 | Ga0068855_100000072 | 3300005563 | Bacteria | 121486 |
| 27 | Ga0068855_100007253 | 3300005563 | Bacteria | 13442 |
| 28 | Ga0068855_100119351 | 3300005563 | Bacteria | 3019 |
| 29 | Ga0068855_100153299 | 3300005563 | Bacteria | 2619 |
| 30 | Ga0068855_100991441 | 3300005563 | Bacteria | 883 |
| 31 | Ga0068857_100136353 | 3300005577 | Bacteria | 2216 |
| 32 | Ga0068854_100138584 | 3300005578 | Bacteria | 1864 |
| 33 | Ga0068859_100275941 | 3300005617 | Bacteria | 1773 |
| 34 | Ga0068864_100251168 | 3300005618 | Bacteria | 1642 |
| 35 | Ga0068870_10234276 | 3300005840 | Bacteria | 1130 |
| 36 | Ga0068860_100418943 | 3300005843 | Bacteria | 1327 |
| 37 | Ga0075365_10032053 | 3300006038 | Bacteria | 3376 |
| 38 | Ga0075364_10059375 | 3300006051 | Bacteria | 2507 |
| 39 | Ga0075362_10175784 | 3300006177 | Bacteria | 1036 |
| 40 | Ga0075366_10009650 | 3300006195 | Bacteria | 5395 |
| 41 | Ga0075366_10079312 | 3300006195 | Bacteria | 1960 |
| 42 | Ga0075370_10245900 | 3300006353 | Bacteria | 1060 |
| 43 | Ga0075428_100032046 | 3300006844 | Bacteria | 5807 |
| 44 | Ga0075428_100044773 | 3300006844 | Bacteria | 4862 |
| 45 | Ga0075430_100374180 | 3300006846 | Bacteria | 1176 |
| 46 | Ga0075429_100008176 | 3300006880 | Bacteria | 9092 |
| 47 | Ga0097620_100275931 | 3300006931 | Bacteria | 1773 |
| 48 | Ga0105240_10012766 | 3300009093 | Bacteria | 11577 |
| 49 | Ga0111539_10016326 | 3300009094 | Bacteria | 9205 |
| 50 | Ga0111539_10358559 | 3300009094 | Bacteria | 1697 |
| 51 | Ga0111539_10385759 | 3300009094 | Bacteria | 1631 |
| 52 | Ga0105247_10021003 | 3300009101 | Bacteria | 3928 |
| 53 | Ga0114129_10011822 | 3300009147 | Bacteria | 12417 |
| 54 | Ga0105243_10321056 | 3300009148 | Bacteria | 1411 |
| 55 | Ga0105248_10041536 | 3300009177 | Bacteria | 5156 |
| 56 | Ga0105248_10687250 | 3300009177 | Bacteria | 1154 |
| 57 | Ga0105238_10000318 | 3300009551 | Bacteria | 52620 |
| 58 | Ga0105238_10049198 | 3300009551 | Bacteria | 4247 |
| 59 | Ga0105238_10071941 | 3300009551 | Bacteria | 3455 |
| 60 | Ga0105238_10326500 | 3300009551 | Bacteria | 1521 |
| 61 | Ga0105249_10061434 | 3300009553 | Bacteria | 3448 |
| 62 | Ga0105239_10109056 | 3300010375 | Bacteria | 3067 |
| 63 | Ga0163163_10248594 | 3300014325 | Bacteria | 1829 |
| 64 | Ga0157380_10460634 | 3300014326 | Bacteria | 1224 |
| 65 | Ga0157379_10218316 | 3300014968 | Bacteria | 1727 |
| 66 | Ga0182006_1004807 | 3300015261 | Bacteria | 6570 |
| 67 | Ga0182007_10019887 | 3300015262 | Bacteria | 2406 |
| 68 | Ga0209148_1001908 | 3300025254 | Bacteria | 8536 |
| 69 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 70 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 71 | Ga0209130_1014551 | 3300025284 | Bacteria | 1969 |
| 72 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 73 | Ga0209675_1000923 | 3300025291 | Bacteria | 18751 |
| 74 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 75 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 76 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 77 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 78 | Ga0209051_1000406 | 3300025303 | Bacteria | 59626 |
| 79 | Ga0209051_1000907 | 3300025303 | Bacteria | 29475 |
| 80 | Ga0209051_1013448 | 3300025303 | Bacteria | 3894 |
| 81 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 82 | Ga0209257_1005066 | 3300025304 | Bacteria | 9567 |
| 83 | Ga0209257_1012144 | 3300025304 | Bacteria | 4028 |
| 84 | Ga0207705_10074170 | 3300025909 | Bacteria | 2469 |
| 85 | Ga0207705_10098846 | 3300025909 | Bacteria | 2145 |
| 86 | Ga0207684_10031183 | 3300025910 | Bacteria | 4536 |
| 87 | Ga0207695_10149060 | 3300025913 | Bacteria | 2280 |
| 88 | Ga0207671_10058384 | 3300025914 | Bacteria | 2860 |
| 89 | Ga0207652_10038159 | 3300025921 | Bacteria | 4070 |
| 90 | Ga0207652_10395464 | 3300025921 | Bacteria | 1247 |
| 91 | Ga0207681_10024600 | 3300025923 | Bacteria | 3866 |
| 92 | Ga0207694_10026618 | 3300025924 | Bacteria | 4402 |
| 93 | Ga0207650_10119120 | 3300025925 | Bacteria | 2053 |
| 94 | Ga0207670_10390069 | 3300025936 | Bacteria | 1111 |
| 95 | Ga0207711_10022130 | 3300025941 | Bacteria | 5314 |
| 96 | Ga0207661_10047779 | 3300025944 | Bacteria | 3399 |
| 97 | Ga0207667_10000055 | 3300025949 | Bacteria | 223770 |
| 98 | Ga0207667_10005517 | 3300025949 | Bacteria | 15432 |
| 99 | Ga0207667_10030522 | 3300025949 | Bacteria | 5831 |
| 100 | Ga0207667_10187531 | 3300025949 | Bacteria | 2123 |
| 101 | Ga0207712_10027650 | 3300025961 | Bacteria | 3788 |
| 102 | Ga0207640_10095129 | 3300025981 | Bacteria | 2073 |
| 103 | Ga0207703_10815908 | 3300026035 | Bacteria | 891 |
| 104 | Ga0207676_10058317 | 3300026095 | Bacteria | 3045 |
| 105 | Ga0207676_10135118 | 3300026095 | Bacteria | 2103 |
| 106 | Ga0207674_10302419 | 3300026116 | Bacteria | 1549 |
| 107 | Ga0207674_10510378 | 3300026116 | Bacteria | 1161 |
| 108 | Ga0207675_100445232 | 3300026118 | Bacteria | 1283 |
| 109 | Ga0207428_10248452 | 3300027907 | Bacteria | 1327 |
| 110 | Ga0265337_1000950 | 3300028556 | Bacteria | 15167 |
| 111 | Ga0265337_1029590 | 3300028556 | Bacteria | 1637 |
| 112 | Ga0265326_10001112 | 3300028558 | Bacteria | 9574 |
| 113 | Ga0265326_10003826 | 3300028558 | Bacteria | 4897 |
| 114 | Ga0265319_1000174 | 3300028563 | Bacteria | 48778 |
| 115 | Ga0265319_1000210 | 3300028563 | Bacteria | 44286 |
| 116 | Ga0265319_1001367 | 3300028563 | Bacteria | 14673 |
| 117 | Ga0265334_10002316 | 3300028573 | Bacteria | 8962 |
| 118 | Ga0265334_10007345 | 3300028573 | Bacteria | 4729 |
| 119 | Ga0265318_10001007 | 3300028577 | Bacteria | 17999 |
| 120 | Ga0265318_10002070 | 3300028577 | Bacteria | 10989 |
| 121 | Ga0265318_10003116 | 3300028577 | Bacteria | 8493 |
| 122 | Ga0265323_10000255 | 3300028653 | Bacteria | 31257 |
| 123 | Ga0265322_10000317 | 3300028654 | Bacteria | 20284 |
| 124 | Ga0265322_10003443 | 3300028654 | Bacteria | 4779 |
| 125 | Ga0265336_10000830 | 3300028666 | Bacteria | 16104 |
| 126 | Ga0265336_10005140 | 3300028666 | Bacteria | 4864 |
| 127 | Ga0265338_10001141 | 3300028800 | Bacteria | 43920 |
| 128 | Ga0265338_10001712 | 3300028800 | Bacteria | 34790 |
| 129 | Ga0265338_10004754 | 3300028800 | Bacteria | 18166 |
| 130 | Ga0265338_10008339 | 3300028800 | Bacteria | 12603 |
| 131 | Ga0265338_10024276 | 3300028800 | Bacteria | 6198 |
| 132 | Ga0265338_10049198 | 3300028800 | Bacteria | 3824 |
| 133 | Ga0265324_10000323 | 3300029957 | Bacteria | 35199 |
| 134 | Ga0265330_10000076 | 3300031235 | Bacteria | 84642 |
| 135 | Ga0265330_10000797 | 3300031235 | Bacteria | 19849 |
| 136 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 137 | Ga0265332_10000015 | 3300031238 | Bacteria | 243944 |
| 138 | Ga0265332_10002710 | 3300031238 | Bacteria | 8850 |
| 139 | Ga0265328_10000914 | 3300031239 | Bacteria | 13626 |
| 140 | Ga0265320_10000569 | 3300031240 | Bacteria | 28515 |
| 141 | Ga0265320_10005104 | 3300031240 | Bacteria | 8481 |
| 142 | Ga0265325_10035809 | 3300031241 | Bacteria | 2633 |
| 143 | Ga0265329_10000496 | 3300031242 | Bacteria | 20364 |
| 144 | Ga0265340_10004206 | 3300031247 | Bacteria | 8071 |
| 145 | Ga0265340_10068309 | 3300031247 | Bacteria | 1688 |
| 146 | Ga0265339_10000994 | 3300031249 | Bacteria | 21727 |
| 147 | Ga0265339_10050157 | 3300031249 | Bacteria | 2283 |
| 148 | Ga0265331_10008126 | 3300031250 | Bacteria | 5992 |
| 149 | Ga0265316_10002027 | 3300031344 | Bacteria | 21327 |
| 150 | Ga0265316_10010948 | 3300031344 | Bacteria | 8231 |
| 151 | Ga0265316_10365145 | 3300031344 | Bacteria | 1043 |
| 152 | Ga0307509_10000543 | 3300031507 | Bacteria | 64572 |
| 153 | Ga0265313_10002936 | 3300031595 | Bacteria | 14236 |
| 154 | Ga0265313_10023181 | 3300031595 | Bacteria | 3349 |
| 155 | Ga0316579_10152379 | 3300031691 | Bacteria | 1116 |
| 156 | Ga0265314_10000066 | 3300031711 | Bacteria | 156399 |
| 157 | Ga0265314_10000970 | 3300031711 | Bacteria | 33717 |
| 158 | Ga0265342_10001043 | 3300031712 | Bacteria | 27135 |
| 159 | Ga0265342_10013233 | 3300031712 | Bacteria | 5547 |
| 160 | Ga0373924_0181548 | 3300035410 | Bacteria | 926 |
| 161 | Ga0373933_0002411 | 3300035724 | Bacteria | 10539 |
| 162 | Ga0373937_0000240 | 3300036401 | Bacteria | 53719 |
| 163 | Ga0373937_0171768 | 3300036401 | Bacteria | 2034 |
| 164 | Ga0395899_0017831 | 3300037312 | Bacteria | 5405 |
| 165 | Ga0395900_0008029 | 3300037418 | Bacteria | 10862 |
| 166 | Ga0395900_0062043 | 3300037418 | Bacteria | 3843 |
| 167 | Ga0395900_0242069 | 3300037418 | Bacteria | 1809 |
| 168 | Ga0395905_0000339 | 3300037471 | Bacteria | 66527 |
| 169 | Ga0395905_0000472 | 3300037471 | Bacteria | 55579 |
| 170 | Ga0395905_0004574 | 3300037471 | Bacteria | 14314 |
| 171 | Ga0395905_0027546 | 3300037471 | Bacteria | 5359 |
| 172 | Ga0395905_0046316 | 3300037471 | Bacteria | 4077 |
| 173 | Ga0395905_0053882 | 3300037471 | Bacteria | 3764 |
| 174 | Ga0395905_0223645 | 3300037471 | Bacteria | 1761 |
| 175 | Ga0395905_0264738 | 3300037471 | Bacteria | 1604 |
| 176 | Ga0395905_0389996 | 3300037471 | Bacteria | 1287 |
| 177 | Ga0395901_0116493 | 3300038443 | Bacteria | 2807 |
| 178 | Ga0395901_0226149 | 3300038443 | Bacteria | 1954 |
| 179 | Ga0395901_0323109 | 3300038443 | Bacteria | 1596 |
| 180 | Ga0436365_0096061 | 3300039437 | Bacteria | 1323 |
| 181 | Ga0436365_1542265 | 3300039437 | Bacteria | 2197 |
| 182 | Ga0439431_0040076 | 3300041997 | Bacteria | 1190 |
| 183 | Ga0439445_0003999 | 3300042004 | Bacteria | 3327 |
| 184 | Ga0439460_0029705 | 3300042461 | Bacteria | 1549 |
| 185 | Ga0451577_0002542 | 3300042876 | Bacteria | 21559 |
| 186 | Ga0451577_0084624 | 3300042876 | Bacteria | 2830 |
| 187 | Ga0451577_0371461 | 3300042876 | Bacteria | 1297 |
| 188 | Ga0451577_0374606 | 3300042876 | Bacteria | 1292 |
| 189 | Ga0466969_0037501 | 3300044656 | Bacteria | 2444 |
| 190 | Ga0453683_0000458 | 3300044673 | Bacteria | 46966 |
| 191 | Ga0453683_0003282 | 3300044673 | Bacteria | 12011 |
| 192 | Ga0466965_0028556 | 3300044683 | Bacteria | 2710 |
| 193 | Ga0466965_0058368 | 3300044683 | Bacteria | 1924 |
| 194 | Ga0466965_0064076 | 3300044683 | Bacteria | 1839 |
| 195 | Ga0453684_0000499 | 3300044712 | Bacteria | 153532 |
| 196 | Ga0453684_0003915 | 3300044712 | Bacteria | 32723 |
| 197 | Ga0453684_0011748 | 3300044712 | Bacteria | 14602 |
| 198 | Ga0453684_0099393 | 3300044712 | Bacteria | 3564 |
| 199 | Ga0453684_0144470 | 3300044712 | Bacteria | 2836 |
| 200 | Ga0453684_0274292 | 3300044712 | Bacteria | 1926 |
| 201 | Ga0466968_0119222 | 3300044735 | Bacteria | 1193 |
| 202 | Ga0466957_0003058 | 3300044842 | Bacteria | 9098 |
| 203 | Ga0466960_0055928 | 3300044901 | Bacteria | 1919 |
| 204 | Ga0466960_0166981 | 3300044901 | Bacteria | 1185 |
| 205 | Ga0466959_0085138 | 3300045049 | Bacteria | 2275 |
| 206 | Ga0466959_0171568 | 3300045049 | Bacteria | 1521 |
| 207 | Ga0451576_0291430 | 3300045051 | Bacteria | 1706 |
| 208 | Ga0451576_0423308 | 3300045051 | Bacteria | 1397 |
| 209 | Ga0451576_0425573 | 3300045051 | Bacteria | 1393 |
| 210 | Ga0495617_000574 | 3300046452 | Bacteria | 18841 |
| 211 | Ga0495651_0004031 | 3300046462 | Bacteria | 11225 |
| 212 | Ga0495653_0000011 | 3300046463 | Bacteria | 272314 |
| 213 | Ga0495584_0000017 | 3300046491 | Bacteria | 149686 |
| 214 | Ga0495585_0000064 | 3300046492 | Bacteria | 109302 |
| 215 | Ga0495585_0033102 | 3300046492 | Bacteria | 2927 |
| 216 | Ga0495596_0002227 | 3300046500 | Bacteria | 10557 |
| 217 | Ga0495606_0014675 | 3300046507 | Bacteria | 6093 |
| 218 | Ga0495616_0000727 | 3300046513 | Bacteria | 24274 |
| 219 | Ga0495631_0007050 | 3300046518 | Bacteria | 5747 |
| 220 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 221 | Ga0495642_0005062 | 3300046528 | Bacteria | 5077 |
| 222 | Ga0495642_0018943 | 3300046528 | Bacteria | 2696 |
| 223 | Ga0495642_0096128 | 3300046528 | Bacteria | 1257 |
| 224 | Ga0495587_0000456 | 3300046536 | Bacteria | 28557 |
| 225 | Ga0495621_0076213 | 3300046539 | Bacteria | 1244 |
| 226 | Ga0495597_0059369 | 3300046542 | Bacteria | 1670 |
| 227 | Ga0495597_0169880 | 3300046542 | Bacteria | 885 |
| 228 | Ga0495633_0033082 | 3300046558 | Bacteria | 2495 |
| 229 | Ga0495633_0042273 | 3300046558 | Bacteria | 2165 |
| 230 | Ga0495633_0063633 | 3300046558 | Bacteria | 1725 |
| 231 | Ga0495656_0001328 | 3300046615 | Bacteria | 8056 |
| 232 | Ga0495611_0110147 | 3300046648 | Bacteria | 1281 |
| 233 | Ga0495661_0001107 | 3300046665 | Bacteria | 23635 |
| 234 | Ga0495661_0087541 | 3300046665 | Bacteria | 1780 |
| 235 | Ga0495661_0126553 | 3300046665 | Bacteria | 1405 |
| 236 | Ga0495669_0003709 | 3300046684 | Bacteria | 6282 |
| 237 | Ga0495670_0129190 | 3300046691 | Bacteria | 1316 |
| 238 | Ga0495670_0253952 | 3300046691 | Bacteria | 937 |
| 239 | Ga0495671_0021731 | 3300046692 | Bacteria | 3367 |
| 240 | Ga0495649_0062873 | 3300046694 | Bacteria | 1995 |
| 241 | Ga0495604_0058082 | 3300047317 | Bacteria | 2972 |
| 242 | Ga0495687_017729 | 3300047443 | Bacteria | 3539 |
| 243 | Ga0495675_0000308 | 3300047444 | Bacteria | 35025 |
| 244 | Ga0495681_0016407 | 3300047470 | Bacteria | 4153 |
| 245 | Ga0495602_0002185 | 3300048088 | Bacteria | 19759 |
| 246 | Ga0496101_0130787 | 3300048904 | Bacteria | 1906 |
| 247 | Ga0496101_0220608 | 3300048904 | Bacteria | 1471 |
| 248 | Ga0496102_0096186 | 3300048905 | Bacteria | 2745 |
| 249 | Ga0496102_0187957 | 3300048905 | Bacteria | 1947 |
| 250 | Ga0496104_0190033 | 3300048907 | Bacteria | 1965 |
| 251 | Ga0496108_0017854 | 3300048911 | Bacteria | 5803 |
| 252 | Ga0496109_0092061 | 3300048912 | Bacteria | 2804 |
| 253 | Ga0496109_0171537 | 3300048912 | Bacteria | 2035 |
| 254 | Ga0496114_0023733 | 3300048917 | Bacteria | 5005 |
| 255 | Ga0496114_0043321 | 3300048917 | Bacteria | 3732 |
| 256 | Ga0496114_0068891 | 3300048917 | Bacteria | 2970 |
| 257 | Ga0496122_0000274 | 3300048925 | Bacteria | 115100 |
| 258 | Ga0496122_0008269 | 3300048925 | Bacteria | 11284 |
| 259 | Ga0496123_0003708 | 3300048926 | Bacteria | 16801 |
| 260 | Ga0496124_0009111 | 3300048927 | Bacteria | 10260 |
| 261 | Ga0496124_0041731 | 3300048927 | Bacteria | 3956 |
| 262 | Ga0496126_0081477 | 3300048929 | Bacteria | 2861 |
| 263 | Ga0496126_0214903 | 3300048929 | Bacteria | 1618 |
| 264 | Ga0501031_0011088 | 3300049568 | Bacteria | 5875 |
| 265 | Ga0501031_0013178 | 3300049568 | Bacteria | 5396 |
| 266 | Ga0501031_0048661 | 3300049568 | Bacteria | 2762 |
| 267 | Ga0501032_0009353 | 3300049569 | Bacteria | 7099 |
| 268 | Ga0501032_0013437 | 3300049569 | Bacteria | 5822 |
| 269 | Ga0501032_0139007 | 3300049569 | Bacteria | 1600 |
| 270 | Ga0501033_0001146 | 3300049570 | Bacteria | 23949 |
| 271 | Ga0501034_0011043 | 3300049571 | Bacteria | 9377 |
| 272 | Ga0501034_0024084 | 3300049571 | Bacteria | 6194 |
| 273 | Ga0501036_0000415 | 3300049572 | Bacteria | 30126 |
| 274 | Ga0501036_0004424 | 3300049572 | Bacteria | 11348 |
| 275 | Ga0501036_0017772 | 3300049572 | Bacteria | 5954 |
| 276 | Ga0501036_0224169 | 3300049572 | Bacteria | 1578 |
| 277 | Ga0501036_0428226 | 3300049572 | Bacteria | 1103 |
| 278 | Ga0501037_0000255 | 3300049573 | Bacteria | 45740 |
| 279 | Ga0501037_0053277 | 3300049573 | Bacteria | 2959 |
| 280 | Ga0501038_0003901 | 3300049574 | Bacteria | 13868 |
| 281 | Ga0501038_0035136 | 3300049574 | Bacteria | 4402 |
| 282 | Ga0501038_0047113 | 3300049574 | Bacteria | 3735 |
| 283 | Ga0501038_0158313 | 3300049574 | Bacteria | 1842 |
| 284 | Ga0501039_0009357 | 3300049575 | Bacteria | 7467 |
| 285 | Ga0501039_0160882 | 3300049575 | Bacteria | 1765 |
| 286 | Ga0501041_0032932 | 3300049577 | Bacteria | 3133 |
| 287 | Ga0501042_0010196 | 3300049578 | Bacteria | 6288 |
| 288 | Ga0501043_0011449 | 3300049579 | Bacteria | 6945 |
| 289 | Ga0501043_0012162 | 3300049579 | Bacteria | 6726 |
| 290 | Ga0501046_0031969 | 3300049580 | Bacteria | 4263 |
| 291 | Ga0501047_0087724 | 3300049581 | Bacteria | 2989 |
| 292 | Ga0501048_0344560 | 3300049582 | Bacteria | 1062 |
| 293 | Ga0501068_0001727 | 3300049584 | Bacteria | 11618 |
| 294 | Ga0501072_0012997 | 3300049588 | Bacteria | 6371 |
| 295 | Ga0501073_0228671 | 3300049589 | Bacteria | 1285 |
| 296 | Ga0501075_0040323 | 3300049591 | Bacteria | 3497 |
| 297 | Ga0501075_0165371 | 3300049591 | Bacteria | 1688 |
| 298 | Ga0501076_0002950 | 3300049592 | Bacteria | 11791 |
| 299 | Ga0501080_0059083 | 3300049742 | Bacteria | 3569 |
| 300 | Ga0501035_0003494 | 3300049822 | Bacteria | 15025 |
| 301 | Ga0501035_0030051 | 3300049822 | Bacteria | 4954 |
| 302 | Ga0501044_0000323 | 3300049823 | Bacteria | 60420 |
| 303 | Ga0501044_0001314 | 3300049823 | Bacteria | 29300 |
| 304 | Ga0501044_0029398 | 3300049823 | Bacteria | 5795 |
| 305 | Ga0501044_0254127 | 3300049823 | Bacteria | 1697 |
| 306 | Ga0501044_0311694 | 3300049823 | Bacteria | 1500 |
| 307 | Ga0501045_0001764 | 3300049824 | Bacteria | 14594 |
| 308 | Ga0501045_0053078 | 3300049824 | Bacteria | 2961 |
| 309 | nmdc:mga0yw44_28977_c1 | 3300050492 | Bacteria | 3191 |
| 310 | nmdc:mga06z11_191354_c1 | 3300050494 | Bacteria | 1184 |
| 311 | nmdc:mga07m45_103139_c1 | 3300050496 | Bacteria | 1639 |
| 312 | nmdc:mga05p37_3727_c1 | 3300050507 | Bacteria | 17834 |
| 313 | nmdc:mga09592_12583_c1 | 3300050508 | Bacteria | 6895 |
| 314 | nmdc:mga0qj67_97713_c1 | 3300050509 | Bacteria | 2365 |
| 315 | nmdc:mga08y16_185197_c1 | 3300050511 | Bacteria | 2161 |
| 316 | nmdc:mga08y16_202985_c1 | 3300050511 | Bacteria | 2054 |
| 317 | Ga0500634_0042665 | 3300053161 | Bacteria | 2460 |
| 318 | Ga0501084_0154781 | 3300054114 | Bacteria | 1933 |
| 319 | Ga0530510_0063811 | 3300061734 | Bacteria | 2667 |
| 320 | Ga0530510_0492143 | 3300061734 | Bacteria | 929 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_0224169 | Ga0501036_0224169_835_1566 | 213 |
| 2 | 3300037471 | Ga0395905_0004574 | Ga0395905_0004574_6144_6983 | 218 |
| 3 | 3300035410 | Ga0373924_0181548 | Ga0373924_0181548_21_773 | 220 |
| 4 | 3300006353 | Ga0075370_10245900 | Ga0075370_102459002 | 230 |
| 5 | 3300050496 | nmdc:mga07m45_103139_c1 | nmdc:mga07m45_103139_c1_683_1516 | 230 |
| 6 | 3300005563 | Ga0068855_100007253 | Ga0068855_1000072536 | 233 |
| 7 | 3300025949 | Ga0207667_10005517 | Ga0207667_100055177 | 233 |
| 8 | 3300046500 | Ga0495596_0002227 | Ga0495596_0002227_9268_10116 | 233 |
| 9 | 3300046558 | Ga0495633_0042273 | Ga0495633_0042273_55_903 | 233 |
| 10 | 3300046665 | Ga0495661_0126553 | Ga0495661_0126553_402_1250 | 233 |
| 11 | 3300046684 | Ga0495669_0003709 | Ga0495669_0003709_4921_5769 | 233 |
| 12 | 3300046691 | Ga0495670_0129190 | Ga0495670_0129190_49_897 | 233 |
| 13 | 3300049568 | Ga0501031_0011088 | Ga0501031_0011088_4670_5500 | 233 |
| 14 | 3300009551 | Ga0105238_10071941 | Ga0105238_100719413 | 234 |
| 15 | 3300053161 | Ga0500634_0042665 | Ga0500634_0042665_1227_2108 | 234 |
| 16 | 3300006051 | Ga0075364_10059375 | Ga0075364_100593752 | 235 |
| 17 | 3300009551 | Ga0105238_10326500 | Ga0105238_103265002 | 235 |
| 18 | 3300037471 | Ga0395905_0000472 | Ga0395905_0000472_28377_29243 | 235 |
| 19 | 3300049569 | Ga0501032_0139007 | Ga0501032_0139007_119_949 | 236 |
| 20 | 3300049570 | Ga0501033_0001146 | Ga0501033_0001146_3052_3882 | 236 |
| 21 | 3300049572 | Ga0501036_0000415 | Ga0501036_0000415_29203_30033 | 236 |
| 22 | 3300049573 | Ga0501037_0053277 | Ga0501037_0053277_1496_2326 | 236 |
| 23 | 3300049574 | Ga0501038_0035136 | Ga0501038_0035136_3473_4303 | 236 |
| 24 | 3300049581 | Ga0501047_0087724 | Ga0501047_0087724_775_1605 | 236 |
| 25 | 3300049823 | Ga0501044_0311694 | Ga0501044_0311694_261_1091 | 237 |
| 26 | 3300049823 | Ga0501044_0254127 | Ga0501044_0254127_130_966 | 238 |
| 27 | 3300005843 | Ga0068860_100418943 | Ga0068860_1004189432 | 239 |
| 28 | 3300046528 | Ga0495642_0018943 | Ga0495642_0018943_1232_2083 | 239 |
| 29 | 3300049591 | Ga0501075_0165371 | Ga0501075_0165371_23_832 | 239 |
| 30 | 3300050494 | nmdc:mga06z11_191354_c1 | nmdc:mga06z11_191354_c1_26_868 | 239 |
| 31 | 3300009094 | Ga0111539_10358559 | Ga0111539_103585592 | 240 |
| 32 | 3300027907 | Ga0207428_10248452 | Ga0207428_102484522 | 240 |
| 33 | 3300041997 | Ga0439431_0040076 | Ga0439431_0040076_75_911 | 240 |
| 34 | 3300048911 | Ga0496108_0017854 | Ga0496108_0017854_2503_3336 | 240 |
| 35 | 3300048912 | Ga0496109_0171537 | Ga0496109_0171537_58_891 | 240 |
| 36 | 3300048917 | Ga0496114_0068891 | Ga0496114_0068891_2030_2863 | 240 |
| 37 | 3300050511 | nmdc:mga08y16_185197_c1 | nmdc:mga08y16_185197_c1_1143_1976 | 240 |
| 38 | 3300025909 | Ga0207705_10074170 | Ga0207705_100741701 | 242 |
| 39 | 3300006177 | Ga0075362_10175784 | Ga0075362_101757842 | 243 |
| 40 | 3300028556 | Ga0265337_1029590 | Ga0265337_10295902 | 243 |
| 41 | 3300046528 | Ga0495642_0096128 | Ga0495642_0096128_126_932 | 243 |
| 42 | 3300026116 | Ga0207674_10510378 | Ga0207674_105103782 | 244 |
| 43 | 3300048925 | Ga0496122_0008269 | Ga0496122_0008269_5009_5860 | 244 |
| 44 | 3300048929 | Ga0496126_0214903 | Ga0496126_0214903_476_1327 | 244 |
| 45 | 3300009101 | Ga0105247_10021003 | Ga0105247_100210033 | 245 |
| 46 | 3300009148 | Ga0105243_10321056 | Ga0105243_103210561 | 245 |
| 47 | 3300009177 | Ga0105248_10041536 | Ga0105248_100415365 | 245 |
| 48 | 3300009553 | Ga0105249_10061434 | Ga0105249_100614343 | 245 |
| 49 | 3300014968 | Ga0157379_10218316 | Ga0157379_102183161 | 245 |
| 50 | 3300026035 | Ga0207703_10815908 | Ga0207703_108159081 | 245 |
| 51 | 3300037418 | Ga0395900_0008029 | Ga0395900_0008029_5727_6566 | 245 |
| 52 | 3300037418 | Ga0395900_0062043 | Ga0395900_0062043_294_1136 | 245 |
| 53 | 3300037418 | Ga0395900_0242069 | Ga0395900_0242069_616_1455 | 245 |
| 54 | 3300037471 | Ga0395905_0223645 | Ga0395905_0223645_849_1688 | 245 |
| 55 | 3300037471 | Ga0395905_0389996 | Ga0395905_0389996_193_1035 | 245 |
| 56 | 3300038443 | Ga0395901_0226149 | Ga0395901_0226149_68_907 | 245 |
| 57 | 3300038443 | Ga0395901_0323109 | Ga0395901_0323109_322_1161 | 245 |
| 58 | 3300028666 | Ga0265336_10005140 | Ga0265336_100051403 | 246 |
| 59 | 3300042876 | Ga0451577_0371461 | Ga0451577_0371461_106_939 | 246 |
| 60 | 3300044712 | Ga0453684_0000499 | Ga0453684_0000499_125337_126170 | 246 |
| 61 | 3300044712 | Ga0453684_0099393 | Ga0453684_0099393_544_1377 | 246 |
| 62 | 3300049568 | Ga0501031_0013178 | Ga0501031_0013178_1292_2122 | 246 |
| 63 | 3300049568 | Ga0501031_0048661 | Ga0501031_0048661_823_1653 | 246 |
| 64 | 3300049569 | Ga0501032_0009353 | Ga0501032_0009353_2560_3390 | 246 |
| 65 | 3300049569 | Ga0501032_0013437 | Ga0501032_0013437_1192_2022 | 246 |
| 66 | 3300049571 | Ga0501034_0011043 | Ga0501034_0011043_959_1789 | 246 |
| 67 | 3300049571 | Ga0501034_0024084 | Ga0501034_0024084_1192_2022 | 246 |
| 68 | 3300049572 | Ga0501036_0004424 | Ga0501036_0004424_8113_8943 | 246 |
| 69 | 3300049572 | Ga0501036_0017772 | Ga0501036_0017772_4078_4908 | 246 |
| 70 | 3300049573 | Ga0501037_0000255 | Ga0501037_0000255_39188_40018 | 246 |
| 71 | 3300049574 | Ga0501038_0003901 | Ga0501038_0003901_10633_11463 | 246 |
| 72 | 3300049574 | Ga0501038_0158313 | Ga0501038_0158313_590_1420 | 246 |
| 73 | 3300049575 | Ga0501039_0009357 | Ga0501039_0009357_2701_3531 | 246 |
| 74 | 3300049578 | Ga0501042_0010196 | Ga0501042_0010196_1017_1847 | 246 |
| 75 | 3300049579 | Ga0501043_0011449 | Ga0501043_0011449_3710_4540 | 246 |
| 76 | 3300049579 | Ga0501043_0012162 | Ga0501043_0012162_1223_2053 | 246 |
| 77 | 3300049580 | Ga0501046_0031969 | Ga0501046_0031969_691_1521 | 246 |
| 78 | 3300049584 | Ga0501068_0001727 | Ga0501068_0001727_2677_3507 | 246 |
| 79 | 3300049822 | Ga0501035_0030051 | Ga0501035_0030051_850_1680 | 246 |
| 80 | 3300049823 | Ga0501044_0000323 | Ga0501044_0000323_55561_56391 | 246 |
| 81 | 3300049823 | Ga0501044_0029398 | Ga0501044_0029398_4012_4842 | 246 |
| 82 | 3300049824 | Ga0501045_0001764 | Ga0501045_0001764_2712_3542 | 246 |
| 83 | 3300005471 | Ga0070698_100373104 | Ga0070698_1003731042 | 247 |
| 84 | 3300046558 | Ga0495633_0033082 | Ga0495633_0033082_249_1061 | 247 |
| 85 | 3300047317 | Ga0495604_0058082 | Ga0495604_0058082_18_887 | 247 |
| 86 | 3300003784 | Ga0055534_1005996 | Ga0055534_10059964 | 248 |
| 87 | 3300025284 | Ga0209130_1014551 | Ga0209130_10145512 | 248 |
| 88 | 3300025291 | Ga0209675_1000923 | Ga0209675_100092315 | 248 |
| 89 | 3300025303 | Ga0209051_1013448 | Ga0209051_10134482 | 248 |
| 90 | 3300025304 | Ga0209257_1012144 | Ga0209257_10121443 | 248 |
| 91 | 3300031595 | Ga0265313_10023181 | Ga0265313_100231813 | 248 |
| 92 | 3300031691 | Ga0316579_10152379 | Ga0316579_101523791 | 249 |
| 93 | 3300046452 | Ga0495617_000574 | Ga0495617_000574_9163_9975 | 249 |
| 94 | 3300046491 | Ga0495584_0000017 | Ga0495584_0000017_125386_126198 | 249 |
| 95 | 3300046492 | Ga0495585_0000064 | Ga0495585_0000064_50626_51438 | 249 |
| 96 | 3300046507 | Ga0495606_0014675 | Ga0495606_0014675_4934_5746 | 249 |
| 97 | 3300046513 | Ga0495616_0000727 | Ga0495616_0000727_8867_9679 | 249 |
| 98 | 3300046524 | Ga0495648_0000007 | Ga0495648_0000007_280939_281751 | 249 |
| 99 | 3300049574 | Ga0501038_0047113 | Ga0501038_0047113_1127_1957 | 250 |
| 100 | 3300049822 | Ga0501035_0003494 | Ga0501035_0003494_12763_13593 | 250 |
| 101 | 3300049823 | Ga0501044_0001314 | Ga0501044_0001314_2874_3704 | 250 |
| 102 | 3300042876 | Ga0451577_0084624 | Ga0451577_0084624_1758_2600 | 251 |
| 103 | 3300045051 | Ga0451576_0423308 | Ga0451576_0423308_160_1032 | 251 |
| 104 | 3300045051 | Ga0451576_0425573 | Ga0451576_0425573_571_1326 | 251 |
| 105 | 3300005331 | Ga0070670_100121995 | Ga0070670_1001219952 | 254 |
| 106 | 3300005618 | Ga0068864_100251168 | Ga0068864_1002511681 | 254 |
| 107 | 3300025925 | Ga0207650_10119120 | Ga0207650_101191202 | 254 |
| 108 | 3300026095 | Ga0207676_10058317 | Ga0207676_100583171 | 254 |
| 109 | 3300046694 | Ga0495649_0062873 | Ga0495649_0062873_389_1198 | 254 |
| 110 | 3300039437 | Ga0436365_1542265 | Ga0436365_1542265_745_1569 | 256 |
| 111 | 3300044673 | Ga0453683_0003282 | Ga0453683_0003282_4286_5173 | 256 |
| 112 | 3300045051 | Ga0451576_0291430 | Ga0451576_0291430_234_1121 | 256 |
| 113 | 3300009094 | Ga0111539_10016326 | Ga0111539_100163266 | 257 |
| 114 | 3300025923 | Ga0207681_10024600 | Ga0207681_100246005 | 257 |
| 115 | 3300048925 | Ga0496122_0000274 | Ga0496122_0000274_18991_19887 | 257 |
| 116 | 3300048926 | Ga0496123_0003708 | Ga0496123_0003708_5503_6399 | 257 |
| 117 | 3300050508 | nmdc:mga09592_12583_c1 | nmdc:mga09592_12583_c1_225_1037 | 257 |
| 118 | 3300035724 | Ga0373933_0002411 | Ga0373933_0002411_8334_9236 | 258 |
| 119 | 3300036401 | Ga0373937_0000240 | Ga0373937_0000240_8831_9733 | 258 |
| 120 | 3300046462 | Ga0495651_0004031 | Ga0495651_0004031_4277_5179 | 258 |
| 121 | 3300046536 | Ga0495587_0000456 | Ga0495587_0000456_14204_15106 | 258 |
| 122 | 3300047444 | Ga0495675_0000308 | Ga0495675_0000308_31872_32774 | 258 |
| 123 | 3300048088 | Ga0495602_0002185 | Ga0495602_0002185_13932_14834 | 258 |
| 124 | 3300005577 | Ga0068857_100136353 | Ga0068857_1001363532 | 259 |
| 125 | 3300044656 | Ga0466969_0037501 | Ga0466969_0037501_199_1032 | 259 |
| 126 | 3300044683 | Ga0466965_0058368 | Ga0466965_0058368_607_1440 | 259 |
| 127 | 3300044735 | Ga0466968_0119222 | Ga0466968_0119222_307_1140 | 259 |
| 128 | 3300045049 | Ga0466959_0085138 | Ga0466959_0085138_1412_2245 | 259 |
| 129 | 3300037471 | Ga0395905_0046316 | Ga0395905_0046316_2815_3696 | 260 |
| 130 | 3300037471 | Ga0395905_0264738 | Ga0395905_0264738_694_1578 | 260 |
| 131 | 3300044901 | Ga0466960_0166981 | Ga0466960_0166981_51_887 | 260 |
| 132 | 3300048917 | Ga0496114_0043321 | Ga0496114_0043321_691_1473 | 260 |
| 133 | 3300005563 | Ga0068855_100000072 | Ga0068855_10000007280 | 261 |
| 134 | 3300005563 | Ga0068855_100153299 | Ga0068855_1001532992 | 261 |
| 135 | 3300005578 | Ga0068854_100138584 | Ga0068854_1001385842 | 261 |
| 136 | 3300009551 | Ga0105238_10000318 | Ga0105238_100003183 | 261 |
| 137 | 3300010375 | Ga0105239_10109056 | Ga0105239_101090565 | 261 |
| 138 | 3300015261 | Ga0182006_1004807 | Ga0182006_10048072 | 261 |
| 139 | 3300015262 | Ga0182007_10019887 | Ga0182007_100198873 | 261 |
| 140 | 3300025914 | Ga0207671_10058384 | Ga0207671_100583843 | 261 |
| 141 | 3300025924 | Ga0207694_10026618 | Ga0207694_100266182 | 261 |
| 142 | 3300025949 | Ga0207667_10000055 | Ga0207667_10000055143 | 261 |
| 143 | 3300025949 | Ga0207667_10030522 | Ga0207667_100305223 | 261 |
| 144 | 3300025981 | Ga0207640_10095129 | Ga0207640_100951292 | 261 |
| 145 | 3300028563 | Ga0265319_1000174 | Ga0265319_100017445 | 261 |
| 146 | 3300028573 | Ga0265334_10007345 | Ga0265334_100073452 | 261 |
| 147 | 3300028577 | Ga0265318_10001007 | Ga0265318_1000100718 | 261 |
| 148 | 3300028800 | Ga0265338_10008339 | Ga0265338_100083398 | 261 |
| 149 | 3300037471 | Ga0395905_0053882 | Ga0395905_0053882_1565_2401 | 261 |
| 150 | 3300046463 | Ga0495653_0000011 | Ga0495653_0000011_240835_241713 | 261 |
| 151 | 3300046528 | Ga0495642_0005062 | Ga0495642_0005062_594_1457 | 261 |
| 152 | 3300046539 | Ga0495621_0076213 | Ga0495621_0076213_134_997 | 261 |
| 153 | 3300046665 | Ga0495661_0001107 | Ga0495661_0001107_21050_21913 | 261 |
| 154 | 3300047443 | Ga0495687_017729 | Ga0495687_017729_379_1242 | 261 |
| 155 | 3300048904 | Ga0496101_0130787 | Ga0496101_0130787_520_1383 | 261 |
| 156 | 3300048905 | Ga0496102_0096186 | Ga0496102_0096186_1471_2334 | 261 |
| 157 | 3300048912 | Ga0496109_0092061 | Ga0496109_0092061_248_1111 | 261 |
| 158 | 3300005840 | Ga0068870_10234276 | Ga0068870_102342761 | 262 |
| 159 | 3300026116 | Ga0207674_10302419 | Ga0207674_103024191 | 262 |
| 160 | 3300028800 | Ga0265338_10001712 | Ga0265338_100017126 | 262 |
| 161 | 3300031344 | Ga0265316_10365145 | Ga0265316_103651452 | 262 |
| 162 | 3300042461 | Ga0439460_0029705 | Ga0439460_0029705_691_1527 | 262 |
| 163 | 3300048929 | Ga0496126_0081477 | Ga0496126_0081477_620_1456 | 262 |
| 164 | 3300003771 | Ga0055526_1004476 | Ga0055526_10044763 | 263 |
| 165 | 3300003773 | Ga0055537_1000111 | Ga0055537_100011150 | 263 |
| 166 | 3300003775 | Ga0055524_1004885 | Ga0055524_10048852 | 263 |
| 167 | 3300003784 | Ga0055534_1000509 | Ga0055534_100050912 | 263 |
| 168 | 3300003790 | Ga0055528_1000178 | Ga0055528_10001782 | 263 |
| 169 | 3300003790 | Ga0055528_1005582 | Ga0055528_10055825 | 263 |
| 170 | 3300005330 | Ga0070690_100167970 | Ga0070690_1001679701 | 263 |
| 171 | 3300005331 | Ga0070670_100163298 | Ga0070670_1001632981 | 263 |
| 172 | 3300005440 | Ga0070705_100050567 | Ga0070705_1000505672 | 263 |
| 173 | 3300005445 | Ga0070708_100303666 | Ga0070708_1003036661 | 263 |
| 174 | 3300005617 | Ga0068859_100275941 | Ga0068859_1002759411 | 263 |
| 175 | 3300006931 | Ga0097620_100275931 | Ga0097620_1002759311 | 263 |
| 176 | 3300014325 | Ga0163163_10248594 | Ga0163163_102485942 | 263 |
| 177 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009549 | 263 |
| 178 | 3300025273 | Ga0209673_1000036 | Ga0209673_1000036133 | 263 |
| 179 | 3300025291 | Ga0209675_1000013 | Ga0209675_1000013133 | 263 |
| 180 | 3300025295 | Ga0209564_1000122 | Ga0209564_1000122133 | 263 |
| 181 | 3300025299 | Ga0209256_1000106 | Ga0209256_100010642 | 263 |
| 182 | 3300025936 | Ga0207670_10390069 | Ga0207670_103900692 | 263 |
| 183 | 3300025941 | Ga0207711_10022130 | Ga0207711_100221303 | 263 |
| 184 | 3300025944 | Ga0207661_10047779 | Ga0207661_100477794 | 263 |
| 185 | 3300025961 | Ga0207712_10027650 | Ga0207712_100276501 | 263 |
| 186 | 3300026095 | Ga0207676_10135118 | Ga0207676_101351182 | 263 |
| 187 | 3300031238 | Ga0265332_10000015 | Ga0265332_10000015115 | 263 |
| 188 | 3300044673 | Ga0453683_0000458 | Ga0453683_0000458_26332_27159 | 263 |
| 189 | 3300044712 | Ga0453684_0011748 | Ga0453684_0011748_1128_1967 | 263 |
| 190 | 3300009147 | Ga0114129_10011822 | Ga0114129_100118225 | 264 |
| 191 | 3300042004 | Ga0439445_0003999 | Ga0439445_0003999_1560_2441 | 264 |
| 192 | 3300044683 | Ga0466965_0064076 | Ga0466965_0064076_969_1805 | 264 |
| 193 | 3300044901 | Ga0466960_0055928 | Ga0466960_0055928_679_1515 | 264 |
| 194 | 3300048927 | Ga0496124_0009111 | Ga0496124_0009111_3796_4665 | 264 |
| 195 | 3300050507 | nmdc:mga05p37_3727_c1 | nmdc:mga05p37_3727_c1_14894_15724 | 264 |
| 196 | iso_pu_bacteria | 2643221683 | 2644468163 | 264 |
| 197 | iso_pu_bacteria | 2899924645 | 2899924715 | 264 |
| 198 | iso_pu_bacteria | 2929520902 | 2929522749 | 264 |
| 199 | iso_pu_bacteria | 2945984333 | 2945986060 | 264 |
| 200 | 3300026118 | Ga0207675_100445232 | Ga0207675_1004452322 | 265 |
| 201 | 3300039437 | Ga0436365_0096061 | Ga0436365_0096061_468_1304 | 265 |
| 202 | 3300044712 | Ga0453684_0003915 | Ga0453684_0003915_2831_3634 | 265 |
| 203 | iso_pu_bacteria | 2928115317 | 2928119924 | 265 |
| 204 | 3300031507 | Ga0307509_10000543 | Ga0307509_1000054332 | 266 |
| 205 | 3300006844 | Ga0075428_100032046 | Ga0075428_1000320464 | 267 |
| 206 | 3300006846 | Ga0075430_100374180 | Ga0075430_1003741802 | 267 |
| 207 | 3300006880 | Ga0075429_100008176 | Ga0075429_1000081765 | 267 |
| 208 | 3300028556 | Ga0265337_1000950 | Ga0265337_10009503 | 267 |
| 209 | 3300028558 | Ga0265326_10003826 | Ga0265326_100038262 | 267 |
| 210 | 3300028563 | Ga0265319_1001367 | Ga0265319_10013677 | 267 |
| 211 | 3300028573 | Ga0265334_10002316 | Ga0265334_100023166 | 267 |
| 212 | 3300028577 | Ga0265318_10002070 | Ga0265318_100020708 | 267 |
| 213 | 3300028654 | Ga0265322_10003443 | Ga0265322_100034432 | 267 |
| 214 | 3300028666 | Ga0265336_10000830 | Ga0265336_1000083015 | 267 |
| 215 | 3300028800 | Ga0265338_10004754 | Ga0265338_1000475416 | 267 |
| 216 | 3300031240 | Ga0265320_10005104 | Ga0265320_100051043 | 267 |
| 217 | 3300031247 | Ga0265340_10004206 | Ga0265340_100042066 | 267 |
| 218 | 3300031249 | Ga0265339_10050157 | Ga0265339_100501572 | 267 |
| 219 | 3300031344 | Ga0265316_10010948 | Ga0265316_100109483 | 267 |
| 220 | 3300031595 | Ga0265313_10002936 | Ga0265313_100029369 | 267 |
| 221 | 3300031712 | Ga0265342_10013233 | Ga0265342_100132333 | 267 |
| 222 | 3300050509 | nmdc:mga0qj67_97713_c1 | nmdc:mga0qj67_97713_c1_1492_2334 | 267 |
| 223 | 3300003760 | Ga0055527_1010753 | Ga0055527_10107531 | 268 |
| 224 | 3300003761 | Ga0055535_1000330 | Ga0055535_100033035 | 268 |
| 225 | 3300003762 | Ga0055542_1000039 | Ga0055542_100003971 | 268 |
| 226 | 3300003781 | Ga0055536_1009209 | Ga0055536_10092094 | 268 |
| 227 | 3300009094 | Ga0111539_10385759 | Ga0111539_103857592 | 268 |
| 228 | 3300025921 | Ga0207652_10395464 | Ga0207652_103954641 | 268 |
| 229 | 3300048927 | Ga0496124_0041731 | Ga0496124_0041731_307_1113 | 268 |
| 230 | 3300050511 | nmdc:mga08y16_202985_c1 | nmdc:mga08y16_202985_c1_596_1402 | 268 |
| 231 | 3300003792 | Ga0055540_1009322 | Ga0055540_10093224 | 269 |
| 232 | 3300003794 | Ga0055531_10006766 | Ga0055531_100067665 | 269 |
| 233 | 3300005327 | Ga0070658_10269870 | Ga0070658_102698702 | 269 |
| 234 | 3300037471 | Ga0395905_0000339 | Ga0395905_0000339_34651_35529 | 269 |
| 235 | 3300046492 | Ga0495585_0033102 | Ga0495585_0033102_2056_2865 | 269 |
| 236 | 3300046542 | Ga0495597_0169880 | Ga0495597_0169880_14_823 | 269 |
| 237 | 3300046558 | Ga0495633_0063633 | Ga0495633_0063633_31_840 | 269 |
| 238 | 3300046665 | Ga0495661_0087541 | Ga0495661_0087541_958_1767 | 269 |
| 239 | 3300047470 | Ga0495681_0016407 | Ga0495681_0016407_1276_2085 | 269 |
| 240 | 3300048907 | Ga0496104_0190033 | Ga0496104_0190033_13_822 | 269 |
| 241 | 3300048917 | Ga0496114_0023733 | Ga0496114_0023733_2877_3686 | 269 |
| 242 | 3300049575 | Ga0501039_0160882 | Ga0501039_0160882_401_1237 | 269 |
| 243 | 3300054114 | Ga0501084_0154781 | Ga0501084_0154781_438_1274 | 269 |
| 244 | 3300005563 | Ga0068855_100991441 | Ga0068855_1009914411 | 270 |
| 245 | 3300009093 | Ga0105240_10012766 | Ga0105240_100127668 | 270 |
| 246 | 3300009551 | Ga0105238_10049198 | Ga0105238_100491984 | 270 |
| 247 | 3300028800 | Ga0265338_10024276 | Ga0265338_100242763 | 270 |
| 248 | 3300048904 | Ga0496101_0220608 | Ga0496101_0220608_513_1355 | 270 |
| 249 | iso_pu_bacteria | 2738541277 | 2738717727 | 270 |
| 250 | iso_pu_bacteria | 2738543019 | 2739278413 | 270 |
| 251 | iso_pu_bacteria | 2808606418 | 2809144609 | 270 |
| 252 | iso_pu_bacteria | 2904541872 | 2904548167 | 270 |
| 253 | iso_pu_bacteria | 2929160207 | 2929163096 | 270 |
| 254 | 3300038443 | Ga0395901_0116493 | Ga0395901_0116493_1502_2368 | 271 |
| 255 | 3300025254 | Ga0209148_1001908 | Ga0209148_10019083 | 272 |
| 256 | 3300037312 | Ga0395899_0017831 | Ga0395899_0017831_4475_5317 | 272 |
| 257 | 3300037471 | Ga0395905_0027546 | Ga0395905_0027546_1443_2291 | 272 |
| 258 | 3300044683 | Ga0466965_0028556 | Ga0466965_0028556_1249_2091 | 272 |
| 259 | 3300044842 | Ga0466957_0003058 | Ga0466957_0003058_3644_4486 | 272 |
| 260 | 3300045049 | Ga0466959_0171568 | Ga0466959_0171568_74_916 | 272 |
| 261 | iso_pu_bacteria | 2521172590 | 2521557610 | 272 |
| 262 | iso_pu_bacteria | 2551306416 | 2553006639 | 272 |
| 263 | iso_pu_bacteria | 2738543013 | 2739251420 | 272 |
| 264 | iso_pu_bacteria | 2808606386 | 2808984364 | 272 |
| 265 | iso_pu_bacteria | 2808606415 | 2809130718 | 272 |
| 266 | iso_pu_bacteria | 2808606419 | 2809149804 | 272 |
| 267 | iso_pu_bacteria | 2818991449 | 2819615250 | 272 |
| 268 | iso_pu_bacteria | 2852618963 | 2852620055 | 272 |
| 269 | iso_pu_bacteria | 2857604169 | 2857609105 | 272 |
| 270 | iso_pu_bacteria | 2904439833 | 2904441675 | 272 |
| 271 | iso_pu_bacteria | 2904530477 | 2904531403 | 272 |
| 272 | iso_pu_bacteria | 2904584206 | 2904586942 | 272 |
| 273 | iso_pu_bacteria | 2904589729 | 2904593025 | 272 |
| 274 | iso_pu_bacteria | 2904601388 | 2904603165 | 272 |
| 275 | iso_pu_bacteria | 2919046199 | 2919050961 | 272 |
| 276 | iso_pu_bacteria | 2919079590 | 2919082013 | 272 |
| 277 | iso_pu_bacteria | 2923510766 | 2923510782 | 272 |
| 278 | iso_pu_bacteria | 2928130867 | 2928135101 | 272 |
| 279 | 3300006844 | Ga0075428_100044773 | Ga0075428_1000447734 | 273 |
| 280 | 3300046518 | Ga0495631_0007050 | Ga0495631_0007050_4123_4971 | 273 |
| 281 | 3300046542 | Ga0495597_0059369 | Ga0495597_0059369_497_1348 | 273 |
| 282 | 3300046615 | Ga0495656_0001328 | Ga0495656_0001328_6044_6892 | 273 |
| 283 | 3300046648 | Ga0495611_0110147 | Ga0495611_0110147_350_1198 | 273 |
| 284 | 3300046691 | Ga0495670_0253952 | Ga0495670_0253952_79_927 | 273 |
| 285 | 3300046692 | Ga0495671_0021731 | Ga0495671_0021731_829_1677 | 273 |
| 286 | 3300003771 | Ga0055526_1000523 | Ga0055526_100052313 | 274 |
| 287 | 3300005530 | Ga0070679_100172600 | Ga0070679_1001726003 | 274 |
| 288 | 3300005563 | Ga0068855_100119351 | Ga0068855_1001193513 | 274 |
| 289 | 3300006038 | Ga0075365_10032053 | Ga0075365_100320533 | 274 |
| 290 | 3300025292 | Ga0209676_1000301 | Ga0209676_100030138 | 274 |
| 291 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073123 | 274 |
| 292 | 3300025303 | Ga0209051_1000907 | Ga0209051_100090712 | 274 |
| 293 | 3300025304 | Ga0209257_1005066 | Ga0209257_10050663 | 274 |
| 294 | 3300025910 | Ga0207684_10031183 | Ga0207684_100311833 | 274 |
| 295 | 3300025913 | Ga0207695_10149060 | Ga0207695_101490601 | 274 |
| 296 | 3300025949 | Ga0207667_10187531 | Ga0207667_101875312 | 274 |
| 297 | 3300050492 | nmdc:mga0yw44_28977_c1 | nmdc:mga0yw44_28977_c1_1585_2460 | 274 |
| 298 | iso_pu_bacteria | 2898907183 | 2898908457 | 274 |
| 299 | 3300005530 | Ga0070679_100353557 | Ga0070679_1003535571 | 275 |
| 300 | 3300006195 | Ga0075366_10009650 | Ga0075366_100096502 | 275 |
| 301 | 3300025303 | Ga0209051_1000406 | Ga0209051_100040621 | 275 |
| 302 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012487 | 275 |
| 303 | 3300025909 | Ga0207705_10098846 | Ga0207705_100988461 | 275 |
| 304 | 3300025921 | Ga0207652_10038159 | Ga0207652_100381595 | 275 |
| 305 | iso_pu_bacteria | 2524023129 | 2524191762 | 275 |
| 306 | 3300005444 | Ga0070694_100271846 | Ga0070694_1002718462 | 276 |
| 307 | 3300009177 | Ga0105248_10687250 | Ga0105248_106872502 | 276 |
| 308 | 3300031235 | Ga0265330_10000076 | Ga0265330_1000007652 | 276 |
| 309 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002438 | 276 |
| 310 | 3300031247 | Ga0265340_10068309 | Ga0265340_100683092 | 276 |
| 311 | 3300031711 | Ga0265314_10000066 | Ga0265314_10000066104 | 276 |
| 312 | 3300042876 | Ga0451577_0374606 | Ga0451577_0374606_357_1193 | 276 |
| 313 | 3300049572 | Ga0501036_0428226 | Ga0501036_0428226_127_957 | 276 |
| 314 | 3300049577 | Ga0501041_0032932 | Ga0501041_0032932_1856_2686 | 276 |
| 315 | 3300049582 | Ga0501048_0344560 | Ga0501048_0344560_100_930 | 276 |
| 316 | 3300049588 | Ga0501072_0012997 | Ga0501072_0012997_1302_2132 | 276 |
| 317 | 3300049589 | Ga0501073_0228671 | Ga0501073_0228671_369_1199 | 276 |
| 318 | 3300049591 | Ga0501075_0040323 | Ga0501075_0040323_2502_3332 | 276 |
| 319 | 3300049592 | Ga0501076_0002950 | Ga0501076_0002950_3378_4208 | 276 |
| 320 | 3300049742 | Ga0501080_0059083 | Ga0501080_0059083_1406_2236 | 276 |
| 321 | 3300049824 | Ga0501045_0053078 | Ga0501045_0053078_716_1546 | 276 |
| 322 | 3300061734 | Ga0530510_0492143 | Ga0530510_0492143_76_906 | 276 |
| 323 | 3300006195 | Ga0075366_10079312 | Ga0075366_100793123 | 277 |
| 324 | 3300042876 | Ga0451577_0002542 | Ga0451577_0002542_17231_18100 | 278 |
| 325 | 3300044712 | Ga0453684_0144470 | Ga0453684_0144470_589_1458 | 278 |
| 326 | 3300048905 | Ga0496102_0187957 | Ga0496102_0187957_682_1518 | 278 |
| 327 | 3300014326 | Ga0157380_10460634 | Ga0157380_104606342 | 279 |
| 328 | 3300028558 | Ga0265326_10001112 | Ga0265326_100011122 | 279 |
| 329 | 3300028563 | Ga0265319_1000210 | Ga0265319_100021016 | 279 |
| 330 | 3300028577 | Ga0265318_10003116 | Ga0265318_100031162 | 279 |
| 331 | 3300028653 | Ga0265323_10000255 | Ga0265323_1000025516 | 279 |
| 332 | 3300028654 | Ga0265322_10000317 | Ga0265322_100003174 | 279 |
| 333 | 3300028800 | Ga0265338_10001141 | Ga0265338_1000114118 | 279 |
| 334 | 3300028800 | Ga0265338_10049198 | Ga0265338_100491982 | 279 |
| 335 | 3300029957 | Ga0265324_10000323 | Ga0265324_1000032318 | 279 |
| 336 | 3300031235 | Ga0265330_10000797 | Ga0265330_1000079716 | 279 |
| 337 | 3300031238 | Ga0265332_10002710 | Ga0265332_100027106 | 279 |
| 338 | 3300031239 | Ga0265328_10000914 | Ga0265328_1000091410 | 279 |
| 339 | 3300031240 | Ga0265320_10000569 | Ga0265320_1000056919 | 279 |
| 340 | 3300031241 | Ga0265325_10035809 | Ga0265325_100358093 | 279 |
| 341 | 3300031242 | Ga0265329_10000496 | Ga0265329_1000049616 | 279 |
| 342 | 3300031249 | Ga0265339_10000994 | Ga0265339_1000099411 | 279 |
| 343 | 3300031250 | Ga0265331_10008126 | Ga0265331_100081264 | 279 |
| 344 | 3300031344 | Ga0265316_10002027 | Ga0265316_100020274 | 279 |
| 345 | 3300031711 | Ga0265314_10000970 | Ga0265314_1000097024 | 279 |
| 346 | 3300031712 | Ga0265342_10001043 | Ga0265342_1000104318 | 279 |
| 347 | 3300061734 | Ga0530510_0063811 | Ga0530510_0063811_526_1365 | 279 |
| 348 | 3300003320 | rootH2_10030150 | rootH2_100301502 | 280 |
| 349 | 3300036401 | Ga0373937_0171768 | Ga0373937_0171768_873_1715 | 280 |
| 350 | 3300044712 | Ga0453684_0274292 | Ga0453684_0274292_461_1318 | 280 |
| 351 | iso_pu_bacteria | 2881927736 | 2881928382 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
91
291
0.87
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.869 | 17 | 269 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8633 | 16 | 265 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8564 | 16 | 268 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8507 | 16 | 265 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8432 | 15 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P16701_14_273_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8982 | 17 | 274 | 1.10.3720.10 |
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8904 | 18 | 275 | 1.10.3720.10 |
| af_P16701_14_273_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8887 | 17 | 274 | 1.10.3720.10 |
| af_P71745_27_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8883 | 18 | 272 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.887 | 54 | 272 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5LMD0-F1-model_v4 | Sulfate transport system permease protein CysT | 0.9377 | 54 | 274 |
GO:0005886
GO:0015419 |
| AF-A0A3L7PFA0-F1-model_v4 | Sulfate transport system permease protein CysT | 0.9359 | 21 | 275 |
GO:0005886
GO:0015419 |
| AF-A0A6P2BBW2-F1-model_v4 | Sulfate transport system permease protein CysT | 0.9331 | 52 | 275 |
GO:0005886
GO:0015419 |
| AF-A0A2A5K5L0-F1-model_v4 | deleted | 0.9315 | 37 | 278 |
|
| AF-A0A0J6LE06-F1-model_v4 | Sulfate transport system permease protein CysT | 0.9302 | 24 | 277 |
GO:0005886
GO:0015419 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar