F418604

General Info

Members Datasets Scaffolds Average Seq Length
351 192 351 202

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100001832|Ga0075435_1000018327
Length 234
Sequence MDTLRRLTGHSGETYVTYLAVQTSSDEPIERTTQMRKLIVSTFLTLDGVMQAPGGPGEDDEGGFEYGGWSVNYWDDRMGQVMAEATSRPFAMVLGRKTYDIMAAHWPHASEEEGATVFNEATKYVASRSRPALEWSNSVLIERDAADGLAALKKEDGPELQVHGSANLIQTLLRHNLVDEYRLWVFPVVIGSGKRLFSDGTIPAGLRLVNSTVSTTGVVIGTYEPAGEIVTGSF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
131 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
180 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
181 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.42
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011940 3300003203 Bacteria 3790
2 JGI25407J50210_10035000 3300003373 Bacteria 1294
3 JGI25405J52794_10053470 3300003911 Bacteria 868
4 Ga0070683_101053304 3300005329 Unclassified 781
5 Ga0070682_100240977 3300005337 Bacteria 1298
6 Ga0070682_100568867 3300005337 Bacteria 890
7 Ga0068868_100373204 3300005338 Bacteria 1226
8 Ga0070660_100163376 3300005339 Bacteria 1795
9 Ga0070691_10070347 3300005341 Bacteria 1697
10 Ga0070691_10112486 3300005341 Bacteria 1363
11 Ga0070661_100185464 3300005344 Bacteria 1585
12 Ga0070675_100020488 3300005354 Bacteria 5276
13 Ga0070674_100061776 3300005356 Bacteria 2616
14 Ga0070674_100067207 3300005356 Bacteria 2520
15 Ga0070673_100148551 3300005364 Unclassified 1983
16 Ga0070688_100005437 3300005365 Bacteria 6708
17 Ga0070703_10000008 3300005406 Bacteria 97684
18 Ga0070705_100037868 3300005440 Bacteria 2724
19 Ga0070705_100098540 3300005440 Bacteria 1840
20 Ga0070694_100035810 3300005444 Bacteria 3284
21 Ga0070708_100000424 3300005445 Bacteria 31474
22 Ga0070678_100136880 3300005456 Bacteria 1954
23 Ga0070678_100450678 3300005456 Bacteria 1127
24 Ga0070662_100021434 3300005457 Bacteria 4411
25 Ga0070662_100097149 3300005457 Bacteria 2223
26 Ga0068867_100348365 3300005459 Bacteria 1235
27 Ga0070706_100102893 3300005467 Bacteria 2655
28 Ga0070707_100006417 3300005468 Bacteria 10932
29 Ga0070707_100086985 3300005468 Bacteria 3022
30 Ga0070698_100031260 3300005471 Bacteria 5520
31 Ga0070699_100221799 3300005518 Unclassified 1685
32 Ga0070684_100232866 3300005535 Bacteria 1682
33 Ga0068853_100049515 3300005539 Bacteria 3611
34 Ga0070696_100063918 3300005546 Bacteria 2578
35 Ga0070704_100176421 3300005549 Bacteria 1705
36 Ga0070664_100551987 3300005564 Bacteria 1065
37 Ga0068856_100139540 3300005614 Bacteria 2431
38 Ga0070702_100355535 3300005615 Bacteria 1033
39 Ga0068852_100070157 3300005616 Bacteria 3074
40 Ga0068861_100077718 3300005719 Bacteria 2590
41 Ga0068870_10020068 3300005840 Bacteria 3249
42 Ga0068863_100101350 3300005841 Bacteria 2737
43 Ga0068863_100137001 3300005841 Unclassified 2339
44 Ga0081455_10001839 3300005937 Bacteria 25528
45 Ga0081455_10009825 3300005937 Bacteria 9800
46 Ga0081455_10033822 3300005937 Bacteria 4588
47 Ga0081455_10058395 3300005937 Unclassified 3264
48 Ga0081455_10062331 3300005937 Bacteria 3135
49 Ga0081455_10150828 3300005937 Bacteria 1793
50 Ga0081455_10298687 3300005937 Bacteria 1156
51 Ga0081538_10002217 3300005981 Bacteria 19254
52 Ga0081538_10004419 3300005981 Bacteria 12964
53 Ga0081538_10006141 3300005981 Bacteria 10655
54 Ga0081538_10013476 3300005981 Bacteria 6466
55 Ga0081538_10026659 3300005981 Bacteria 4034
56 Ga0081538_10049333 3300005981 Bacteria 2554
57 Ga0081538_10051612 3300005981 Bacteria 2467
58 Ga0081538_10204590 3300005981 Bacteria 805
59 Ga0081540_1047461 3300005983 Bacteria 2159
60 Ga0081539_10003126 3300005985 Bacteria 21123
61 Ga0081539_10010991 3300005985 Bacteria 7249
62 Ga0081539_10030978 3300005985 Bacteria 3307
63 Ga0081539_10036540 3300005985 Bacteria 2939
64 Ga0075432_10001821 3300006058 Bacteria 7020
65 Ga0075432_10004080 3300006058 Bacteria 4985
66 Ga0075427_10002455 3300006194 Bacteria 2486
67 Ga0097621_100199279 3300006237 Bacteria 1737
68 Ga0075428_100007416 3300006844 Bacteria 12156
69 Ga0075428_100019243 3300006844 Bacteria 7552
70 Ga0075428_100024197 3300006844 Bacteria 6718
71 Ga0075428_100031225 3300006844 Bacteria 5891
72 Ga0075428_100184721 3300006844 Bacteria 2256
73 Ga0075430_100012632 3300006846 Bacteria 7192
74 Ga0075430_100085531 3300006846 Bacteria 2640
75 Ga0075431_100018299 3300006847 Bacteria 7130
76 Ga0075431_100530893 3300006847 Bacteria 1165
77 Ga0075433_10006039 3300006852 Bacteria 9541
78 Ga0075433_10029117 3300006852 Bacteria 4702
79 Ga0075433_10034014 3300006852 Bacteria 4374
80 Ga0075434_100000282 3300006871 Bacteria 36131
81 Ga0075434_100001158 3300006871 Bacteria 21807
82 Ga0075434_100096668 3300006871 Bacteria 2958
83 Ga0075429_100007437 3300006880 Bacteria 9505
84 Ga0075429_100030139 3300006880 Bacteria 4713
85 Ga0075429_100102338 3300006880 Bacteria 2501
86 Ga0068865_100003980 3300006881 Bacteria 8861
87 Ga0068865_100034162 3300006881 Bacteria 3410
88 Ga0075435_100001832 3300007076 Bacteria 13809
89 Ga0075435_100003603 3300007076 Bacteria 10534
90 Ga0111539_10002959 3300009094 Bacteria 22536
91 Ga0111539_10035517 3300009094 Bacteria 6034
92 Ga0111539_10270656 3300009094 Bacteria 1977
93 Ga0111539_11168140 3300009094 Bacteria 894
94 Ga0105245_10244560 3300009098 Bacteria 1741
95 Ga0105245_10258061 3300009098 Bacteria 1695
96 Ga0105245_10337455 3300009098 Unclassified 1489
97 Ga0114129_10013764 3300009147 Bacteria 11529
98 Ga0114129_10025352 3300009147 Bacteria 8402
99 Ga0114129_10034732 3300009147 Bacteria 7124
100 Ga0114129_10194547 3300009147 Bacteria 2751
101 Ga0114129_10221970 3300009147 Bacteria 2549
102 Ga0114129_10228966 3300009147 Bacteria 2504
103 Ga0114129_10642365 3300009147 Unclassified 1371
104 Ga0105243_10018567 3300009148 Bacteria 5270
105 Ga0105243_10035150 3300009148 Bacteria 3883
106 Ga0105243_10161823 3300009148 Bacteria 1930
107 Ga0105243_10191433 3300009148 Bacteria 1787
108 Ga0105242_10004050 3300009176 Bacteria 11387
109 Ga0105242_10036746 3300009176 Bacteria 3931
110 Ga0105242_10166151 3300009176 Bacteria 1936
111 Ga0105242_11214742 3300009176 Bacteria 774
112 Ga0105237_10326320 3300009545 Bacteria 1539
113 Ga0105238_10019272 3300009551 Bacteria 6951
114 Ga0105238_10091108 3300009551 Bacteria 3037
115 Ga0105249_10012973 3300009553 Bacteria 7354
116 Ga0105249_10096068 3300009553 Unclassified 2779
117 Ga0105249_10688941 3300009553 Bacteria 1081
118 Ga0105239_10047924 3300010375 Bacteria 4683
119 Ga0157324_1015542 3300012506 Bacteria 714
120 Ga0157378_10127475 3300013297 Bacteria 2353
121 Ga0163162_10069118 3300013306 Bacteria 3584
122 Ga0163162_10188112 3300013306 Unclassified 2192
123 Ga0163162_10209525 3300013306 Unclassified 2079
124 Ga0163162_10360626 3300013306 Bacteria 1586
125 Ga0163163_10103155 3300014325 Bacteria 2876
126 Ga0163163_10548264 3300014325 Bacteria 1219
127 Ga0157380_10297474 3300014326 Unclassified 1485
128 Ga0182008_10062143 3300014497 Bacteria 1841
129 Ga0157377_10120373 3300014745 Archaea 1590
130 Ga0163161_10057590 3300017792 Unclassified 2823
131 Ga0163161_10149188 3300017792 Bacteria 1776
132 Ga0207653_10000003 3300025885 Bacteria 268014
133 Ga0207653_10001105 3300025885 Bacteria 8833
134 Ga0207642_10025373 3300025899 Bacteria 2397
135 Ga0207643_10032727 3300025908 Bacteria 2905
136 Ga0207684_10000025 3300025910 Bacteria 316760
137 Ga0207684_10033061 3300025910 Bacteria 4399
138 Ga0207671_10301858 3300025914 Bacteria 1265
139 Ga0207660_10076477 3300025917 Bacteria 2448
140 Ga0207649_10035331 3300025920 Bacteria 3003
141 Ga0207646_10145306 3300025922 Bacteria 2137
142 Ga0207694_10286894 3300025924 Bacteria 1353
143 Ga0207687_10033589 3300025927 Bacteria 3480
144 Ga0207687_10322035 3300025927 Bacteria 1252
145 Ga0207706_10150330 3300025933 Bacteria 2048
146 Ga0207686_10006916 3300025934 Bacteria 6106
147 Ga0207686_10440743 3300025934 Bacteria 1000
148 Ga0207709_10026602 3300025935 Bacteria 3325
149 Ga0207709_10039380 3300025935 Bacteria 2822
150 Ga0207709_10086539 3300025935 Bacteria 2035
151 Ga0207669_10030866 3300025937 Bacteria 2985
152 Ga0207669_10048065 3300025937 Bacteria 2532
153 Ga0207704_10035078 3300025938 Bacteria 2870
154 Ga0207704_10145453 3300025938 Bacteria 1664
155 Ga0207704_10313815 3300025938 Bacteria 1206
156 Ga0207704_10591597 3300025938 Bacteria 907
157 Ga0207679_10733044 3300025945 Archaea 898
158 Ga0207651_10278023 3300025960 Bacteria 1382
159 Ga0207712_10020288 3300025961 Bacteria 4352
160 Ga0207712_10023292 3300025961 Bacteria 4086
161 Ga0207668_10296295 3300025972 Bacteria 1333
162 Ga0207640_10176468 3300025981 Bacteria 1597
163 Ga0207640_10506344 3300025981 Bacteria 1006
164 Ga0207677_10182491 3300026023 Bacteria 1652
165 Ga0207639_10900712 3300026041 Bacteria 827
166 Ga0207702_10529186 3300026078 Bacteria 1151
167 Ga0207641_10755265 3300026088 Unclassified 960
168 Ga0207648_10387655 3300026089 Bacteria 1264
169 Ga0207675_100007945 3300026118 Bacteria 10005
170 Ga0207675_100020703 3300026118 Bacteria 6132
171 Ga0207683_10109861 3300026121 Bacteria 2468
172 Ga0207698_10435642 3300026142 Bacteria 1262
173 Ga0207428_10002935 3300027907 Bacteria 16896
174 Ga0207428_10268910 3300027907 Bacteria 1268
175 Ga0207428_10612031 3300027907 Bacteria 784
176 Ga0268265_10369079 3300028380 Bacteria 1317
177 Ga0268264_10225862 3300028381 Unclassified 1726
178 Ga0307513_10027910 3300031456 Bacteria 6469
179 Ga0307408_100020271 3300031548 Bacteria 4485
180 Ga0307408_100882324 3300031548 Bacteria 817
181 Ga0307408_101168827 3300031548 Bacteria 716
182 Ga0307405_10020715 3300031731 Bacteria 3680
183 Ga0307405_10065610 3300031731 Bacteria 2312
184 Ga0307405_10127355 3300031731 Unclassified 1753
185 Ga0307405_10246281 3300031731 Bacteria 1327
186 Ga0307405_10512884 3300031731 Bacteria 963
187 Ga0307413_10000383 3300031824 Bacteria 14132
188 Ga0307413_10243594 3300031824 Bacteria 1329
189 Ga0307413_10935946 3300031824 Bacteria 738
190 Ga0307410_10008857 3300031852 Bacteria 5610
191 Ga0307410_10051632 3300031852 Bacteria 2772
192 Ga0307410_10072240 3300031852 Bacteria 2395
193 Ga0307410_10144960 3300031852 Bacteria 1761
194 Ga0307410_10148680 3300031852 Bacteria 1741
195 Ga0307410_10212447 3300031852 Bacteria 1483
196 Ga0307410_10256704 3300031852 Bacteria 1361
197 Ga0307406_10000212 3300031901 Bacteria 35056
198 Ga0307406_10010700 3300031901 Bacteria 5181
199 Ga0307406_10081837 3300031901 Bacteria 2148
200 Ga0307407_10000607 3300031903 Bacteria 11418
201 Ga0307407_10012672 3300031903 Bacteria 4062
202 Ga0307407_10016246 3300031903 Bacteria 3702
203 Ga0307412_10060649 3300031911 Bacteria 2539
204 Ga0307412_10106316 3300031911 Bacteria 1995
205 Ga0307412_10131567 3300031911 Bacteria 1818
206 Ga0307412_10149791 3300031911 Bacteria 1720
207 Ga0307409_100000225 3300031995 Bacteria 22648
208 Ga0307409_100011341 3300031995 Bacteria 5610
209 Ga0307409_100065983 3300031995 Bacteria 2851
210 Ga0307409_100076990 3300031995 Bacteria 2677
211 Ga0307416_100006892 3300032002 Bacteria 7155
212 Ga0307416_100017186 3300032002 Bacteria 5051
213 Ga0307416_100098752 3300032002 Bacteria 2533
214 Ga0307416_100414826 3300032002 Bacteria 1388
215 Ga0307416_101906615 3300032002 Bacteria 697
216 Ga0307414_10021490 3300032004 Bacteria 4050
217 Ga0307414_10497169 3300032004 Bacteria 1078
218 Ga0307414_10631175 3300032004 Bacteria 964
219 Ga0307411_10011939 3300032005 Bacteria 4714
220 Ga0307411_10180861 3300032005 Unclassified 1600
221 Ga0307411_10260369 3300032005 Bacteria 1369
222 Ga0307411_10389150 3300032005 Bacteria 1149
223 Ga0307411_10703546 3300032005 Bacteria 880
224 Ga0307415_100000310 3300032126 Bacteria 21068
225 Ga0307415_100000944 3300032126 Bacteria 13368
226 Ga0307415_100028001 3300032126 Bacteria 3578
227 Ga0307415_100053976 3300032126 Unclassified 2741
228 Ga0307415_100065316 3300032126 Bacteria 2535
229 Ga0307415_100081504 3300032126 Bacteria 2311
230 Ga0307415_100157592 3300032126 Bacteria 1755
231 Ga0307415_100349187 3300032126 Bacteria 1244
232 Ga0373939_0016952 3300035114 Bacteria 1928
233 Ga0373946_0056616 3300035171 Bacteria 1656
234 Ga0373962_0043651 3300035242 Bacteria 1271
235 Ga0373927_0181566 3300035695 Bacteria 1380
236 Ga0373925_0259179 3300037068 Bacteria 1396
237 Ga0395899_0229359 3300037312 Bacteria 1283
238 Ga0395899_0265174 3300037312 Bacteria 1173
239 Ga0395900_0420028 3300037418 Bacteria 1298
240 Ga0395900_0773398 3300037418 Bacteria 889
241 Ga0395898_0127802 3300037466 Bacteria 2435
242 Ga0395898_0241614 3300037466 Bacteria 1722
243 Ga0395898_0360754 3300037466 Bacteria 1386
244 Ga0395905_0010556 3300037471 Bacteria 8971
245 Ga0395905_0081776 3300037471 Bacteria 3027
246 Ga0395905_0317558 3300037471 Bacteria 1447
247 Ga0395905_0480191 3300037471 Bacteria 1142
248 Ga0395901_0031026 3300038443 Bacteria 5510
249 Ga0395901_0178070 3300038443 Bacteria 2230
250 Ga0395901_0224988 3300038443 Bacteria 1960
251 Ga0395901_0312375 3300038443 Bacteria 1627
252 Ga0395901_0647415 3300038443 Bacteria 1060
253 Ga0436365_1768430 3300039437 Bacteria 2127
254 Ga0439443_018222 3300042003 Bacteria 1086
255 Ga0439448_0006352 3300042005 Bacteria 3396
256 Ga0439448_0020975 3300042005 Bacteria 2026
257 Ga0439448_0044899 3300042005 Bacteria 1438
258 Ga0439450_073522 3300042008 Bacteria 842
259 Ga0439454_033046 3300042011 Bacteria 819
260 Ga0439455_0024379 3300042012 Bacteria 1463
261 Ga0439456_042385 3300042013 Bacteria 988
262 Ga0439463_000643 3300042016 Bacteria 9673
263 Ga0439463_008837 3300042016 Bacteria 2479
264 Ga0439463_015537 3300042016 Bacteria 1882
265 Ga0450888_003953 3300042126 Bacteria 1529
266 Ga0450905_019267 3300042142 Bacteria 998
267 Ga0439435_0095006 3300042436 Bacteria 910
268 Ga0439444_0004731 3300042437 Bacteria 1991
269 Ga0439464_0047898 3300042439 Bacteria 1230
270 Ga0439460_0005360 3300042461 Bacteria 3145
271 Ga0439460_0011921 3300042461 Bacteria 2247
272 Ga0439460_0031842 3300042461 Bacteria 1507
273 Ga0439440_0001730 3300042993 Bacteria 4017
274 Ga0439440_0020710 3300042993 Bacteria 1477
275 Ga0439440_0023063 3300042993 Bacteria 1416
276 Ga0495603_0045446 3300046455 Bacteria 2619
277 Ga0495629_0044346 3300046459 Bacteria 3121
278 Ga0495638_0175602 3300046460 Bacteria 1226
279 Ga0495641_0135009 3300046461 Bacteria 1101
280 Ga0495653_0090967 3300046463 Bacteria 2231
281 Ga0495580_0106218 3300046472 Bacteria 1950
282 Ga0495639_0030829 3300046475 Bacteria 2385
283 Ga0495596_0259767 3300046500 Bacteria 674
284 Ga0495607_0206922 3300046501 Bacteria 968
285 Ga0495583_0119977 3300046506 Bacteria 1108
286 Ga0495630_0106981 3300046517 Bacteria 2118
287 Ga0495644_0055671 3300046523 Bacteria 1486
288 Ga0495663_0075766 3300046525 Bacteria 1077
289 Ga0495654_0176870 3300046530 Bacteria 927
290 Ga0495640_0040979 3300046533 Bacteria 3239
291 Ga0495609_0051367 3300046538 Archaea 1836
292 Ga0495597_0277111 3300046542 Bacteria 654
293 Ga0495633_0106285 3300046558 Bacteria 1302
294 Ga0495656_0027578 3300046615 Bacteria 2270
295 Ga0495661_0190125 3300046665 Bacteria 1082
296 Ga0495647_0010919 3300046681 Bacteria 3103
297 Ga0495647_0324010 3300046681 Bacteria 698
298 Ga0495613_0015690 3300046689 Bacteria 5637
299 Ga0495624_0134648 3300046690 Bacteria 1514
300 Ga0495670_0021632 3300046691 Bacteria 3173
301 Ga0495581_0123450 3300047315 Bacteria 1507
302 Ga0495676_0105673 3300047321 Bacteria 2075
303 Ga0495680_0016288 3300047322 Bacteria 6393
304 Ga0495677_0044589 3300047445 Bacteria 1626
305 Ga0495684_0012395 3300047471 Bacteria 6573
306 Ga0496100_0144728 3300048903 Bacteria 1689
307 Ga0496100_0460340 3300048903 Bacteria 976
308 Ga0496100_0858696 3300048903 Bacteria 712
309 Ga0496102_0014708 3300048905 Bacteria 6802
310 Ga0496103_0125416 3300048906 Bacteria 1637
311 Ga0496104_0704972 3300048907 Bacteria 917
312 Ga0496106_0018667 3300048909 Bacteria 5134
313 Ga0496107_0042732 3300048910 Bacteria 3255
314 Ga0496108_0115926 3300048911 Bacteria 2294
315 Ga0496109_0013024 3300048912 Bacteria 7192
316 Ga0496111_0367247 3300048914 Bacteria 1065
317 Ga0496114_0390081 3300048917 Bacteria 1233
318 Ga0501299_034483 3300049522 Bacteria 991
319 Ga0501034_0193216 3300049571 Bacteria 1997
320 Ga0501071_0530338 3300049587 Bacteria 904
321 Ga0501206_032409 3300049653 Bacteria 782
322 Ga0501243_021472 3300049675 Bacteria 1066
323 Ga0501271_008019 3300049768 Bacteria 1075
324 nmdc:mga05p37_17510_c1 3300050507 Bacteria 8650
325 nmdc:mga05p37_198700_c2 3300050507 Bacteria 1521
326 nmdc:mga05p37_24233_c1 3300050507 Bacteria 7374
327 nmdc:mga05p37_461167_c1 3300050507 Bacteria 1468
328 nmdc:mga05p37_59323_c1 3300050507 Bacteria 4712
329 nmdc:mga09592_182341_c1 3300050508 Bacteria 1816
330 nmdc:mga09592_23642_c1 3300050508 Bacteria 5076
331 nmdc:mga09592_40109_c1 3300050508 Bacteria 3934
332 nmdc:mga0qj67_17946_c1 3300050509 Bacteria 5388
333 nmdc:mga0qj67_1820_c1 3300050509 Bacteria 15094
334 nmdc:mga06r32_29218_c1 3300050510 Bacteria 5165
335 nmdc:mga06r32_5618_c1 3300050510 Bacteria 11277
336 nmdc:mga08y16_369027_c1 3300050511 Unclassified 1473
337 nmdc:mga08y16_554138_c1 3300050511 Bacteria 1163
338 nmdc:mga08y16_584845_c1 3300050511 Bacteria 1127
339 nmdc:mga08y16_8129_c1 3300050511 Bacteria 10972
340 nmdc:mga0n895_1197_c1 3300050512 Bacteria 19111
341 nmdc:mga0n895_129937_c1 3300050512 Bacteria 2544
342 nmdc:mga0n895_20861_c1 3300050512 Bacteria 6120
343 nmdc:mga0rr50_29838_c1 3300050513 Bacteria 3852
344 nmdc:mga0rr50_9139_c1 3300050513 Bacteria 6209
345 nmdc:mga08x19_61623_c1 3300050514 Bacteria 2431
346 nmdc:mga0a205_1542_c1 3300050515 Bacteria 19699
347 nmdc:mga0a205_234019_c1 3300050515 Unclassified 1720
348 nmdc:mga0a205_3599_c1 3300050515 Bacteria 13867
349 nmdc:mga0a205_7549_c2 3300050515 Bacteria 7279
350 Ga0495655_0107441 3300053083 Bacteria 834
351 Ga0495619_0012186 3300053085 Bacteria 5412

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0206922 Ga0495607_0206922_25_591 188
2 3300042013 Ga0439456_042385 Ga0439456_042385_17_595 192
3 3300048903 Ga0496100_0144728 Ga0496100_0144728_435_1040 193
4 3300048909 Ga0496106_0018667 Ga0496106_0018667_3446_4051 193
5 3300048910 Ga0496107_0042732 Ga0496107_0042732_2032_2637 193
6 3300005614 Ga0068856_100139540 Ga0068856_1001395403 195
7 3300009147 Ga0114129_10221970 Ga0114129_102219704 195
8 3300009545 Ga0105237_10326320 Ga0105237_103263202 195
9 3300025914 Ga0207671_10301858 Ga0207671_103018582 195
10 3300026078 Ga0207702_10529186 Ga0207702_105291862 195
11 3300009094 Ga0111539_10270656 Ga0111539_102706563 196
12 3300013306 Ga0163162_10360626 Ga0163162_103606262 196
13 3300035114 Ga0373939_0016952 Ga0373939_0016952_174_764 196
14 3300035242 Ga0373962_0043651 Ga0373962_0043651_78_668 196
15 3300042008 Ga0439450_073522 Ga0439450_073522_156_764 196
16 3300046506 Ga0495583_0119977 Ga0495583_0119977_323_913 196
17 3300046525 Ga0495663_0075766 Ga0495663_0075766_107_697 196
18 3300046538 Ga0495609_0051367 Ga0495609_0051367_376_966 196
19 3300046558 Ga0495633_0106285 Ga0495633_0106285_32_622 196
20 3300047445 Ga0495677_0044589 Ga0495677_0044589_717_1307 196
21 3300050511 nmdc:mga08y16_554138_c1 nmdc:mga08y16_554138_c1_414_1004 196
22 3300005337 Ga0070682_100568867 Ga0070682_1005688671 199
23 3300009094 Ga0111539_11168140 Ga0111539_111681402 199
24 3300025937 Ga0207669_10030866 Ga0207669_100308663 199
25 3300032005 Ga0307411_10389150 Ga0307411_103891501 199
26 3300048917 Ga0496114_0390081 Ga0496114_0390081_400_999 199
27 3300005329 Ga0070683_101053304 Ga0070683_1010533041 200
28 3300005337 Ga0070682_100240977 Ga0070682_1002409772 200
29 3300005338 Ga0068868_100373204 Ga0068868_1003732042 200
30 3300005339 Ga0070660_100163376 Ga0070660_1001633762 200
31 3300005341 Ga0070691_10070347 Ga0070691_100703472 200
32 3300005341 Ga0070691_10112486 Ga0070691_101124862 200
33 3300005344 Ga0070661_100185464 Ga0070661_1001854643 200
34 3300005354 Ga0070675_100020488 Ga0070675_1000204883 200
35 3300005356 Ga0070674_100061776 Ga0070674_1000617763 200
36 3300005364 Ga0070673_100148551 Ga0070673_1001485513 200
37 3300005365 Ga0070688_100005437 Ga0070688_1000054374 200
38 3300005444 Ga0070694_100035810 Ga0070694_1000358105 200
39 3300005456 Ga0070678_100450678 Ga0070678_1004506782 200
40 3300005457 Ga0070662_100021434 Ga0070662_1000214343 200
41 3300005457 Ga0070662_100097149 Ga0070662_1000971492 200
42 3300005459 Ga0068867_100348365 Ga0068867_1003483652 200
43 3300005518 Ga0070699_100221799 Ga0070699_1002217992 200
44 3300005539 Ga0068853_100049515 Ga0068853_1000495152 200
45 3300005615 Ga0070702_100355535 Ga0070702_1003555351 200
46 3300005616 Ga0068852_100070157 Ga0068852_1000701573 200
47 3300005719 Ga0068861_100077718 Ga0068861_1000777182 200
48 3300005841 Ga0068863_100101350 Ga0068863_1001013503 200
49 3300005841 Ga0068863_100137001 Ga0068863_1001370013 200
50 3300006058 Ga0075432_10001821 Ga0075432_100018216 200
51 3300006844 Ga0075428_100007416 Ga0075428_10000741610 200
52 3300006844 Ga0075428_100024197 Ga0075428_1000241972 200
53 3300006847 Ga0075431_100018299 Ga0075431_1000182992 200
54 3300006852 Ga0075433_10006039 Ga0075433_1000603910 200
55 3300006852 Ga0075433_10029117 Ga0075433_100291174 200
56 3300006871 Ga0075434_100001158 Ga0075434_1000011583 200
57 3300006871 Ga0075434_100096668 Ga0075434_1000966683 200
58 3300006880 Ga0075429_100102338 Ga0075429_1001023382 200
59 3300006881 Ga0068865_100003980 Ga0068865_1000039802 200
60 3300007076 Ga0075435_100001832 Ga0075435_1000018327 200
61 3300009094 Ga0111539_10035517 Ga0111539_100355179 200
62 3300009098 Ga0105245_10337455 Ga0105245_103374552 200
63 3300009147 Ga0114129_10013764 Ga0114129_1001376410 200
64 3300009147 Ga0114129_10034732 Ga0114129_100347327 200
65 3300009148 Ga0105243_10035150 Ga0105243_100351503 200
66 3300009148 Ga0105243_10161823 Ga0105243_101618232 200
67 3300009176 Ga0105242_10036746 Ga0105242_100367462 200
68 3300009176 Ga0105242_10166151 Ga0105242_101661512 200
69 3300009551 Ga0105238_10019272 Ga0105238_100192725 200
70 3300009551 Ga0105238_10091108 Ga0105238_100911082 200
71 3300009553 Ga0105249_10012973 Ga0105249_100129739 200
72 3300009553 Ga0105249_10096068 Ga0105249_100960683 200
73 3300010375 Ga0105239_10047924 Ga0105239_100479242 200
74 3300012506 Ga0157324_1015542 Ga0157324_10155421 200
75 3300013297 Ga0157378_10127475 Ga0157378_101274753 200
76 3300013306 Ga0163162_10188112 Ga0163162_101881122 200
77 3300013306 Ga0163162_10209525 Ga0163162_102095251 200
78 3300014326 Ga0157380_10297474 Ga0157380_102974743 200
79 3300014745 Ga0157377_10120373 Ga0157377_101203732 200
80 3300017792 Ga0163161_10057590 Ga0163161_100575902 200
81 3300017792 Ga0163161_10149188 Ga0163161_101491882 200
82 3300025885 Ga0207653_10001105 Ga0207653_100011056 200
83 3300025899 Ga0207642_10025373 Ga0207642_100253732 200
84 3300025917 Ga0207660_10076477 Ga0207660_100764775 200
85 3300025920 Ga0207649_10035331 Ga0207649_100353312 200
86 3300025924 Ga0207694_10286894 Ga0207694_102868942 200
87 3300025927 Ga0207687_10033589 Ga0207687_100335892 200
88 3300025927 Ga0207687_10322035 Ga0207687_103220352 200
89 3300025933 Ga0207706_10150330 Ga0207706_101503302 200
90 3300025934 Ga0207686_10006916 Ga0207686_100069162 200
91 3300025935 Ga0207709_10039380 Ga0207709_100393802 200
92 3300025935 Ga0207709_10086539 Ga0207709_100865392 200
93 3300025938 Ga0207704_10035078 Ga0207704_100350782 200
94 3300025938 Ga0207704_10591597 Ga0207704_105915971 200
95 3300025945 Ga0207679_10733044 Ga0207679_107330441 200
96 3300025960 Ga0207651_10278023 Ga0207651_102780231 200
97 3300025961 Ga0207712_10020288 Ga0207712_100202882 200
98 3300025961 Ga0207712_10023292 Ga0207712_100232923 200
99 3300025972 Ga0207668_10296295 Ga0207668_102962952 200
100 3300025981 Ga0207640_10176468 Ga0207640_101764682 200
101 3300026023 Ga0207677_10182491 Ga0207677_101824912 200
102 3300026041 Ga0207639_10900712 Ga0207639_109007121 200
103 3300026088 Ga0207641_10755265 Ga0207641_107552651 200
104 3300026089 Ga0207648_10387655 Ga0207648_103876552 200
105 3300026118 Ga0207675_100007945 Ga0207675_1000079456 200
106 3300026118 Ga0207675_100020703 Ga0207675_1000207035 200
107 3300026142 Ga0207698_10435642 Ga0207698_104356422 200
108 3300027907 Ga0207428_10268910 Ga0207428_102689102 200
109 3300027907 Ga0207428_10612031 Ga0207428_106120311 200
110 3300028380 Ga0268265_10369079 Ga0268265_103690791 200
111 3300028381 Ga0268264_10225862 Ga0268264_102258622 200
112 3300031548 Ga0307408_100020271 Ga0307408_1000202713 200
113 3300031731 Ga0307405_10065610 Ga0307405_100656101 200
114 3300031731 Ga0307405_10127355 Ga0307405_101273552 200
115 3300031731 Ga0307405_10246281 Ga0307405_102462812 200
116 3300031824 Ga0307413_10000383 Ga0307413_100003838 200
117 3300031824 Ga0307413_10935946 Ga0307413_109359461 200
118 3300031852 Ga0307410_10008857 Ga0307410_100088573 200
119 3300031852 Ga0307410_10212447 Ga0307410_102124473 200
120 3300031901 Ga0307406_10000212 Ga0307406_1000021232 200
121 3300031901 Ga0307406_10010700 Ga0307406_100107002 200
122 3300031903 Ga0307407_10000607 Ga0307407_100006074 200
123 3300031903 Ga0307407_10016246 Ga0307407_100162463 200
124 3300031911 Ga0307412_10060649 Ga0307412_100606492 200
125 3300031995 Ga0307409_100000225 Ga0307409_1000002256 200
126 3300031995 Ga0307409_100011341 Ga0307409_1000113413 200
127 3300032002 Ga0307416_100006892 Ga0307416_1000068926 200
128 3300032002 Ga0307416_100017186 Ga0307416_1000171863 200
129 3300032002 Ga0307416_101906615 Ga0307416_1019066151 200
130 3300032004 Ga0307414_10021490 Ga0307414_100214902 200
131 3300032005 Ga0307411_10011939 Ga0307411_100119392 200
132 3300032005 Ga0307411_10180861 Ga0307411_101808612 200
133 3300032126 Ga0307415_100000310 Ga0307415_10000031017 200
134 3300032126 Ga0307415_100000944 Ga0307415_10000094411 200
135 3300032126 Ga0307415_100349187 Ga0307415_1003491872 200
136 3300039437 Ga0436365_1768430 Ga0436365_1768430_680_1288 200
137 3300042003 Ga0439443_018222 Ga0439443_018222_422_1024 200
138 3300042005 Ga0439448_0044899 Ga0439448_0044899_599_1201 200
139 3300042016 Ga0439463_008837 Ga0439463_008837_378_989 200
140 3300042016 Ga0439463_015537 Ga0439463_015537_1100_1702 200
141 3300042461 Ga0439460_0011921 Ga0439460_0011921_1225_1827 200
142 3300042993 Ga0439440_0023063 Ga0439440_0023063_169_771 200
143 3300046500 Ga0495596_0259767 Ga0495596_0259767_49_651 200
144 3300046530 Ga0495654_0176870 Ga0495654_0176870_75_677 200
145 3300046615 Ga0495656_0027578 Ga0495656_0027578_1246_1848 200
146 3300046665 Ga0495661_0190125 Ga0495661_0190125_351_953 200
147 3300050507 nmdc:mga05p37_24233_c1 nmdc:mga05p37_24233_c1_4210_4821 200
148 3300050507 nmdc:mga05p37_461167_c1 nmdc:mga05p37_461167_c1_286_888 200
149 3300050508 nmdc:mga09592_182341_c1 nmdc:mga09592_182341_c1_769_1371 200
150 3300050511 nmdc:mga08y16_369027_c1 nmdc:mga08y16_369027_c1_106_810 200
151 3300050511 nmdc:mga08y16_584845_c1 nmdc:mga08y16_584845_c1_440_1051 200
152 3300050512 nmdc:mga0n895_129937_c1 nmdc:mga0n895_129937_c1_99_803 200
153 3300050512 nmdc:mga0n895_20861_c1 nmdc:mga0n895_20861_c1_138_749 200
154 3300050513 nmdc:mga0rr50_29838_c1 nmdc:mga0rr50_29838_c1_1386_2090 200
155 3300050515 nmdc:mga0a205_234019_c1 nmdc:mga0a205_234019_c1_911_1615 200
156 3300050515 nmdc:mga0a205_7549_c2 nmdc:mga0a205_7549_c2_4484_5095 200
157 3300053083 Ga0495655_0107441 Ga0495655_0107441_221_823 200
158 3300003373 JGI25407J50210_10035000 JGI25407J50210_100350002 201
159 3300005356 Ga0070674_100067207 Ga0070674_1000672073 201
160 3300005406 Ga0070703_10000008 Ga0070703_1000000831 201
161 3300005440 Ga0070705_100037868 Ga0070705_1000378685 201
162 3300005440 Ga0070705_100098540 Ga0070705_1000985403 201
163 3300005445 Ga0070708_100000424 Ga0070708_10000042434 201
164 3300005456 Ga0070678_100136880 Ga0070678_1001368803 201
165 3300005467 Ga0070706_100102893 Ga0070706_1001028932 201
166 3300005468 Ga0070707_100006417 Ga0070707_1000064172 201
167 3300005468 Ga0070707_100086985 Ga0070707_1000869856 201
168 3300005471 Ga0070698_100031260 Ga0070698_1000312607 201
169 3300005535 Ga0070684_100232866 Ga0070684_1002328665 201
170 3300005546 Ga0070696_100063918 Ga0070696_1000639182 201
171 3300005549 Ga0070704_100176421 Ga0070704_1001764212 201
172 3300005564 Ga0070664_100551987 Ga0070664_1005519872 201
173 3300005840 Ga0068870_10020068 Ga0068870_100200682 201
174 3300005937 Ga0081455_10150828 Ga0081455_101508283 201
175 3300005937 Ga0081455_10298687 Ga0081455_102986872 201
176 3300005981 Ga0081538_10002217 Ga0081538_1000221717 201
177 3300005981 Ga0081538_10004419 Ga0081538_100044194 201
178 3300005981 Ga0081538_10006141 Ga0081538_100061413 201
179 3300005981 Ga0081538_10013476 Ga0081538_100134763 201
180 3300005981 Ga0081538_10026659 Ga0081538_100266594 201
181 3300005981 Ga0081538_10049333 Ga0081538_100493332 201
182 3300005981 Ga0081538_10051612 Ga0081538_100516123 201
183 3300005981 Ga0081538_10204590 Ga0081538_102045901 201
184 3300005983 Ga0081540_1047461 Ga0081540_10474612 201
185 3300005985 Ga0081539_10010991 Ga0081539_100109913 201
186 3300005985 Ga0081539_10036540 Ga0081539_100365404 201
187 3300006058 Ga0075432_10004080 Ga0075432_100040803 201
188 3300006194 Ga0075427_10002455 Ga0075427_100024553 201
189 3300006237 Ga0097621_100199279 Ga0097621_1001992792 201
190 3300006844 Ga0075428_100031225 Ga0075428_1000312253 201
191 3300006844 Ga0075428_100184721 Ga0075428_1001847212 201
192 3300006846 Ga0075430_100012632 Ga0075430_1000126326 201
193 3300006846 Ga0075430_100085531 Ga0075430_1000855312 201
194 3300006847 Ga0075431_100530893 Ga0075431_1005308931 201
195 3300006852 Ga0075433_10034014 Ga0075433_100340142 201
196 3300006871 Ga0075434_100000282 Ga0075434_1000002824 201
197 3300006880 Ga0075429_100007437 Ga0075429_1000074377 201
198 3300006880 Ga0075429_100030139 Ga0075429_1000301392 201
199 3300006881 Ga0068865_100034162 Ga0068865_1000341624 201
200 3300007076 Ga0075435_100003603 Ga0075435_1000036033 201
201 3300009094 Ga0111539_10002959 Ga0111539_1000295910 201
202 3300009098 Ga0105245_10244560 Ga0105245_102445602 201
203 3300009098 Ga0105245_10258061 Ga0105245_102580611 201
204 3300009147 Ga0114129_10025352 Ga0114129_100253527 201
205 3300009147 Ga0114129_10194547 Ga0114129_101945472 201
206 3300009147 Ga0114129_10228966 Ga0114129_102289664 201
207 3300009148 Ga0105243_10018567 Ga0105243_100185674 201
208 3300009148 Ga0105243_10191433 Ga0105243_101914333 201
209 3300009176 Ga0105242_10004050 Ga0105242_1000405011 201
210 3300009176 Ga0105242_11214742 Ga0105242_112147421 201
211 3300009553 Ga0105249_10688941 Ga0105249_106889411 201
212 3300013306 Ga0163162_10069118 Ga0163162_100691185 201
213 3300014325 Ga0163163_10103155 Ga0163163_101031552 201
214 3300014325 Ga0163163_10548264 Ga0163163_105482642 201
215 3300014497 Ga0182008_10062143 Ga0182008_100621432 201
216 3300025885 Ga0207653_10000003 Ga0207653_1000000340 201
217 3300025908 Ga0207643_10032727 Ga0207643_100327273 201
218 3300025910 Ga0207684_10000025 Ga0207684_10000025158 201
219 3300025910 Ga0207684_10033061 Ga0207684_100330615 201
220 3300025922 Ga0207646_10145306 Ga0207646_101453063 201
221 3300025934 Ga0207686_10440743 Ga0207686_104407432 201
222 3300025935 Ga0207709_10026602 Ga0207709_100266023 201
223 3300025937 Ga0207669_10048065 Ga0207669_100480653 201
224 3300025938 Ga0207704_10145453 Ga0207704_101454532 201
225 3300025938 Ga0207704_10313815 Ga0207704_103138152 201
226 3300025981 Ga0207640_10506344 Ga0207640_105063441 201
227 3300026121 Ga0207683_10109861 Ga0207683_101098612 201
228 3300027907 Ga0207428_10002935 Ga0207428_100029355 201
229 3300031456 Ga0307513_10027910 Ga0307513_100279105 201
230 3300031548 Ga0307408_100882324 Ga0307408_1008823241 201
231 3300031731 Ga0307405_10020715 Ga0307405_100207153 201
232 3300031824 Ga0307413_10243594 Ga0307413_102435941 201
233 3300031852 Ga0307410_10051632 Ga0307410_100516323 201
234 3300031852 Ga0307410_10072240 Ga0307410_100722403 201
235 3300031852 Ga0307410_10144960 Ga0307410_101449602 201
236 3300031852 Ga0307410_10256704 Ga0307410_102567042 201
237 3300031901 Ga0307406_10081837 Ga0307406_100818372 201
238 3300031903 Ga0307407_10012672 Ga0307407_100126724 201
239 3300031911 Ga0307412_10106316 Ga0307412_101063163 201
240 3300031911 Ga0307412_10131567 Ga0307412_101315672 201
241 3300031911 Ga0307412_10149791 Ga0307412_101497911 201
242 3300031995 Ga0307409_100065983 Ga0307409_1000659834 201
243 3300031995 Ga0307409_100076990 Ga0307409_1000769903 201
244 3300032002 Ga0307416_100098752 Ga0307416_1000987522 201
245 3300032004 Ga0307414_10497169 Ga0307414_104971692 201
246 3300032005 Ga0307411_10260369 Ga0307411_102603692 201
247 3300032126 Ga0307415_100028001 Ga0307415_1000280013 201
248 3300032126 Ga0307415_100053976 Ga0307415_1000539765 201
249 3300032126 Ga0307415_100081504 Ga0307415_1000815042 201
250 3300035171 Ga0373946_0056616 Ga0373946_0056616_108_713 201
251 3300035695 Ga0373927_0181566 Ga0373927_0181566_372_977 201
252 3300037068 Ga0373925_0259179 Ga0373925_0259179_130_735 201
253 3300037312 Ga0395899_0229359 Ga0395899_0229359_602_1213 201
254 3300037418 Ga0395900_0773398 Ga0395900_0773398_59_670 201
255 3300037466 Ga0395898_0241614 Ga0395898_0241614_841_1452 201
256 3300037466 Ga0395898_0360754 Ga0395898_0360754_572_1177 201
257 3300037471 Ga0395905_0317558 Ga0395905_0317558_55_666 201
258 3300037471 Ga0395905_0480191 Ga0395905_0480191_304_915 201
259 3300038443 Ga0395901_0031026 Ga0395901_0031026_2793_3398 201
260 3300038443 Ga0395901_0178070 Ga0395901_0178070_273_884 201
261 3300038443 Ga0395901_0224988 Ga0395901_0224988_1295_1906 201
262 3300038443 Ga0395901_0647415 Ga0395901_0647415_301_912 201
263 3300042005 Ga0439448_0006352 Ga0439448_0006352_2406_3017 201
264 3300042005 Ga0439448_0020975 Ga0439448_0020975_230_841 201
265 3300042011 Ga0439454_033046 Ga0439454_033046_163_774 201
266 3300042012 Ga0439455_0024379 Ga0439455_0024379_372_983 201
267 3300042016 Ga0439463_000643 Ga0439463_000643_6156_6767 201
268 3300042126 Ga0450888_003953 Ga0450888_003953_249_854 201
269 3300042142 Ga0450905_019267 Ga0450905_019267_372_983 201
270 3300042436 Ga0439435_0095006 Ga0439435_0095006_94_705 201
271 3300042437 Ga0439444_0004731 Ga0439444_0004731_1074_1685 201
272 3300042439 Ga0439464_0047898 Ga0439464_0047898_16_627 201
273 3300042461 Ga0439460_0005360 Ga0439460_0005360_376_987 201
274 3300042461 Ga0439460_0031842 Ga0439460_0031842_598_1209 201
275 3300042993 Ga0439440_0001730 Ga0439440_0001730_607_1218 201
276 3300042993 Ga0439440_0020710 Ga0439440_0020710_251_856 201
277 3300046455 Ga0495603_0045446 Ga0495603_0045446_1913_2518 201
278 3300046459 Ga0495629_0044346 Ga0495629_0044346_1652_2257 201
279 3300046460 Ga0495638_0175602 Ga0495638_0175602_511_1173 201
280 3300046461 Ga0495641_0135009 Ga0495641_0135009_391_996 201
281 3300046463 Ga0495653_0090967 Ga0495653_0090967_722_1327 201
282 3300046472 Ga0495580_0106218 Ga0495580_0106218_422_1027 201
283 3300046475 Ga0495639_0030829 Ga0495639_0030829_378_983 201
284 3300046517 Ga0495630_0106981 Ga0495630_0106981_1160_1765 201
285 3300046523 Ga0495644_0055671 Ga0495644_0055671_692_1303 201
286 3300046533 Ga0495640_0040979 Ga0495640_0040979_247_852 201
287 3300046542 Ga0495597_0277111 Ga0495597_0277111_33_644 201
288 3300046681 Ga0495647_0010919 Ga0495647_0010919_1864_2469 201
289 3300046681 Ga0495647_0324010 Ga0495647_0324010_20_631 201
290 3300046689 Ga0495613_0015690 Ga0495613_0015690_1494_2099 201
291 3300046690 Ga0495624_0134648 Ga0495624_0134648_34_639 201
292 3300046691 Ga0495670_0021632 Ga0495670_0021632_1595_2212 201
293 3300047315 Ga0495581_0123450 Ga0495581_0123450_316_921 201
294 3300047321 Ga0495676_0105673 Ga0495676_0105673_884_1489 201
295 3300047322 Ga0495680_0016288 Ga0495680_0016288_3103_3708 201
296 3300047471 Ga0495684_0012395 Ga0495684_0012395_3554_4159 201
297 3300048903 Ga0496100_0460340 Ga0496100_0460340_341_952 201
298 3300048903 Ga0496100_0858696 Ga0496100_0858696_30_635 201
299 3300048905 Ga0496102_0014708 Ga0496102_0014708_4716_5327 201
300 3300048906 Ga0496103_0125416 Ga0496103_0125416_264_875 201
301 3300048907 Ga0496104_0704972 Ga0496104_0704972_95_700 201
302 3300048911 Ga0496108_0115926 Ga0496108_0115926_365_982 201
303 3300048912 Ga0496109_0013024 Ga0496109_0013024_4651_5268 201
304 3300048914 Ga0496111_0367247 Ga0496111_0367247_69_680 201
305 3300049522 Ga0501299_034483 Ga0501299_034483_192_803 201
306 3300049571 Ga0501034_0193216 Ga0501034_0193216_841_1464 201
307 3300049587 Ga0501071_0530338 Ga0501071_0530338_238_849 201
308 3300049653 Ga0501206_032409 Ga0501206_032409_78_728 201
309 3300049675 Ga0501243_021472 Ga0501243_021472_116_766 201
310 3300049768 Ga0501271_008019 Ga0501271_008019_221_871 201
311 3300050507 nmdc:mga05p37_17510_c1 nmdc:mga05p37_17510_c1_6901_7512 201
312 3300050507 nmdc:mga05p37_198700_c2 nmdc:mga05p37_198700_c2_615_1220 201
313 3300050507 nmdc:mga05p37_59323_c1 nmdc:mga05p37_59323_c1_564_1175 201
314 3300050508 nmdc:mga09592_23642_c1 nmdc:mga09592_23642_c1_2343_2948 201
315 3300050508 nmdc:mga09592_40109_c1 nmdc:mga09592_40109_c1_1954_2565 201
316 3300050509 nmdc:mga0qj67_17946_c1 nmdc:mga0qj67_17946_c1_4302_4907 201
317 3300050509 nmdc:mga0qj67_1820_c1 nmdc:mga0qj67_1820_c1_9397_10008 201
318 3300050510 nmdc:mga06r32_29218_c1 nmdc:mga06r32_29218_c1_193_798 201
319 3300050510 nmdc:mga06r32_5618_c1 nmdc:mga06r32_5618_c1_8585_9196 201
320 3300050511 nmdc:mga08y16_8129_c1 nmdc:mga08y16_8129_c1_6473_7084 201
321 3300050512 nmdc:mga0n895_1197_c1 nmdc:mga0n895_1197_c1_5252_5863 201
322 3300050513 nmdc:mga0rr50_9139_c1 nmdc:mga0rr50_9139_c1_3707_4318 201
323 3300050514 nmdc:mga08x19_61623_c1 nmdc:mga08x19_61623_c1_406_1017 201
324 3300050515 nmdc:mga0a205_1542_c1 nmdc:mga0a205_1542_c1_1059_1670 201
325 3300050515 nmdc:mga0a205_3599_c1 nmdc:mga0a205_3599_c1_8177_8788 201
326 3300053085 Ga0495619_0012186 Ga0495619_0012186_3305_3910 201
327 3300003203 JGI25406J46586_10011940 JGI25406J46586_100119403 202
328 3300003911 JGI25405J52794_10053470 JGI25405J52794_100534701 202
329 3300005937 Ga0081455_10001839 Ga0081455_100018397 202
330 3300005937 Ga0081455_10009825 Ga0081455_100098257 202
331 3300005937 Ga0081455_10033822 Ga0081455_100338224 202
332 3300005937 Ga0081455_10058395 Ga0081455_100583952 202
333 3300005937 Ga0081455_10062331 Ga0081455_100623312 202
334 3300005985 Ga0081539_10003126 Ga0081539_100031269 202
335 3300005985 Ga0081539_10030978 Ga0081539_100309782 202
336 3300006844 Ga0075428_100019243 Ga0075428_1000192435 202
337 3300009147 Ga0114129_10642365 Ga0114129_106423652 202
338 3300031548 Ga0307408_101168827 Ga0307408_1011688271 202
339 3300031731 Ga0307405_10512884 Ga0307405_105128841 202
340 3300031852 Ga0307410_10148680 Ga0307410_101486802 202
341 3300032002 Ga0307416_100414826 Ga0307416_1004148262 202
342 3300032004 Ga0307414_10631175 Ga0307414_106311752 202
343 3300032005 Ga0307411_10703546 Ga0307411_107035461 202
344 3300032126 Ga0307415_100065316 Ga0307415_1000653162 202
345 3300032126 Ga0307415_100157592 Ga0307415_1001575923 202
346 3300037312 Ga0395899_0265174 Ga0395899_0265174_522_1148 202
347 3300037418 Ga0395900_0420028 Ga0395900_0420028_76_702 202
348 3300037466 Ga0395898_0127802 Ga0395898_0127802_535_1161 202
349 3300037471 Ga0395905_0010556 Ga0395905_0010556_6778_7389 202
350 3300037471 Ga0395905_0081776 Ga0395905_0081776_1145_1771 202
351 3300038443 Ga0395901_0312375 Ga0395901_0312375_457_1083 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

36

220

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8043 2 191
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7844 1 193
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7804 1 193
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7784 2 191
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7694 3 193
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8064 3 197 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8034 2 189 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7978 3 197 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7942 2 189 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7611 4 191 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1Y0BKG4-F1-model_v4 H148 0.9416 1 193 GO:0008703
GO:0009231
AF-A0A1H8KVU2-F1-model_v4 Dihydrofolate reductase 0.9413 1 193 GO:0008703
GO:0009231
AF-D3CVG2-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9402 1 193 GO:0008703
GO:0009231
AF-A0A6G9H8H5-F1-model_v4 Dihydrofolate reductase 0.9398 1 193 GO:0008703
GO:0009231
AF-A0A6G9H8H5-F1-model_v4 Dihydrofolate reductase 0.9347 1 193 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
86.6 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map