F418611

General Info

Members Datasets Scaffolds Average Seq Length
351 223 702 205

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10014502|Ga0105250_100145022
Length 228
Sequence LTPTVRASSLISKVISLSEIPAQDFPMVNILVLYYSSYGHIERMATAQAEGAARVPGVSVAVKRVAELVPRDAAIAAGFRVDQAAPVANPAELENYDAVVFGTPTRFGNMAAQMRNFLDQTGPLWTRGALVGKVGSVFCSTASQHGGQETTITSFHTTLLHHGMIIVGLPYTFKDLATMREVTGGTPYGASCVTGSGAELRMPTALELEMCRYQGEHVGRITSRLVSH

Samples

Sample ID Description Type Environment
1 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
146 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
223 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.57
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 6.55
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105250_10014502 3300009092 Bacteria 3237
2 Ga0070676_10038325 3300005328 Bacteria 2768
3 Ga0070666_10010456 3300005335 Bacteria 5807
4 Ga0070666_10174994 3300005335 Bacteria 1504
5 Ga0070680_100053167 3300005336 Bacteria 3305
6 Ga0070680_100365373 3300005336 Bacteria 1228
7 Ga0068868_100061560 3300005338 Bacteria 2973
8 Ga0070675_100150739 3300005354 Bacteria 1994
9 Ga0070671_100004919 3300005355 Bacteria 10640
10 Ga0070671_100061938 3300005355 Bacteria 3115
11 Ga0070674_100101533 3300005356 Bacteria 2097
12 Ga0070674_100415911 3300005356 Bacteria 1102
13 Ga0070673_100928349 3300005364 Bacteria 808
14 Ga0070667_100043305 3300005367 Bacteria 3778
15 Ga0070709_10720366 3300005434 Bacteria 778
16 Ga0070714_100177278 3300005435 Bacteria 1937
17 Ga0070714_100962009 3300005435 Bacteria 830
18 Ga0070713_100028470 3300005436 Bacteria 4412
19 Ga0070713_100682807 3300005436 Bacteria 980
20 Ga0070711_100003677 3300005439 Bacteria 8977
21 Ga0070711_100046778 3300005439 Bacteria 2950
22 Ga0070711_100620040 3300005439 Bacteria 904
23 Ga0070711_100696769 3300005439 Bacteria 855
24 Ga0070700_100082687 3300005441 Bacteria 2077
25 Ga0070694_100795522 3300005444 Bacteria 775
26 Ga0070678_100151070 3300005456 Bacteria 1871
27 Ga0070662_100032743 3300005457 Bacteria 3654
28 Ga0070681_10014573 3300005458 Bacteria 7824
29 Ga0070681_10169531 3300005458 Bacteria 2105
30 Ga0068867_100051551 3300005459 Bacteria 3035
31 Ga0068867_100499820 3300005459 Bacteria 1045
32 Ga0070685_10273282 3300005466 Bacteria 1128
33 Ga0070699_100158329 3300005518 Bacteria 2004
34 Ga0070679_100381989 3300005530 Bacteria 1355
35 Ga0070679_101047454 3300005530 Bacteria 760
36 Ga0070672_100014808 3300005543 Bacteria 5534
37 Ga0070695_100004700 3300005545 Bacteria 8034
38 Ga0070696_100221436 3300005546 Bacteria 1420
39 Ga0070665_100075986 3300005548 Bacteria 3366
40 Ga0068855_100123922 3300005563 Bacteria 2956
41 Ga0068856_100029343 3300005614 Bacteria 5373
42 Ga0068859_100000397 3300005617 Bacteria 43279
43 Ga0068866_10151686 3300005718 Bacteria 1343
44 Ga0068866_10206525 3300005718 Bacteria 1176
45 Ga0068861_100029803 3300005719 Bacteria 3994
46 Ga0068870_10440191 3300005840 Bacteria 857
47 Ga0068870_10467443 3300005840 Bacteria 834
48 Ga0068863_100010017 3300005841 Bacteria 9224
49 Ga0068863_100034413 3300005841 Bacteria 4826
50 Ga0068858_100008826 3300005842 Bacteria 9667
51 Ga0068858_100081559 3300005842 Bacteria 3006
52 Ga0068860_100005560 3300005843 Bacteria 12743
53 Ga0068860_100691091 3300005843 Bacteria 1030
54 Ga0068862_100028150 3300005844 Bacteria 4731
55 Ga0070715_10018815 3300006163 Bacteria 2639
56 Ga0070715_10092575 3300006163 Bacteria 1394
57 Ga0070716_100010170 3300006173 Bacteria 4712
58 Ga0070716_100035319 3300006173 Bacteria 2748
59 Ga0070716_100206216 3300006173 Bacteria 1310
60 Ga0070712_100013084 3300006175 Bacteria 5292
61 Ga0070712_100014416 3300006175 Bacteria 5073
62 Ga0070712_100065510 3300006175 Bacteria 2579
63 Ga0070712_100208068 3300006175 Bacteria 1541
64 Ga0070712_100331431 3300006175 Bacteria 1240
65 Ga0068871_100293040 3300006358 Bacteria 1426
66 Ga0075428_100007405 3300006844 Bacteria 12167
67 Ga0075428_100053083 3300006844 Bacteria 4441
68 Ga0075428_100199078 3300006844 Bacteria 2166
69 Ga0075431_100038686 3300006847 Bacteria 4913
70 Ga0075434_100900797 3300006871 Bacteria 899
71 Ga0075429_100135836 3300006880 Bacteria 2152
72 Ga0068865_100014931 3300006881 Bacteria 4945
73 Ga0068865_100459168 3300006881 Bacteria 1055
74 Ga0097620_100000397 3300006931 Bacteria 43279
75 Ga0105240_10024049 3300009093 Bacteria 8045
76 Ga0105240_10037202 3300009093 Bacteria 6256
77 Ga0111539_10179453 3300009094 Bacteria 2474
78 Ga0111539_10318796 3300009094 Bacteria 1809
79 Ga0105247_10000862 3300009101 Bacteria 22978
80 Ga0114129_10422156 3300009147 Bacteria 1754
81 Ga0105241_10018123 3300009174 Bacteria 5178
82 Ga0105242_10012554 3300009176 Bacteria 6522
83 Ga0105248_10017456 3300009177 Bacteria 7914
84 Ga0105237_10273491 3300009545 Bacteria 1692
85 Ga0105238_10221277 3300009551 Bacteria 1869
86 Ga0105249_10004306 3300009553 Bacteria 12304
87 Ga0105249_10879480 3300009553 Bacteria 962
88 Ga0105239_10295521 3300010375 Bacteria 1824
89 Ga0157369_10046790 3300013105 Bacteria 4701
90 Ga0157369_10077910 3300013105 Bacteria 3552
91 Ga0157369_10187077 3300013105 Bacteria 2177
92 Ga0157369_10661277 3300013105 Bacteria 1077
93 Ga0157374_10012538 3300013296 Bacteria 7377
94 Ga0157378_10733696 3300013297 Bacteria 1009
95 Ga0163162_10039070 3300013306 Bacteria 4739
96 Ga0163162_10124354 3300013306 Bacteria 2685
97 Ga0157372_10302956 3300013307 Bacteria 1859
98 Ga0163163_10089894 3300014325 Bacteria 3084
99 Ga0157380_10091738 3300014326 Bacteria 2508
100 Ga0157380_10224834 3300014326 Bacteria 1682
101 Ga0157377_10172263 3300014745 Bacteria 1355
102 Ga0157379_10015789 3300014968 Bacteria 6635
103 Ga0157379_10485805 3300014968 Bacteria 1143
104 Ga0157379_10656795 3300014968 Bacteria 982
105 Ga0157379_10847890 3300014968 Bacteria 864
106 Ga0157376_10857333 3300014969 Bacteria 924
107 Ga0207696_1060906 3300025711 Bacteria 1062
108 Ga0207642_10008135 3300025899 Bacteria 3582
109 Ga0207710_10000486 3300025900 Bacteria 25127
110 Ga0207680_10159940 3300025903 Bacteria 1509
111 Ga0207685_10193178 3300025905 Bacteria 951
112 Ga0207699_10007805 3300025906 Bacteria 5244
113 Ga0207699_10105214 3300025906 Bacteria 1799
114 Ga0207643_10012405 3300025908 Bacteria 4606
115 Ga0207643_10450180 3300025908 Bacteria 819
116 Ga0207707_10141236 3300025912 Bacteria 2106
117 Ga0207695_10014480 3300025913 Bacteria 9336
118 Ga0207671_10135446 3300025914 Bacteria 1893
119 Ga0207693_10000337 3300025915 Bacteria 43205
120 Ga0207693_10090165 3300025915 Bacteria 2403
121 Ga0207693_10225217 3300025915 Bacteria 1473
122 Ga0207660_10369169 3300025917 Bacteria 1152
123 Ga0207660_10574896 3300025917 Bacteria 917
124 Ga0207681_10200655 3300025923 Bacteria 1531
125 Ga0207687_10133773 3300025927 Bacteria 1873
126 Ga0207700_10040112 3300025928 Bacteria 3414
127 Ga0207700_10270502 3300025928 Bacteria 1458
128 Ga0207664_10156020 3300025929 Bacteria 1943
129 Ga0207664_10176778 3300025929 Bacteria 1831
130 Ga0207664_10422092 3300025929 Bacteria 1188
131 Ga0207664_10450017 3300025929 Bacteria 1149
132 Ga0207644_10003191 3300025931 Bacteria 10561
133 Ga0207706_10017577 3300025933 Bacteria 6444
134 Ga0207686_10010509 3300025934 Bacteria 5043
135 Ga0207669_10254079 3300025937 Bacteria 1310
136 Ga0207669_10387348 3300025937 Bacteria 1091
137 Ga0207704_10097867 3300025938 Bacteria 1947
138 Ga0207665_10044991 3300025939 Bacteria 2955
139 Ga0207665_10152927 3300025939 Bacteria 1654
140 Ga0207665_10247516 3300025939 Bacteria 1316
141 Ga0207691_10000550 3300025940 Bacteria 37583
142 Ga0207711_10441256 3300025941 Bacteria 1211
143 Ga0207661_10992938 3300025944 Bacteria 773
144 Ga0207667_10047839 3300025949 Bacteria 4525
145 Ga0207651_10230652 3300025960 Bacteria 1503
146 Ga0207712_10100594 3300025961 Bacteria 2148
147 Ga0207668_10826463 3300025972 Bacteria 821
148 Ga0207658_10027582 3300025986 Bacteria 3991
149 Ga0207677_10097992 3300026023 Bacteria 2150
150 Ga0207703_10001935 3300026035 Bacteria 18340
151 Ga0207703_10545181 3300026035 Bacteria 1093
152 Ga0207708_10104474 3300026075 Bacteria 2195
153 Ga0207702_10802912 3300026078 Bacteria 930
154 Ga0207641_10012552 3300026088 Bacteria 6944
155 Ga0207648_10014974 3300026089 Bacteria 7144
156 Ga0207675_100069070 3300026118 Bacteria 3302
157 Ga0207683_10027743 3300026121 Bacteria 4892
158 Ga0209969_1003342 3300027360 Bacteria 2217
159 Ga0209984_1004158 3300027424 Bacteria 1693
160 Ga0210002_1012440 3300027617 Bacteria 1322
161 Ga0209983_1001397 3300027665 Bacteria 5376
162 Ga0209971_1000541 3300027682 Bacteria 9917
163 Ga0209966_1043092 3300027695 Bacteria 945
164 Ga0209998_10000505 3300027717 Bacteria 10679
165 Ga0209974_10005832 3300027876 Bacteria 4318
166 Ga0207428_10046013 3300027907 Bacteria 3511
167 Ga0268266_10037911 3300028379 Bacteria 4104
168 Ga0268266_10614674 3300028379 Bacteria 1044
169 Ga0268265_10100922 3300028380 Bacteria 2331
170 Ga0268265_10237975 3300028380 Bacteria 1604
171 Ga0268264_10005698 3300028381 Bacteria 10558
172 Ga0268264_10068703 3300028381 Bacteria 2995
173 Ga0307515_10518085 3300028794 Bacteria 802
174 Ga0265338_10385930 3300028800 Bacteria 1001
175 Ga0265762_1015873 3300030760 Bacteria 1364
176 Ga0265760_10010397 3300031090 Unclassified 2657
177 Ga0265320_10107581 3300031240 Bacteria 1280
178 Ga0265340_10273471 3300031247 Bacteria 751
179 Ga0307513_10076914 3300031456 Bacteria 3459
180 Ga0265313_10024673 3300031595 Bacteria 3207
181 Ga0316575_10165302 3300031665 Bacteria 916
182 Ga0373934_0001960 3300035086 Bacteria 7542
183 Ga0373923_0239598 3300035111 Bacteria 847
184 Ga0373953_0008128 3300035117 Bacteria 3551
185 Ga0373954_0002683 3300035118 Bacteria 7488
186 Ga0373954_0225719 3300035118 Bacteria 922
187 Ga0373956_0000917 3300035119 Bacteria 12214
188 Ga0373957_0174759 3300035120 Bacteria 889
189 Ga0373946_0071443 3300035171 Bacteria 1500
190 Ga0373955_0000298 3300035172 Bacteria 20499
191 Ga0373955_0201721 3300035172 Bacteria 1184
192 Ga0373955_0229718 3300035172 Bacteria 1110
193 Ga0373955_0395844 3300035172 Bacteria 839
194 Ga0373935_0045006 3300035692 Bacteria 2784
195 Ga0373935_0512408 3300035692 Bacteria 872
196 Ga0373933_0000779 3300035724 Bacteria 19428
197 Ga0373933_0132413 3300035724 Bacteria 1569
198 Ga0373933_0140459 3300035724 Bacteria 1525
199 Ga0373933_0212556 3300035724 Bacteria 1240
200 Ga0373947_0121278 3300035725 Bacteria 1661
201 Ga0373937_0000527 3300036401 Bacteria 34172
202 Ga0373937_0002536 3300036401 Bacteria 15171
203 Ga0373937_0135934 3300036401 Bacteria 2299
204 Ga0373937_0973550 3300036401 Bacteria 797
205 Ga0395900_0308067 3300037418 Bacteria 1568
206 Ga0395900_0979832 3300037418 Bacteria 766
207 Ga0395898_0028676 3300037466 Bacteria 5578
208 Ga0395898_0072249 3300037466 Bacteria 3333
209 Ga0395898_1006682 3300037466 Bacteria 769
210 Ga0395901_0370364 3300038443 Bacteria 1476
211 Ga0400489_09665 3300039093 Unclassified 1270
212 Ga0400489_14542 3300039093 Bacteria 67753
213 Ga0436363_1715599 3300039450 Bacteria 1350
214 Ga0451798_0959613 3300041458 Bacteria 639
215 Ga0450896_011940 3300042133 Bacteria 1226
216 Ga0439435_0016078 3300042436 Bacteria 1871
217 Ga0451577_0000188 3300042876 Bacteria 131320
218 Ga0451577_0002426 3300042876 Bacteria 22222
219 Ga0451577_0039629 3300042876 Bacteria 4233
220 Ga0451577_0060578 3300042876 Bacteria 3374
221 Ga0451577_0133065 3300042876 Bacteria 2232
222 Ga0451577_0503285 3300042876 Bacteria 1100
223 Ga0466969_0201512 3300044656 Bacteria 908
224 Ga0466966_0491470 3300044684 Bacteria 738
225 Ga0453684_0000612 3300044712 Bacteria 131319
226 Ga0453684_0004575 3300044712 Bacteria 28876
227 Ga0453684_0119572 3300044712 Bacteria 3184
228 Ga0453684_0399414 3300044712 Bacteria 1540
229 Ga0453684_0628598 3300044712 Bacteria 1174
230 Ga0453684_0640698 3300044712 Bacteria 1161
231 Ga0466971_0211508 3300044719 Bacteria 917
232 Ga0466959_0064657 3300045049 Bacteria 2656
233 Ga0466959_0116544 3300045049 Bacteria 1902
234 Ga0451576_0043362 3300045051 Bacteria 4747
235 Ga0451576_0062279 3300045051 Bacteria 3889
236 Ga0451576_1280618 3300045051 Bacteria 764
237 Ga0495592_0167462 3300046454 Bacteria 1507
238 Ga0495638_0007350 3300046460 Bacteria 7907
239 Ga0495651_0047862 3300046462 Bacteria 3304
240 Ga0495580_0000023 3300046472 Bacteria 88848
241 Ga0495580_0068257 3300046472 Bacteria 2486
242 Ga0495582_0200681 3300046473 Bacteria 1139
243 Ga0495608_0057705 3300046511 Bacteria 2561
244 Ga0495618_0310466 3300046514 Bacteria 978
245 Ga0495628_0140010 3300046516 Bacteria 1846
246 Ga0495643_0183997 3300046522 Bacteria 1013
247 Ga0495587_0000291 3300046536 Bacteria 35547
248 Ga0495587_0253877 3300046536 Bacteria 988
249 Ga0495667_0210475 3300046559 Bacteria 1243
250 Ga0495667_0477318 3300046559 Bacteria 782
251 Ga0495657_0078295 3300046675 Bacteria 2143
252 Ga0495658_0016451 3300046683 Bacteria 3807
253 Ga0495604_0000957 3300047317 Bacteria 24095
254 Ga0495604_0175992 3300047317 Bacteria 1500
255 Ga0495674_0609676 3300047319 Bacteria 864
256 Ga0495680_0089217 3300047322 Bacteria 2315
257 Ga0495675_0103026 3300047444 Bacteria 1785
258 Ga0495684_0020327 3300047471 Bacteria 5115
259 Ga0495602_0024328 3300048088 Bacteria 5877
260 Ga0495602_0077733 3300048088 Bacteria 2806
261 Ga0496100_0104198 3300048903 Bacteria 1960
262 Ga0496100_0473633 3300048903 Bacteria 962
263 Ga0496101_0447192 3300048904 Bacteria 1019
264 Ga0496101_0951227 3300048904 Bacteria 676
265 Ga0496101_0962343 3300048904 Bacteria 672
266 Ga0496102_0015018 3300048905 Bacteria 6740
267 Ga0496102_0300283 3300048905 Bacteria 1513
268 Ga0496104_0014813 3300048907 Bacteria 7047
269 Ga0496104_0147227 3300048907 Bacteria 2261
270 Ga0496105_0001241 3300048908 Bacteria 17800
271 Ga0496105_0029031 3300048908 Bacteria 4526
272 Ga0496106_0067567 3300048909 Bacteria 2725
273 Ga0496107_0296597 3300048910 Bacteria 1203
274 Ga0496107_0596008 3300048910 Bacteria 817
275 Ga0496108_0207483 3300048911 Bacteria 1700
276 Ga0496109_0158467 3300048912 Bacteria 2120
277 Ga0496111_0090931 3300048914 Bacteria 2236
278 Ga0496112_0118465 3300048915 Bacteria 2618
279 Ga0496114_0016316 3300048917 Bacteria 5981
280 Ga0496114_0040528 3300048917 Bacteria 3856
281 Ga0496115_0021584 3300048918 Bacteria 4975
282 Ga0496115_0717110 3300048918 Bacteria 785
283 Ga0496118_0039829 3300048921 Bacteria 3744
284 Ga0496121_0001371 3300048924 Bacteria 41462
285 Ga0496125_0162523 3300048928 Bacteria 1514
286 Ga0496126_0355553 3300048929 Bacteria 1197
287 Ga0501036_0069263 3300049572 Bacteria 2985
288 Ga0501036_0132250 3300049572 Bacteria 2106
289 Ga0501039_0007127 3300049575 Bacteria 8519
290 Ga0501039_0033608 3300049575 Bacteria 3955
291 Ga0501039_0119023 3300049575 Bacteria 2069
292 Ga0501040_0022367 3300049576 Bacteria 4230
293 Ga0501040_0086656 3300049576 Bacteria 2174
294 Ga0501041_0001457 3300049577 Bacteria 13089
295 Ga0501041_0020597 3300049577 Bacteria 3944
296 Ga0501042_0000587 3300049578 Bacteria 19294
297 Ga0501042_0037157 3300049578 Bacteria 3456
298 Ga0501042_0085344 3300049578 Bacteria 2264
299 Ga0501046_0005210 3300049580 Bacteria 11630
300 Ga0501046_0044646 3300049580 Bacteria 3524
301 Ga0501046_0638431 3300049580 Bacteria 753
302 Ga0501048_0010058 3300049582 Bacteria 7077
303 Ga0501048_0035889 3300049582 Bacteria 3566
304 Ga0501068_0012807 3300049584 Bacteria 4762
305 Ga0501070_0384745 3300049586 Bacteria 1136
306 Ga0501070_0683265 3300049586 Bacteria 813
307 Ga0501071_0000011 3300049587 Bacteria 63363
308 Ga0501071_0019286 3300049587 Bacteria 4732
309 Ga0501072_0003926 3300049588 Bacteria 11254
310 Ga0501072_0396003 3300049588 Bacteria 1095
311 Ga0501073_0145582 3300049589 Bacteria 1642
312 Ga0501074_0010689 3300049590 Bacteria 6664
313 Ga0501074_0022335 3300049590 Bacteria 4596
314 Ga0501075_0000086 3300049591 Bacteria 42180
315 Ga0501075_0007843 3300049591 Bacteria 7412
316 Ga0501076_0003276 3300049592 Bacteria 11340
317 Ga0501076_0039919 3300049592 Bacteria 3686
318 Ga0501077_0004003 3300049593 Bacteria 8892
319 Ga0501079_0020181 3300049741 Bacteria 5093
320 Ga0501079_0183215 3300049741 Bacteria 1634
321 Ga0501079_0334341 3300049741 Bacteria 1186
322 Ga0501079_0391672 3300049741 Bacteria 1090
323 Ga0501080_0069073 3300049742 Bacteria 3286
324 Ga0501080_0074595 3300049742 Bacteria 3155
325 Ga0501081_0011416 3300049743 Bacteria 5811
326 Ga0501081_0081542 3300049743 Bacteria 2266
327 Ga0501081_0119304 3300049743 Bacteria 1877
328 Ga0501083_0033658 3300049744 Bacteria 3508
329 Ga0501035_0217805 3300049822 Bacteria 1631
330 Ga0501035_0298476 3300049822 Bacteria 1358
331 Ga0501035_0366256 3300049822 Bacteria 1204
332 Ga0501044_0139033 3300049823 Bacteria 2418
333 Ga0501044_0679564 3300049823 Bacteria 916
334 Ga0501044_0791145 3300049823 Bacteria 828
335 Ga0501045_0000055 3300049824 Bacteria 51250
336 Ga0501045_0086102 3300049824 Bacteria 2319
337 Ga0501045_0238018 3300049824 Bacteria 1355
338 nmdc:mga05p37_311276_c1 3300050507 Bacteria 1866
339 nmdc:mga06r32_29123_c1 3300050510 Bacteria 5173
340 nmdc:mga08y16_221087_c1 3300050511 Bacteria 1961
341 Ga0495612_0150836 3300053078 Bacteria 1011
342 Ga0500616_0179024 3300053153 Bacteria 956
343 Ga0501084_0010909 3300054114 Bacteria 7525
344 Ga0501084_0027853 3300054114 Bacteria 4722
345 Ga0501082_0000298 3300060353 Bacteria 43791
346 Ga0501082_0144019 3300060353 Bacteria 2068
347 Ga0501082_0163069 3300060353 Bacteria 1937
348 Ga0530510_0000228 3300061734 Bacteria 35067
349 Ga0530510_0021638 3300061734 Bacteria 4575
350 2837683274 2837678835 Bacteria 5252418
351 2937846201 2937843397 Bacteria 5256375
352 Ga0105250_10014502
353 Ga0070676_10038325
354 Ga0070666_10010456
355 Ga0070666_10174994
356 Ga0070680_100053167
357 Ga0070680_100365373
358 Ga0068868_100061560
359 Ga0070675_100150739
360 Ga0070671_100004919
361 Ga0070671_100061938
362 Ga0070674_100101533
363 Ga0070674_100415911
364 Ga0070673_100928349
365 Ga0070667_100043305
366 Ga0070709_10720366
367 Ga0070714_100177278
368 Ga0070714_100962009
369 Ga0070713_100028470
370 Ga0070713_100682807
371 Ga0070711_100003677
372 Ga0070711_100046778
373 Ga0070711_100620040
374 Ga0070711_100696769
375 Ga0070700_100082687
376 Ga0070694_100795522
377 Ga0070678_100151070
378 Ga0070662_100032743
379 Ga0070681_10014573
380 Ga0070681_10169531
381 Ga0068867_100051551
382 Ga0068867_100499820
383 Ga0070685_10273282
384 Ga0070699_100158329
385 Ga0070679_100381989
386 Ga0070679_101047454
387 Ga0070672_100014808
388 Ga0070695_100004700
389 Ga0070696_100221436
390 Ga0070665_100075986
391 Ga0068855_100123922
392 Ga0068856_100029343
393 Ga0068859_100000397
394 Ga0068866_10151686
395 Ga0068866_10206525
396 Ga0068861_100029803
397 Ga0068870_10440191
398 Ga0068870_10467443
399 Ga0068863_100010017
400 Ga0068863_100034413
401 Ga0068858_100008826
402 Ga0068858_100081559
403 Ga0068860_100005560
404 Ga0068860_100691091
405 Ga0068862_100028150
406 Ga0070715_10018815
407 Ga0070715_10092575
408 Ga0070716_100010170
409 Ga0070716_100035319
410 Ga0070716_100206216
411 Ga0070712_100013084
412 Ga0070712_100014416
413 Ga0070712_100065510
414 Ga0070712_100208068
415 Ga0070712_100331431
416 Ga0068871_100293040
417 Ga0075428_100007405
418 Ga0075428_100053083
419 Ga0075428_100199078
420 Ga0075431_100038686
421 Ga0075434_100900797
422 Ga0075429_100135836
423 Ga0068865_100014931
424 Ga0068865_100459168
425 Ga0097620_100000397
426 Ga0105240_10024049
427 Ga0105240_10037202
428 Ga0111539_10179453
429 Ga0111539_10318796
430 Ga0105247_10000862
431 Ga0114129_10422156
432 Ga0105241_10018123
433 Ga0105242_10012554
434 Ga0105248_10017456
435 Ga0105237_10273491
436 Ga0105238_10221277
437 Ga0105249_10004306
438 Ga0105249_10879480
439 Ga0105239_10295521
440 Ga0157369_10046790
441 Ga0157369_10077910
442 Ga0157369_10187077
443 Ga0157369_10661277
444 Ga0157374_10012538
445 Ga0157378_10733696
446 Ga0163162_10039070
447 Ga0163162_10124354
448 Ga0157372_10302956
449 Ga0163163_10089894
450 Ga0157380_10091738
451 Ga0157380_10224834
452 Ga0157377_10172263
453 Ga0157379_10015789
454 Ga0157379_10485805
455 Ga0157379_10656795
456 Ga0157379_10847890
457 Ga0157376_10857333
458 Ga0207696_1060906
459 Ga0207642_10008135
460 Ga0207710_10000486
461 Ga0207680_10159940
462 Ga0207685_10193178
463 Ga0207699_10007805
464 Ga0207699_10105214
465 Ga0207643_10012405
466 Ga0207643_10450180
467 Ga0207707_10141236
468 Ga0207695_10014480
469 Ga0207671_10135446
470 Ga0207693_10000337
471 Ga0207693_10090165
472 Ga0207693_10225217
473 Ga0207660_10369169
474 Ga0207660_10574896
475 Ga0207681_10200655
476 Ga0207687_10133773
477 Ga0207700_10040112
478 Ga0207700_10270502
479 Ga0207664_10156020
480 Ga0207664_10176778
481 Ga0207664_10422092
482 Ga0207664_10450017
483 Ga0207644_10003191
484 Ga0207706_10017577
485 Ga0207686_10010509
486 Ga0207669_10254079
487 Ga0207669_10387348
488 Ga0207704_10097867
489 Ga0207665_10044991
490 Ga0207665_10152927
491 Ga0207665_10247516
492 Ga0207691_10000550
493 Ga0207711_10441256
494 Ga0207661_10992938
495 Ga0207667_10047839
496 Ga0207651_10230652
497 Ga0207712_10100594
498 Ga0207668_10826463
499 Ga0207658_10027582
500 Ga0207677_10097992
501 Ga0207703_10001935
502 Ga0207703_10545181
503 Ga0207708_10104474
504 Ga0207702_10802912
505 Ga0207641_10012552
506 Ga0207648_10014974
507 Ga0207675_100069070
508 Ga0207683_10027743
509 Ga0209969_1003342
510 Ga0209984_1004158
511 Ga0210002_1012440
512 Ga0209983_1001397
513 Ga0209971_1000541
514 Ga0209966_1043092
515 Ga0209998_10000505
516 Ga0209974_10005832
517 Ga0207428_10046013
518 Ga0268266_10037911
519 Ga0268266_10614674
520 Ga0268265_10100922
521 Ga0268265_10237975
522 Ga0268264_10005698
523 Ga0268264_10068703
524 Ga0307515_10518085
525 Ga0265338_10385930
526 Ga0265762_1015873
527 Ga0265760_10010397
528 Ga0265320_10107581
529 Ga0265340_10273471
530 Ga0307513_10076914
531 Ga0265313_10024673
532 Ga0316575_10165302
533 Ga0373934_0001960
534 Ga0373923_0239598
535 Ga0373953_0008128
536 Ga0373954_0002683
537 Ga0373954_0225719
538 Ga0373956_0000917
539 Ga0373957_0174759
540 Ga0373946_0071443
541 Ga0373955_0000298
542 Ga0373955_0201721
543 Ga0373955_0229718
544 Ga0373955_0395844
545 Ga0373935_0045006
546 Ga0373935_0512408
547 Ga0373933_0000779
548 Ga0373933_0132413
549 Ga0373933_0140459
550 Ga0373933_0212556
551 Ga0373947_0121278
552 Ga0373937_0000527
553 Ga0373937_0002536
554 Ga0373937_0135934
555 Ga0373937_0973550
556 Ga0395900_0308067
557 Ga0395900_0979832
558 Ga0395898_0028676
559 Ga0395898_0072249
560 Ga0395898_1006682
561 Ga0395901_0370364
562 Ga0400489_09665
563 Ga0400489_14542
564 Ga0436363_1715599
565 Ga0451798_0959613
566 Ga0450896_011940
567 Ga0439435_0016078
568 Ga0451577_0000188
569 Ga0451577_0002426
570 Ga0451577_0039629
571 Ga0451577_0060578
572 Ga0451577_0133065
573 Ga0451577_0503285
574 Ga0466969_0201512
575 Ga0466966_0491470
576 Ga0453684_0000612
577 Ga0453684_0004575
578 Ga0453684_0119572
579 Ga0453684_0399414
580 Ga0453684_0628598
581 Ga0453684_0640698
582 Ga0466971_0211508
583 Ga0466959_0064657
584 Ga0466959_0116544
585 Ga0451576_0043362
586 Ga0451576_0062279
587 Ga0451576_1280618
588 Ga0495592_0167462
589 Ga0495638_0007350
590 Ga0495651_0047862
591 Ga0495580_0000023
592 Ga0495580_0068257
593 Ga0495582_0200681
594 Ga0495608_0057705
595 Ga0495618_0310466
596 Ga0495628_0140010
597 Ga0495643_0183997
598 Ga0495587_0000291
599 Ga0495587_0253877
600 Ga0495667_0210475
601 Ga0495667_0477318
602 Ga0495657_0078295
603 Ga0495658_0016451
604 Ga0495604_0000957
605 Ga0495604_0175992
606 Ga0495674_0609676
607 Ga0495680_0089217
608 Ga0495675_0103026
609 Ga0495684_0020327
610 Ga0495602_0024328
611 Ga0495602_0077733
612 Ga0496100_0104198
613 Ga0496100_0473633
614 Ga0496101_0447192
615 Ga0496101_0951227
616 Ga0496101_0962343
617 Ga0496102_0015018
618 Ga0496102_0300283
619 Ga0496104_0014813
620 Ga0496104_0147227
621 Ga0496105_0001241
622 Ga0496105_0029031
623 Ga0496106_0067567
624 Ga0496107_0296597
625 Ga0496107_0596008
626 Ga0496108_0207483
627 Ga0496109_0158467
628 Ga0496111_0090931
629 Ga0496112_0118465
630 Ga0496114_0016316
631 Ga0496114_0040528
632 Ga0496115_0021584
633 Ga0496115_0717110
634 Ga0496118_0039829
635 Ga0496121_0001371
636 Ga0496125_0162523
637 Ga0496126_0355553
638 Ga0501036_0069263
639 Ga0501036_0132250
640 Ga0501039_0007127
641 Ga0501039_0033608
642 Ga0501039_0119023
643 Ga0501040_0022367
644 Ga0501040_0086656
645 Ga0501041_0001457
646 Ga0501041_0020597
647 Ga0501042_0000587
648 Ga0501042_0037157
649 Ga0501042_0085344
650 Ga0501046_0005210
651 Ga0501046_0044646
652 Ga0501046_0638431
653 Ga0501048_0010058
654 Ga0501048_0035889
655 Ga0501068_0012807
656 Ga0501070_0384745
657 Ga0501070_0683265
658 Ga0501071_0000011
659 Ga0501071_0019286
660 Ga0501072_0003926
661 Ga0501072_0396003
662 Ga0501073_0145582
663 Ga0501074_0010689
664 Ga0501074_0022335
665 Ga0501075_0000086
666 Ga0501075_0007843
667 Ga0501076_0003276
668 Ga0501076_0039919
669 Ga0501077_0004003
670 Ga0501079_0020181
671 Ga0501079_0183215
672 Ga0501079_0334341
673 Ga0501079_0391672
674 Ga0501080_0069073
675 Ga0501080_0074595
676 Ga0501081_0011416
677 Ga0501081_0081542
678 Ga0501081_0119304
679 Ga0501083_0033658
680 Ga0501035_0217805
681 Ga0501035_0298476
682 Ga0501035_0366256
683 Ga0501044_0139033
684 Ga0501044_0679564
685 Ga0501044_0791145
686 Ga0501045_0000055
687 Ga0501045_0086102
688 Ga0501045_0238018
689 nmdc:mga05p37_311276_c1
690 nmdc:mga06r32_29123_c1
691 nmdc:mga08y16_221087_c1
692 Ga0495612_0150836
693 Ga0500616_0179024
694 Ga0501084_0010909
695 Ga0501084_0027853
696 Ga0501082_0000298
697 Ga0501082_0144019
698 Ga0501082_0163069
699 Ga0530510_0000228
700 Ga0530510_0021638
701 2837683274
702 2937846201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00258

Flavodoxin_1

Flavodoxin

32

163

0.9

PF03358

FMN_red

NADPH-dependent FMN reductase

28

177

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zho-assembly1.cif.gz_B-2 x-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution 0.9787 3 201
4dy4-assembly1.cif.gz_C-2 high resolution structure of e.coli wrba with fmn 0.9739 3 201
7q6o-assembly1.cif.gz_B-2 structure of wrba from yersinia pseudotuberculosis in c2221 0.9736 1 200
2rg1-assembly1.cif.gz_A-2 crystal structure of e. coli wrba apoprotein 0.9723 3 200
7q6o-assembly1.cif.gz_B-2 structure of wrba from yersinia pseudotuberculosis in c2221 0.9684 1 200
ID Description Score Start End Superfamily
3zhoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9787 3 201 3.40.50.360
3zhoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9679 3 201 3.40.50.360
af_K7MW35_1_136_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9419 12 148 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9354 1 198 3.40.50.360
af_K7MW35_1_136_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.922 12 148 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A162AC88-F1-model_v4 Flavodoxin-like domain-containing protein 0.9997 1 115 GO:0003955
GO:0010181
GO:0016020
AF-T1CAN3-F1-model_v4 TrpR binding protein WrbA 0.9985 1 112 GO:0003955
GO:0010181
GO:0016020
AF-A0A379YF25-F1-model_v4 Flavoprotein WrbA 0.9949 1 113 GO:0003955
GO:0010181
GO:0016020
AF-A0A2J4V8K3-F1-model_v4 deleted 0.9861 1 139
AF-A0A0A6ZPX9-F1-model_v4 Flavoprotein WrbA 0.9822 1 136 GO:0003955
GO:0010181
GO:0016020

Map