F418604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 192 | 351 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300007076|Ga0075435_100001832|Ga0075435_1000018327 |
| Length | 234 |
| Sequence | MDTLRRLTGHSGETYVTYLAVQTSSDEPIERTTQMRKLIVSTFLTLDGVMQAPGGPGEDDEGGFEYGGWSVNYWDDRMGQVMAEATSRPFAMVLGRKTYDIMAAHWPHASEEEGATVFNEATKYVASRSRPALEWSNSVLIERDAADGLAALKKEDGPELQVHGSANLIQTLLRHNLVDEYRLWVFPVVIGSGKRLFSDGTIPAGLRLVNSTVSTTGVVIGTYEPAGEIVTGSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 41 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 101 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 103 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 104 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 105 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 106 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 113 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 115 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 124 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 125 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 126 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 127 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 128 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 129 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 130 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 131 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 132 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 133 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 134 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 135 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 136 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 137 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 180 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 181 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.42 |
| Rhizosphere | 96.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10011940 | 3300003203 | Bacteria | 3790 |
| 2 | JGI25407J50210_10035000 | 3300003373 | Bacteria | 1294 |
| 3 | JGI25405J52794_10053470 | 3300003911 | Bacteria | 868 |
| 4 | Ga0070683_101053304 | 3300005329 | Unclassified | 781 |
| 5 | Ga0070682_100240977 | 3300005337 | Bacteria | 1298 |
| 6 | Ga0070682_100568867 | 3300005337 | Bacteria | 890 |
| 7 | Ga0068868_100373204 | 3300005338 | Bacteria | 1226 |
| 8 | Ga0070660_100163376 | 3300005339 | Bacteria | 1795 |
| 9 | Ga0070691_10070347 | 3300005341 | Bacteria | 1697 |
| 10 | Ga0070691_10112486 | 3300005341 | Bacteria | 1363 |
| 11 | Ga0070661_100185464 | 3300005344 | Bacteria | 1585 |
| 12 | Ga0070675_100020488 | 3300005354 | Bacteria | 5276 |
| 13 | Ga0070674_100061776 | 3300005356 | Bacteria | 2616 |
| 14 | Ga0070674_100067207 | 3300005356 | Bacteria | 2520 |
| 15 | Ga0070673_100148551 | 3300005364 | Unclassified | 1983 |
| 16 | Ga0070688_100005437 | 3300005365 | Bacteria | 6708 |
| 17 | Ga0070703_10000008 | 3300005406 | Bacteria | 97684 |
| 18 | Ga0070705_100037868 | 3300005440 | Bacteria | 2724 |
| 19 | Ga0070705_100098540 | 3300005440 | Bacteria | 1840 |
| 20 | Ga0070694_100035810 | 3300005444 | Bacteria | 3284 |
| 21 | Ga0070708_100000424 | 3300005445 | Bacteria | 31474 |
| 22 | Ga0070678_100136880 | 3300005456 | Bacteria | 1954 |
| 23 | Ga0070678_100450678 | 3300005456 | Bacteria | 1127 |
| 24 | Ga0070662_100021434 | 3300005457 | Bacteria | 4411 |
| 25 | Ga0070662_100097149 | 3300005457 | Bacteria | 2223 |
| 26 | Ga0068867_100348365 | 3300005459 | Bacteria | 1235 |
| 27 | Ga0070706_100102893 | 3300005467 | Bacteria | 2655 |
| 28 | Ga0070707_100006417 | 3300005468 | Bacteria | 10932 |
| 29 | Ga0070707_100086985 | 3300005468 | Bacteria | 3022 |
| 30 | Ga0070698_100031260 | 3300005471 | Bacteria | 5520 |
| 31 | Ga0070699_100221799 | 3300005518 | Unclassified | 1685 |
| 32 | Ga0070684_100232866 | 3300005535 | Bacteria | 1682 |
| 33 | Ga0068853_100049515 | 3300005539 | Bacteria | 3611 |
| 34 | Ga0070696_100063918 | 3300005546 | Bacteria | 2578 |
| 35 | Ga0070704_100176421 | 3300005549 | Bacteria | 1705 |
| 36 | Ga0070664_100551987 | 3300005564 | Bacteria | 1065 |
| 37 | Ga0068856_100139540 | 3300005614 | Bacteria | 2431 |
| 38 | Ga0070702_100355535 | 3300005615 | Bacteria | 1033 |
| 39 | Ga0068852_100070157 | 3300005616 | Bacteria | 3074 |
| 40 | Ga0068861_100077718 | 3300005719 | Bacteria | 2590 |
| 41 | Ga0068870_10020068 | 3300005840 | Bacteria | 3249 |
| 42 | Ga0068863_100101350 | 3300005841 | Bacteria | 2737 |
| 43 | Ga0068863_100137001 | 3300005841 | Unclassified | 2339 |
| 44 | Ga0081455_10001839 | 3300005937 | Bacteria | 25528 |
| 45 | Ga0081455_10009825 | 3300005937 | Bacteria | 9800 |
| 46 | Ga0081455_10033822 | 3300005937 | Bacteria | 4588 |
| 47 | Ga0081455_10058395 | 3300005937 | Unclassified | 3264 |
| 48 | Ga0081455_10062331 | 3300005937 | Bacteria | 3135 |
| 49 | Ga0081455_10150828 | 3300005937 | Bacteria | 1793 |
| 50 | Ga0081455_10298687 | 3300005937 | Bacteria | 1156 |
| 51 | Ga0081538_10002217 | 3300005981 | Bacteria | 19254 |
| 52 | Ga0081538_10004419 | 3300005981 | Bacteria | 12964 |
| 53 | Ga0081538_10006141 | 3300005981 | Bacteria | 10655 |
| 54 | Ga0081538_10013476 | 3300005981 | Bacteria | 6466 |
| 55 | Ga0081538_10026659 | 3300005981 | Bacteria | 4034 |
| 56 | Ga0081538_10049333 | 3300005981 | Bacteria | 2554 |
| 57 | Ga0081538_10051612 | 3300005981 | Bacteria | 2467 |
| 58 | Ga0081538_10204590 | 3300005981 | Bacteria | 805 |
| 59 | Ga0081540_1047461 | 3300005983 | Bacteria | 2159 |
| 60 | Ga0081539_10003126 | 3300005985 | Bacteria | 21123 |
| 61 | Ga0081539_10010991 | 3300005985 | Bacteria | 7249 |
| 62 | Ga0081539_10030978 | 3300005985 | Bacteria | 3307 |
| 63 | Ga0081539_10036540 | 3300005985 | Bacteria | 2939 |
| 64 | Ga0075432_10001821 | 3300006058 | Bacteria | 7020 |
| 65 | Ga0075432_10004080 | 3300006058 | Bacteria | 4985 |
| 66 | Ga0075427_10002455 | 3300006194 | Bacteria | 2486 |
| 67 | Ga0097621_100199279 | 3300006237 | Bacteria | 1737 |
| 68 | Ga0075428_100007416 | 3300006844 | Bacteria | 12156 |
| 69 | Ga0075428_100019243 | 3300006844 | Bacteria | 7552 |
| 70 | Ga0075428_100024197 | 3300006844 | Bacteria | 6718 |
| 71 | Ga0075428_100031225 | 3300006844 | Bacteria | 5891 |
| 72 | Ga0075428_100184721 | 3300006844 | Bacteria | 2256 |
| 73 | Ga0075430_100012632 | 3300006846 | Bacteria | 7192 |
| 74 | Ga0075430_100085531 | 3300006846 | Bacteria | 2640 |
| 75 | Ga0075431_100018299 | 3300006847 | Bacteria | 7130 |
| 76 | Ga0075431_100530893 | 3300006847 | Bacteria | 1165 |
| 77 | Ga0075433_10006039 | 3300006852 | Bacteria | 9541 |
| 78 | Ga0075433_10029117 | 3300006852 | Bacteria | 4702 |
| 79 | Ga0075433_10034014 | 3300006852 | Bacteria | 4374 |
| 80 | Ga0075434_100000282 | 3300006871 | Bacteria | 36131 |
| 81 | Ga0075434_100001158 | 3300006871 | Bacteria | 21807 |
| 82 | Ga0075434_100096668 | 3300006871 | Bacteria | 2958 |
| 83 | Ga0075429_100007437 | 3300006880 | Bacteria | 9505 |
| 84 | Ga0075429_100030139 | 3300006880 | Bacteria | 4713 |
| 85 | Ga0075429_100102338 | 3300006880 | Bacteria | 2501 |
| 86 | Ga0068865_100003980 | 3300006881 | Bacteria | 8861 |
| 87 | Ga0068865_100034162 | 3300006881 | Bacteria | 3410 |
| 88 | Ga0075435_100001832 | 3300007076 | Bacteria | 13809 |
| 89 | Ga0075435_100003603 | 3300007076 | Bacteria | 10534 |
| 90 | Ga0111539_10002959 | 3300009094 | Bacteria | 22536 |
| 91 | Ga0111539_10035517 | 3300009094 | Bacteria | 6034 |
| 92 | Ga0111539_10270656 | 3300009094 | Bacteria | 1977 |
| 93 | Ga0111539_11168140 | 3300009094 | Bacteria | 894 |
| 94 | Ga0105245_10244560 | 3300009098 | Bacteria | 1741 |
| 95 | Ga0105245_10258061 | 3300009098 | Bacteria | 1695 |
| 96 | Ga0105245_10337455 | 3300009098 | Unclassified | 1489 |
| 97 | Ga0114129_10013764 | 3300009147 | Bacteria | 11529 |
| 98 | Ga0114129_10025352 | 3300009147 | Bacteria | 8402 |
| 99 | Ga0114129_10034732 | 3300009147 | Bacteria | 7124 |
| 100 | Ga0114129_10194547 | 3300009147 | Bacteria | 2751 |
| 101 | Ga0114129_10221970 | 3300009147 | Bacteria | 2549 |
| 102 | Ga0114129_10228966 | 3300009147 | Bacteria | 2504 |
| 103 | Ga0114129_10642365 | 3300009147 | Unclassified | 1371 |
| 104 | Ga0105243_10018567 | 3300009148 | Bacteria | 5270 |
| 105 | Ga0105243_10035150 | 3300009148 | Bacteria | 3883 |
| 106 | Ga0105243_10161823 | 3300009148 | Bacteria | 1930 |
| 107 | Ga0105243_10191433 | 3300009148 | Bacteria | 1787 |
| 108 | Ga0105242_10004050 | 3300009176 | Bacteria | 11387 |
| 109 | Ga0105242_10036746 | 3300009176 | Bacteria | 3931 |
| 110 | Ga0105242_10166151 | 3300009176 | Bacteria | 1936 |
| 111 | Ga0105242_11214742 | 3300009176 | Bacteria | 774 |
| 112 | Ga0105237_10326320 | 3300009545 | Bacteria | 1539 |
| 113 | Ga0105238_10019272 | 3300009551 | Bacteria | 6951 |
| 114 | Ga0105238_10091108 | 3300009551 | Bacteria | 3037 |
| 115 | Ga0105249_10012973 | 3300009553 | Bacteria | 7354 |
| 116 | Ga0105249_10096068 | 3300009553 | Unclassified | 2779 |
| 117 | Ga0105249_10688941 | 3300009553 | Bacteria | 1081 |
| 118 | Ga0105239_10047924 | 3300010375 | Bacteria | 4683 |
| 119 | Ga0157324_1015542 | 3300012506 | Bacteria | 714 |
| 120 | Ga0157378_10127475 | 3300013297 | Bacteria | 2353 |
| 121 | Ga0163162_10069118 | 3300013306 | Bacteria | 3584 |
| 122 | Ga0163162_10188112 | 3300013306 | Unclassified | 2192 |
| 123 | Ga0163162_10209525 | 3300013306 | Unclassified | 2079 |
| 124 | Ga0163162_10360626 | 3300013306 | Bacteria | 1586 |
| 125 | Ga0163163_10103155 | 3300014325 | Bacteria | 2876 |
| 126 | Ga0163163_10548264 | 3300014325 | Bacteria | 1219 |
| 127 | Ga0157380_10297474 | 3300014326 | Unclassified | 1485 |
| 128 | Ga0182008_10062143 | 3300014497 | Bacteria | 1841 |
| 129 | Ga0157377_10120373 | 3300014745 | Archaea | 1590 |
| 130 | Ga0163161_10057590 | 3300017792 | Unclassified | 2823 |
| 131 | Ga0163161_10149188 | 3300017792 | Bacteria | 1776 |
| 132 | Ga0207653_10000003 | 3300025885 | Bacteria | 268014 |
| 133 | Ga0207653_10001105 | 3300025885 | Bacteria | 8833 |
| 134 | Ga0207642_10025373 | 3300025899 | Bacteria | 2397 |
| 135 | Ga0207643_10032727 | 3300025908 | Bacteria | 2905 |
| 136 | Ga0207684_10000025 | 3300025910 | Bacteria | 316760 |
| 137 | Ga0207684_10033061 | 3300025910 | Bacteria | 4399 |
| 138 | Ga0207671_10301858 | 3300025914 | Bacteria | 1265 |
| 139 | Ga0207660_10076477 | 3300025917 | Bacteria | 2448 |
| 140 | Ga0207649_10035331 | 3300025920 | Bacteria | 3003 |
| 141 | Ga0207646_10145306 | 3300025922 | Bacteria | 2137 |
| 142 | Ga0207694_10286894 | 3300025924 | Bacteria | 1353 |
| 143 | Ga0207687_10033589 | 3300025927 | Bacteria | 3480 |
| 144 | Ga0207687_10322035 | 3300025927 | Bacteria | 1252 |
| 145 | Ga0207706_10150330 | 3300025933 | Bacteria | 2048 |
| 146 | Ga0207686_10006916 | 3300025934 | Bacteria | 6106 |
| 147 | Ga0207686_10440743 | 3300025934 | Bacteria | 1000 |
| 148 | Ga0207709_10026602 | 3300025935 | Bacteria | 3325 |
| 149 | Ga0207709_10039380 | 3300025935 | Bacteria | 2822 |
| 150 | Ga0207709_10086539 | 3300025935 | Bacteria | 2035 |
| 151 | Ga0207669_10030866 | 3300025937 | Bacteria | 2985 |
| 152 | Ga0207669_10048065 | 3300025937 | Bacteria | 2532 |
| 153 | Ga0207704_10035078 | 3300025938 | Bacteria | 2870 |
| 154 | Ga0207704_10145453 | 3300025938 | Bacteria | 1664 |
| 155 | Ga0207704_10313815 | 3300025938 | Bacteria | 1206 |
| 156 | Ga0207704_10591597 | 3300025938 | Bacteria | 907 |
| 157 | Ga0207679_10733044 | 3300025945 | Archaea | 898 |
| 158 | Ga0207651_10278023 | 3300025960 | Bacteria | 1382 |
| 159 | Ga0207712_10020288 | 3300025961 | Bacteria | 4352 |
| 160 | Ga0207712_10023292 | 3300025961 | Bacteria | 4086 |
| 161 | Ga0207668_10296295 | 3300025972 | Bacteria | 1333 |
| 162 | Ga0207640_10176468 | 3300025981 | Bacteria | 1597 |
| 163 | Ga0207640_10506344 | 3300025981 | Bacteria | 1006 |
| 164 | Ga0207677_10182491 | 3300026023 | Bacteria | 1652 |
| 165 | Ga0207639_10900712 | 3300026041 | Bacteria | 827 |
| 166 | Ga0207702_10529186 | 3300026078 | Bacteria | 1151 |
| 167 | Ga0207641_10755265 | 3300026088 | Unclassified | 960 |
| 168 | Ga0207648_10387655 | 3300026089 | Bacteria | 1264 |
| 169 | Ga0207675_100007945 | 3300026118 | Bacteria | 10005 |
| 170 | Ga0207675_100020703 | 3300026118 | Bacteria | 6132 |
| 171 | Ga0207683_10109861 | 3300026121 | Bacteria | 2468 |
| 172 | Ga0207698_10435642 | 3300026142 | Bacteria | 1262 |
| 173 | Ga0207428_10002935 | 3300027907 | Bacteria | 16896 |
| 174 | Ga0207428_10268910 | 3300027907 | Bacteria | 1268 |
| 175 | Ga0207428_10612031 | 3300027907 | Bacteria | 784 |
| 176 | Ga0268265_10369079 | 3300028380 | Bacteria | 1317 |
| 177 | Ga0268264_10225862 | 3300028381 | Unclassified | 1726 |
| 178 | Ga0307513_10027910 | 3300031456 | Bacteria | 6469 |
| 179 | Ga0307408_100020271 | 3300031548 | Bacteria | 4485 |
| 180 | Ga0307408_100882324 | 3300031548 | Bacteria | 817 |
| 181 | Ga0307408_101168827 | 3300031548 | Bacteria | 716 |
| 182 | Ga0307405_10020715 | 3300031731 | Bacteria | 3680 |
| 183 | Ga0307405_10065610 | 3300031731 | Bacteria | 2312 |
| 184 | Ga0307405_10127355 | 3300031731 | Unclassified | 1753 |
| 185 | Ga0307405_10246281 | 3300031731 | Bacteria | 1327 |
| 186 | Ga0307405_10512884 | 3300031731 | Bacteria | 963 |
| 187 | Ga0307413_10000383 | 3300031824 | Bacteria | 14132 |
| 188 | Ga0307413_10243594 | 3300031824 | Bacteria | 1329 |
| 189 | Ga0307413_10935946 | 3300031824 | Bacteria | 738 |
| 190 | Ga0307410_10008857 | 3300031852 | Bacteria | 5610 |
| 191 | Ga0307410_10051632 | 3300031852 | Bacteria | 2772 |
| 192 | Ga0307410_10072240 | 3300031852 | Bacteria | 2395 |
| 193 | Ga0307410_10144960 | 3300031852 | Bacteria | 1761 |
| 194 | Ga0307410_10148680 | 3300031852 | Bacteria | 1741 |
| 195 | Ga0307410_10212447 | 3300031852 | Bacteria | 1483 |
| 196 | Ga0307410_10256704 | 3300031852 | Bacteria | 1361 |
| 197 | Ga0307406_10000212 | 3300031901 | Bacteria | 35056 |
| 198 | Ga0307406_10010700 | 3300031901 | Bacteria | 5181 |
| 199 | Ga0307406_10081837 | 3300031901 | Bacteria | 2148 |
| 200 | Ga0307407_10000607 | 3300031903 | Bacteria | 11418 |
| 201 | Ga0307407_10012672 | 3300031903 | Bacteria | 4062 |
| 202 | Ga0307407_10016246 | 3300031903 | Bacteria | 3702 |
| 203 | Ga0307412_10060649 | 3300031911 | Bacteria | 2539 |
| 204 | Ga0307412_10106316 | 3300031911 | Bacteria | 1995 |
| 205 | Ga0307412_10131567 | 3300031911 | Bacteria | 1818 |
| 206 | Ga0307412_10149791 | 3300031911 | Bacteria | 1720 |
| 207 | Ga0307409_100000225 | 3300031995 | Bacteria | 22648 |
| 208 | Ga0307409_100011341 | 3300031995 | Bacteria | 5610 |
| 209 | Ga0307409_100065983 | 3300031995 | Bacteria | 2851 |
| 210 | Ga0307409_100076990 | 3300031995 | Bacteria | 2677 |
| 211 | Ga0307416_100006892 | 3300032002 | Bacteria | 7155 |
| 212 | Ga0307416_100017186 | 3300032002 | Bacteria | 5051 |
| 213 | Ga0307416_100098752 | 3300032002 | Bacteria | 2533 |
| 214 | Ga0307416_100414826 | 3300032002 | Bacteria | 1388 |
| 215 | Ga0307416_101906615 | 3300032002 | Bacteria | 697 |
| 216 | Ga0307414_10021490 | 3300032004 | Bacteria | 4050 |
| 217 | Ga0307414_10497169 | 3300032004 | Bacteria | 1078 |
| 218 | Ga0307414_10631175 | 3300032004 | Bacteria | 964 |
| 219 | Ga0307411_10011939 | 3300032005 | Bacteria | 4714 |
| 220 | Ga0307411_10180861 | 3300032005 | Unclassified | 1600 |
| 221 | Ga0307411_10260369 | 3300032005 | Bacteria | 1369 |
| 222 | Ga0307411_10389150 | 3300032005 | Bacteria | 1149 |
| 223 | Ga0307411_10703546 | 3300032005 | Bacteria | 880 |
| 224 | Ga0307415_100000310 | 3300032126 | Bacteria | 21068 |
| 225 | Ga0307415_100000944 | 3300032126 | Bacteria | 13368 |
| 226 | Ga0307415_100028001 | 3300032126 | Bacteria | 3578 |
| 227 | Ga0307415_100053976 | 3300032126 | Unclassified | 2741 |
| 228 | Ga0307415_100065316 | 3300032126 | Bacteria | 2535 |
| 229 | Ga0307415_100081504 | 3300032126 | Bacteria | 2311 |
| 230 | Ga0307415_100157592 | 3300032126 | Bacteria | 1755 |
| 231 | Ga0307415_100349187 | 3300032126 | Bacteria | 1244 |
| 232 | Ga0373939_0016952 | 3300035114 | Bacteria | 1928 |
| 233 | Ga0373946_0056616 | 3300035171 | Bacteria | 1656 |
| 234 | Ga0373962_0043651 | 3300035242 | Bacteria | 1271 |
| 235 | Ga0373927_0181566 | 3300035695 | Bacteria | 1380 |
| 236 | Ga0373925_0259179 | 3300037068 | Bacteria | 1396 |
| 237 | Ga0395899_0229359 | 3300037312 | Bacteria | 1283 |
| 238 | Ga0395899_0265174 | 3300037312 | Bacteria | 1173 |
| 239 | Ga0395900_0420028 | 3300037418 | Bacteria | 1298 |
| 240 | Ga0395900_0773398 | 3300037418 | Bacteria | 889 |
| 241 | Ga0395898_0127802 | 3300037466 | Bacteria | 2435 |
| 242 | Ga0395898_0241614 | 3300037466 | Bacteria | 1722 |
| 243 | Ga0395898_0360754 | 3300037466 | Bacteria | 1386 |
| 244 | Ga0395905_0010556 | 3300037471 | Bacteria | 8971 |
| 245 | Ga0395905_0081776 | 3300037471 | Bacteria | 3027 |
| 246 | Ga0395905_0317558 | 3300037471 | Bacteria | 1447 |
| 247 | Ga0395905_0480191 | 3300037471 | Bacteria | 1142 |
| 248 | Ga0395901_0031026 | 3300038443 | Bacteria | 5510 |
| 249 | Ga0395901_0178070 | 3300038443 | Bacteria | 2230 |
| 250 | Ga0395901_0224988 | 3300038443 | Bacteria | 1960 |
| 251 | Ga0395901_0312375 | 3300038443 | Bacteria | 1627 |
| 252 | Ga0395901_0647415 | 3300038443 | Bacteria | 1060 |
| 253 | Ga0436365_1768430 | 3300039437 | Bacteria | 2127 |
| 254 | Ga0439443_018222 | 3300042003 | Bacteria | 1086 |
| 255 | Ga0439448_0006352 | 3300042005 | Bacteria | 3396 |
| 256 | Ga0439448_0020975 | 3300042005 | Bacteria | 2026 |
| 257 | Ga0439448_0044899 | 3300042005 | Bacteria | 1438 |
| 258 | Ga0439450_073522 | 3300042008 | Bacteria | 842 |
| 259 | Ga0439454_033046 | 3300042011 | Bacteria | 819 |
| 260 | Ga0439455_0024379 | 3300042012 | Bacteria | 1463 |
| 261 | Ga0439456_042385 | 3300042013 | Bacteria | 988 |
| 262 | Ga0439463_000643 | 3300042016 | Bacteria | 9673 |
| 263 | Ga0439463_008837 | 3300042016 | Bacteria | 2479 |
| 264 | Ga0439463_015537 | 3300042016 | Bacteria | 1882 |
| 265 | Ga0450888_003953 | 3300042126 | Bacteria | 1529 |
| 266 | Ga0450905_019267 | 3300042142 | Bacteria | 998 |
| 267 | Ga0439435_0095006 | 3300042436 | Bacteria | 910 |
| 268 | Ga0439444_0004731 | 3300042437 | Bacteria | 1991 |
| 269 | Ga0439464_0047898 | 3300042439 | Bacteria | 1230 |
| 270 | Ga0439460_0005360 | 3300042461 | Bacteria | 3145 |
| 271 | Ga0439460_0011921 | 3300042461 | Bacteria | 2247 |
| 272 | Ga0439460_0031842 | 3300042461 | Bacteria | 1507 |
| 273 | Ga0439440_0001730 | 3300042993 | Bacteria | 4017 |
| 274 | Ga0439440_0020710 | 3300042993 | Bacteria | 1477 |
| 275 | Ga0439440_0023063 | 3300042993 | Bacteria | 1416 |
| 276 | Ga0495603_0045446 | 3300046455 | Bacteria | 2619 |
| 277 | Ga0495629_0044346 | 3300046459 | Bacteria | 3121 |
| 278 | Ga0495638_0175602 | 3300046460 | Bacteria | 1226 |
| 279 | Ga0495641_0135009 | 3300046461 | Bacteria | 1101 |
| 280 | Ga0495653_0090967 | 3300046463 | Bacteria | 2231 |
| 281 | Ga0495580_0106218 | 3300046472 | Bacteria | 1950 |
| 282 | Ga0495639_0030829 | 3300046475 | Bacteria | 2385 |
| 283 | Ga0495596_0259767 | 3300046500 | Bacteria | 674 |
| 284 | Ga0495607_0206922 | 3300046501 | Bacteria | 968 |
| 285 | Ga0495583_0119977 | 3300046506 | Bacteria | 1108 |
| 286 | Ga0495630_0106981 | 3300046517 | Bacteria | 2118 |
| 287 | Ga0495644_0055671 | 3300046523 | Bacteria | 1486 |
| 288 | Ga0495663_0075766 | 3300046525 | Bacteria | 1077 |
| 289 | Ga0495654_0176870 | 3300046530 | Bacteria | 927 |
| 290 | Ga0495640_0040979 | 3300046533 | Bacteria | 3239 |
| 291 | Ga0495609_0051367 | 3300046538 | Archaea | 1836 |
| 292 | Ga0495597_0277111 | 3300046542 | Bacteria | 654 |
| 293 | Ga0495633_0106285 | 3300046558 | Bacteria | 1302 |
| 294 | Ga0495656_0027578 | 3300046615 | Bacteria | 2270 |
| 295 | Ga0495661_0190125 | 3300046665 | Bacteria | 1082 |
| 296 | Ga0495647_0010919 | 3300046681 | Bacteria | 3103 |
| 297 | Ga0495647_0324010 | 3300046681 | Bacteria | 698 |
| 298 | Ga0495613_0015690 | 3300046689 | Bacteria | 5637 |
| 299 | Ga0495624_0134648 | 3300046690 | Bacteria | 1514 |
| 300 | Ga0495670_0021632 | 3300046691 | Bacteria | 3173 |
| 301 | Ga0495581_0123450 | 3300047315 | Bacteria | 1507 |
| 302 | Ga0495676_0105673 | 3300047321 | Bacteria | 2075 |
| 303 | Ga0495680_0016288 | 3300047322 | Bacteria | 6393 |
| 304 | Ga0495677_0044589 | 3300047445 | Bacteria | 1626 |
| 305 | Ga0495684_0012395 | 3300047471 | Bacteria | 6573 |
| 306 | Ga0496100_0144728 | 3300048903 | Bacteria | 1689 |
| 307 | Ga0496100_0460340 | 3300048903 | Bacteria | 976 |
| 308 | Ga0496100_0858696 | 3300048903 | Bacteria | 712 |
| 309 | Ga0496102_0014708 | 3300048905 | Bacteria | 6802 |
| 310 | Ga0496103_0125416 | 3300048906 | Bacteria | 1637 |
| 311 | Ga0496104_0704972 | 3300048907 | Bacteria | 917 |
| 312 | Ga0496106_0018667 | 3300048909 | Bacteria | 5134 |
| 313 | Ga0496107_0042732 | 3300048910 | Bacteria | 3255 |
| 314 | Ga0496108_0115926 | 3300048911 | Bacteria | 2294 |
| 315 | Ga0496109_0013024 | 3300048912 | Bacteria | 7192 |
| 316 | Ga0496111_0367247 | 3300048914 | Bacteria | 1065 |
| 317 | Ga0496114_0390081 | 3300048917 | Bacteria | 1233 |
| 318 | Ga0501299_034483 | 3300049522 | Bacteria | 991 |
| 319 | Ga0501034_0193216 | 3300049571 | Bacteria | 1997 |
| 320 | Ga0501071_0530338 | 3300049587 | Bacteria | 904 |
| 321 | Ga0501206_032409 | 3300049653 | Bacteria | 782 |
| 322 | Ga0501243_021472 | 3300049675 | Bacteria | 1066 |
| 323 | Ga0501271_008019 | 3300049768 | Bacteria | 1075 |
| 324 | nmdc:mga05p37_17510_c1 | 3300050507 | Bacteria | 8650 |
| 325 | nmdc:mga05p37_198700_c2 | 3300050507 | Bacteria | 1521 |
| 326 | nmdc:mga05p37_24233_c1 | 3300050507 | Bacteria | 7374 |
| 327 | nmdc:mga05p37_461167_c1 | 3300050507 | Bacteria | 1468 |
| 328 | nmdc:mga05p37_59323_c1 | 3300050507 | Bacteria | 4712 |
| 329 | nmdc:mga09592_182341_c1 | 3300050508 | Bacteria | 1816 |
| 330 | nmdc:mga09592_23642_c1 | 3300050508 | Bacteria | 5076 |
| 331 | nmdc:mga09592_40109_c1 | 3300050508 | Bacteria | 3934 |
| 332 | nmdc:mga0qj67_17946_c1 | 3300050509 | Bacteria | 5388 |
| 333 | nmdc:mga0qj67_1820_c1 | 3300050509 | Bacteria | 15094 |
| 334 | nmdc:mga06r32_29218_c1 | 3300050510 | Bacteria | 5165 |
| 335 | nmdc:mga06r32_5618_c1 | 3300050510 | Bacteria | 11277 |
| 336 | nmdc:mga08y16_369027_c1 | 3300050511 | Unclassified | 1473 |
| 337 | nmdc:mga08y16_554138_c1 | 3300050511 | Bacteria | 1163 |
| 338 | nmdc:mga08y16_584845_c1 | 3300050511 | Bacteria | 1127 |
| 339 | nmdc:mga08y16_8129_c1 | 3300050511 | Bacteria | 10972 |
| 340 | nmdc:mga0n895_1197_c1 | 3300050512 | Bacteria | 19111 |
| 341 | nmdc:mga0n895_129937_c1 | 3300050512 | Bacteria | 2544 |
| 342 | nmdc:mga0n895_20861_c1 | 3300050512 | Bacteria | 6120 |
| 343 | nmdc:mga0rr50_29838_c1 | 3300050513 | Bacteria | 3852 |
| 344 | nmdc:mga0rr50_9139_c1 | 3300050513 | Bacteria | 6209 |
| 345 | nmdc:mga08x19_61623_c1 | 3300050514 | Bacteria | 2431 |
| 346 | nmdc:mga0a205_1542_c1 | 3300050515 | Bacteria | 19699 |
| 347 | nmdc:mga0a205_234019_c1 | 3300050515 | Unclassified | 1720 |
| 348 | nmdc:mga0a205_3599_c1 | 3300050515 | Bacteria | 13867 |
| 349 | nmdc:mga0a205_7549_c2 | 3300050515 | Bacteria | 7279 |
| 350 | Ga0495655_0107441 | 3300053083 | Bacteria | 834 |
| 351 | Ga0495619_0012186 | 3300053085 | Bacteria | 5412 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046501 | Ga0495607_0206922 | Ga0495607_0206922_25_591 | 188 |
| 2 | 3300042013 | Ga0439456_042385 | Ga0439456_042385_17_595 | 192 |
| 3 | 3300048903 | Ga0496100_0144728 | Ga0496100_0144728_435_1040 | 193 |
| 4 | 3300048909 | Ga0496106_0018667 | Ga0496106_0018667_3446_4051 | 193 |
| 5 | 3300048910 | Ga0496107_0042732 | Ga0496107_0042732_2032_2637 | 193 |
| 6 | 3300005614 | Ga0068856_100139540 | Ga0068856_1001395403 | 195 |
| 7 | 3300009147 | Ga0114129_10221970 | Ga0114129_102219704 | 195 |
| 8 | 3300009545 | Ga0105237_10326320 | Ga0105237_103263202 | 195 |
| 9 | 3300025914 | Ga0207671_10301858 | Ga0207671_103018582 | 195 |
| 10 | 3300026078 | Ga0207702_10529186 | Ga0207702_105291862 | 195 |
| 11 | 3300009094 | Ga0111539_10270656 | Ga0111539_102706563 | 196 |
| 12 | 3300013306 | Ga0163162_10360626 | Ga0163162_103606262 | 196 |
| 13 | 3300035114 | Ga0373939_0016952 | Ga0373939_0016952_174_764 | 196 |
| 14 | 3300035242 | Ga0373962_0043651 | Ga0373962_0043651_78_668 | 196 |
| 15 | 3300042008 | Ga0439450_073522 | Ga0439450_073522_156_764 | 196 |
| 16 | 3300046506 | Ga0495583_0119977 | Ga0495583_0119977_323_913 | 196 |
| 17 | 3300046525 | Ga0495663_0075766 | Ga0495663_0075766_107_697 | 196 |
| 18 | 3300046538 | Ga0495609_0051367 | Ga0495609_0051367_376_966 | 196 |
| 19 | 3300046558 | Ga0495633_0106285 | Ga0495633_0106285_32_622 | 196 |
| 20 | 3300047445 | Ga0495677_0044589 | Ga0495677_0044589_717_1307 | 196 |
| 21 | 3300050511 | nmdc:mga08y16_554138_c1 | nmdc:mga08y16_554138_c1_414_1004 | 196 |
| 22 | 3300005337 | Ga0070682_100568867 | Ga0070682_1005688671 | 199 |
| 23 | 3300009094 | Ga0111539_11168140 | Ga0111539_111681402 | 199 |
| 24 | 3300025937 | Ga0207669_10030866 | Ga0207669_100308663 | 199 |
| 25 | 3300032005 | Ga0307411_10389150 | Ga0307411_103891501 | 199 |
| 26 | 3300048917 | Ga0496114_0390081 | Ga0496114_0390081_400_999 | 199 |
| 27 | 3300005329 | Ga0070683_101053304 | Ga0070683_1010533041 | 200 |
| 28 | 3300005337 | Ga0070682_100240977 | Ga0070682_1002409772 | 200 |
| 29 | 3300005338 | Ga0068868_100373204 | Ga0068868_1003732042 | 200 |
| 30 | 3300005339 | Ga0070660_100163376 | Ga0070660_1001633762 | 200 |
| 31 | 3300005341 | Ga0070691_10070347 | Ga0070691_100703472 | 200 |
| 32 | 3300005341 | Ga0070691_10112486 | Ga0070691_101124862 | 200 |
| 33 | 3300005344 | Ga0070661_100185464 | Ga0070661_1001854643 | 200 |
| 34 | 3300005354 | Ga0070675_100020488 | Ga0070675_1000204883 | 200 |
| 35 | 3300005356 | Ga0070674_100061776 | Ga0070674_1000617763 | 200 |
| 36 | 3300005364 | Ga0070673_100148551 | Ga0070673_1001485513 | 200 |
| 37 | 3300005365 | Ga0070688_100005437 | Ga0070688_1000054374 | 200 |
| 38 | 3300005444 | Ga0070694_100035810 | Ga0070694_1000358105 | 200 |
| 39 | 3300005456 | Ga0070678_100450678 | Ga0070678_1004506782 | 200 |
| 40 | 3300005457 | Ga0070662_100021434 | Ga0070662_1000214343 | 200 |
| 41 | 3300005457 | Ga0070662_100097149 | Ga0070662_1000971492 | 200 |
| 42 | 3300005459 | Ga0068867_100348365 | Ga0068867_1003483652 | 200 |
| 43 | 3300005518 | Ga0070699_100221799 | Ga0070699_1002217992 | 200 |
| 44 | 3300005539 | Ga0068853_100049515 | Ga0068853_1000495152 | 200 |
| 45 | 3300005615 | Ga0070702_100355535 | Ga0070702_1003555351 | 200 |
| 46 | 3300005616 | Ga0068852_100070157 | Ga0068852_1000701573 | 200 |
| 47 | 3300005719 | Ga0068861_100077718 | Ga0068861_1000777182 | 200 |
| 48 | 3300005841 | Ga0068863_100101350 | Ga0068863_1001013503 | 200 |
| 49 | 3300005841 | Ga0068863_100137001 | Ga0068863_1001370013 | 200 |
| 50 | 3300006058 | Ga0075432_10001821 | Ga0075432_100018216 | 200 |
| 51 | 3300006844 | Ga0075428_100007416 | Ga0075428_10000741610 | 200 |
| 52 | 3300006844 | Ga0075428_100024197 | Ga0075428_1000241972 | 200 |
| 53 | 3300006847 | Ga0075431_100018299 | Ga0075431_1000182992 | 200 |
| 54 | 3300006852 | Ga0075433_10006039 | Ga0075433_1000603910 | 200 |
| 55 | 3300006852 | Ga0075433_10029117 | Ga0075433_100291174 | 200 |
| 56 | 3300006871 | Ga0075434_100001158 | Ga0075434_1000011583 | 200 |
| 57 | 3300006871 | Ga0075434_100096668 | Ga0075434_1000966683 | 200 |
| 58 | 3300006880 | Ga0075429_100102338 | Ga0075429_1001023382 | 200 |
| 59 | 3300006881 | Ga0068865_100003980 | Ga0068865_1000039802 | 200 |
| 60 | 3300007076 | Ga0075435_100001832 | Ga0075435_1000018327 | 200 |
| 61 | 3300009094 | Ga0111539_10035517 | Ga0111539_100355179 | 200 |
| 62 | 3300009098 | Ga0105245_10337455 | Ga0105245_103374552 | 200 |
| 63 | 3300009147 | Ga0114129_10013764 | Ga0114129_1001376410 | 200 |
| 64 | 3300009147 | Ga0114129_10034732 | Ga0114129_100347327 | 200 |
| 65 | 3300009148 | Ga0105243_10035150 | Ga0105243_100351503 | 200 |
| 66 | 3300009148 | Ga0105243_10161823 | Ga0105243_101618232 | 200 |
| 67 | 3300009176 | Ga0105242_10036746 | Ga0105242_100367462 | 200 |
| 68 | 3300009176 | Ga0105242_10166151 | Ga0105242_101661512 | 200 |
| 69 | 3300009551 | Ga0105238_10019272 | Ga0105238_100192725 | 200 |
| 70 | 3300009551 | Ga0105238_10091108 | Ga0105238_100911082 | 200 |
| 71 | 3300009553 | Ga0105249_10012973 | Ga0105249_100129739 | 200 |
| 72 | 3300009553 | Ga0105249_10096068 | Ga0105249_100960683 | 200 |
| 73 | 3300010375 | Ga0105239_10047924 | Ga0105239_100479242 | 200 |
| 74 | 3300012506 | Ga0157324_1015542 | Ga0157324_10155421 | 200 |
| 75 | 3300013297 | Ga0157378_10127475 | Ga0157378_101274753 | 200 |
| 76 | 3300013306 | Ga0163162_10188112 | Ga0163162_101881122 | 200 |
| 77 | 3300013306 | Ga0163162_10209525 | Ga0163162_102095251 | 200 |
| 78 | 3300014326 | Ga0157380_10297474 | Ga0157380_102974743 | 200 |
| 79 | 3300014745 | Ga0157377_10120373 | Ga0157377_101203732 | 200 |
| 80 | 3300017792 | Ga0163161_10057590 | Ga0163161_100575902 | 200 |
| 81 | 3300017792 | Ga0163161_10149188 | Ga0163161_101491882 | 200 |
| 82 | 3300025885 | Ga0207653_10001105 | Ga0207653_100011056 | 200 |
| 83 | 3300025899 | Ga0207642_10025373 | Ga0207642_100253732 | 200 |
| 84 | 3300025917 | Ga0207660_10076477 | Ga0207660_100764775 | 200 |
| 85 | 3300025920 | Ga0207649_10035331 | Ga0207649_100353312 | 200 |
| 86 | 3300025924 | Ga0207694_10286894 | Ga0207694_102868942 | 200 |
| 87 | 3300025927 | Ga0207687_10033589 | Ga0207687_100335892 | 200 |
| 88 | 3300025927 | Ga0207687_10322035 | Ga0207687_103220352 | 200 |
| 89 | 3300025933 | Ga0207706_10150330 | Ga0207706_101503302 | 200 |
| 90 | 3300025934 | Ga0207686_10006916 | Ga0207686_100069162 | 200 |
| 91 | 3300025935 | Ga0207709_10039380 | Ga0207709_100393802 | 200 |
| 92 | 3300025935 | Ga0207709_10086539 | Ga0207709_100865392 | 200 |
| 93 | 3300025938 | Ga0207704_10035078 | Ga0207704_100350782 | 200 |
| 94 | 3300025938 | Ga0207704_10591597 | Ga0207704_105915971 | 200 |
| 95 | 3300025945 | Ga0207679_10733044 | Ga0207679_107330441 | 200 |
| 96 | 3300025960 | Ga0207651_10278023 | Ga0207651_102780231 | 200 |
| 97 | 3300025961 | Ga0207712_10020288 | Ga0207712_100202882 | 200 |
| 98 | 3300025961 | Ga0207712_10023292 | Ga0207712_100232923 | 200 |
| 99 | 3300025972 | Ga0207668_10296295 | Ga0207668_102962952 | 200 |
| 100 | 3300025981 | Ga0207640_10176468 | Ga0207640_101764682 | 200 |
| 101 | 3300026023 | Ga0207677_10182491 | Ga0207677_101824912 | 200 |
| 102 | 3300026041 | Ga0207639_10900712 | Ga0207639_109007121 | 200 |
| 103 | 3300026088 | Ga0207641_10755265 | Ga0207641_107552651 | 200 |
| 104 | 3300026089 | Ga0207648_10387655 | Ga0207648_103876552 | 200 |
| 105 | 3300026118 | Ga0207675_100007945 | Ga0207675_1000079456 | 200 |
| 106 | 3300026118 | Ga0207675_100020703 | Ga0207675_1000207035 | 200 |
| 107 | 3300026142 | Ga0207698_10435642 | Ga0207698_104356422 | 200 |
| 108 | 3300027907 | Ga0207428_10268910 | Ga0207428_102689102 | 200 |
| 109 | 3300027907 | Ga0207428_10612031 | Ga0207428_106120311 | 200 |
| 110 | 3300028380 | Ga0268265_10369079 | Ga0268265_103690791 | 200 |
| 111 | 3300028381 | Ga0268264_10225862 | Ga0268264_102258622 | 200 |
| 112 | 3300031548 | Ga0307408_100020271 | Ga0307408_1000202713 | 200 |
| 113 | 3300031731 | Ga0307405_10065610 | Ga0307405_100656101 | 200 |
| 114 | 3300031731 | Ga0307405_10127355 | Ga0307405_101273552 | 200 |
| 115 | 3300031731 | Ga0307405_10246281 | Ga0307405_102462812 | 200 |
| 116 | 3300031824 | Ga0307413_10000383 | Ga0307413_100003838 | 200 |
| 117 | 3300031824 | Ga0307413_10935946 | Ga0307413_109359461 | 200 |
| 118 | 3300031852 | Ga0307410_10008857 | Ga0307410_100088573 | 200 |
| 119 | 3300031852 | Ga0307410_10212447 | Ga0307410_102124473 | 200 |
| 120 | 3300031901 | Ga0307406_10000212 | Ga0307406_1000021232 | 200 |
| 121 | 3300031901 | Ga0307406_10010700 | Ga0307406_100107002 | 200 |
| 122 | 3300031903 | Ga0307407_10000607 | Ga0307407_100006074 | 200 |
| 123 | 3300031903 | Ga0307407_10016246 | Ga0307407_100162463 | 200 |
| 124 | 3300031911 | Ga0307412_10060649 | Ga0307412_100606492 | 200 |
| 125 | 3300031995 | Ga0307409_100000225 | Ga0307409_1000002256 | 200 |
| 126 | 3300031995 | Ga0307409_100011341 | Ga0307409_1000113413 | 200 |
| 127 | 3300032002 | Ga0307416_100006892 | Ga0307416_1000068926 | 200 |
| 128 | 3300032002 | Ga0307416_100017186 | Ga0307416_1000171863 | 200 |
| 129 | 3300032002 | Ga0307416_101906615 | Ga0307416_1019066151 | 200 |
| 130 | 3300032004 | Ga0307414_10021490 | Ga0307414_100214902 | 200 |
| 131 | 3300032005 | Ga0307411_10011939 | Ga0307411_100119392 | 200 |
| 132 | 3300032005 | Ga0307411_10180861 | Ga0307411_101808612 | 200 |
| 133 | 3300032126 | Ga0307415_100000310 | Ga0307415_10000031017 | 200 |
| 134 | 3300032126 | Ga0307415_100000944 | Ga0307415_10000094411 | 200 |
| 135 | 3300032126 | Ga0307415_100349187 | Ga0307415_1003491872 | 200 |
| 136 | 3300039437 | Ga0436365_1768430 | Ga0436365_1768430_680_1288 | 200 |
| 137 | 3300042003 | Ga0439443_018222 | Ga0439443_018222_422_1024 | 200 |
| 138 | 3300042005 | Ga0439448_0044899 | Ga0439448_0044899_599_1201 | 200 |
| 139 | 3300042016 | Ga0439463_008837 | Ga0439463_008837_378_989 | 200 |
| 140 | 3300042016 | Ga0439463_015537 | Ga0439463_015537_1100_1702 | 200 |
| 141 | 3300042461 | Ga0439460_0011921 | Ga0439460_0011921_1225_1827 | 200 |
| 142 | 3300042993 | Ga0439440_0023063 | Ga0439440_0023063_169_771 | 200 |
| 143 | 3300046500 | Ga0495596_0259767 | Ga0495596_0259767_49_651 | 200 |
| 144 | 3300046530 | Ga0495654_0176870 | Ga0495654_0176870_75_677 | 200 |
| 145 | 3300046615 | Ga0495656_0027578 | Ga0495656_0027578_1246_1848 | 200 |
| 146 | 3300046665 | Ga0495661_0190125 | Ga0495661_0190125_351_953 | 200 |
| 147 | 3300050507 | nmdc:mga05p37_24233_c1 | nmdc:mga05p37_24233_c1_4210_4821 | 200 |
| 148 | 3300050507 | nmdc:mga05p37_461167_c1 | nmdc:mga05p37_461167_c1_286_888 | 200 |
| 149 | 3300050508 | nmdc:mga09592_182341_c1 | nmdc:mga09592_182341_c1_769_1371 | 200 |
| 150 | 3300050511 | nmdc:mga08y16_369027_c1 | nmdc:mga08y16_369027_c1_106_810 | 200 |
| 151 | 3300050511 | nmdc:mga08y16_584845_c1 | nmdc:mga08y16_584845_c1_440_1051 | 200 |
| 152 | 3300050512 | nmdc:mga0n895_129937_c1 | nmdc:mga0n895_129937_c1_99_803 | 200 |
| 153 | 3300050512 | nmdc:mga0n895_20861_c1 | nmdc:mga0n895_20861_c1_138_749 | 200 |
| 154 | 3300050513 | nmdc:mga0rr50_29838_c1 | nmdc:mga0rr50_29838_c1_1386_2090 | 200 |
| 155 | 3300050515 | nmdc:mga0a205_234019_c1 | nmdc:mga0a205_234019_c1_911_1615 | 200 |
| 156 | 3300050515 | nmdc:mga0a205_7549_c2 | nmdc:mga0a205_7549_c2_4484_5095 | 200 |
| 157 | 3300053083 | Ga0495655_0107441 | Ga0495655_0107441_221_823 | 200 |
| 158 | 3300003373 | JGI25407J50210_10035000 | JGI25407J50210_100350002 | 201 |
| 159 | 3300005356 | Ga0070674_100067207 | Ga0070674_1000672073 | 201 |
| 160 | 3300005406 | Ga0070703_10000008 | Ga0070703_1000000831 | 201 |
| 161 | 3300005440 | Ga0070705_100037868 | Ga0070705_1000378685 | 201 |
| 162 | 3300005440 | Ga0070705_100098540 | Ga0070705_1000985403 | 201 |
| 163 | 3300005445 | Ga0070708_100000424 | Ga0070708_10000042434 | 201 |
| 164 | 3300005456 | Ga0070678_100136880 | Ga0070678_1001368803 | 201 |
| 165 | 3300005467 | Ga0070706_100102893 | Ga0070706_1001028932 | 201 |
| 166 | 3300005468 | Ga0070707_100006417 | Ga0070707_1000064172 | 201 |
| 167 | 3300005468 | Ga0070707_100086985 | Ga0070707_1000869856 | 201 |
| 168 | 3300005471 | Ga0070698_100031260 | Ga0070698_1000312607 | 201 |
| 169 | 3300005535 | Ga0070684_100232866 | Ga0070684_1002328665 | 201 |
| 170 | 3300005546 | Ga0070696_100063918 | Ga0070696_1000639182 | 201 |
| 171 | 3300005549 | Ga0070704_100176421 | Ga0070704_1001764212 | 201 |
| 172 | 3300005564 | Ga0070664_100551987 | Ga0070664_1005519872 | 201 |
| 173 | 3300005840 | Ga0068870_10020068 | Ga0068870_100200682 | 201 |
| 174 | 3300005937 | Ga0081455_10150828 | Ga0081455_101508283 | 201 |
| 175 | 3300005937 | Ga0081455_10298687 | Ga0081455_102986872 | 201 |
| 176 | 3300005981 | Ga0081538_10002217 | Ga0081538_1000221717 | 201 |
| 177 | 3300005981 | Ga0081538_10004419 | Ga0081538_100044194 | 201 |
| 178 | 3300005981 | Ga0081538_10006141 | Ga0081538_100061413 | 201 |
| 179 | 3300005981 | Ga0081538_10013476 | Ga0081538_100134763 | 201 |
| 180 | 3300005981 | Ga0081538_10026659 | Ga0081538_100266594 | 201 |
| 181 | 3300005981 | Ga0081538_10049333 | Ga0081538_100493332 | 201 |
| 182 | 3300005981 | Ga0081538_10051612 | Ga0081538_100516123 | 201 |
| 183 | 3300005981 | Ga0081538_10204590 | Ga0081538_102045901 | 201 |
| 184 | 3300005983 | Ga0081540_1047461 | Ga0081540_10474612 | 201 |
| 185 | 3300005985 | Ga0081539_10010991 | Ga0081539_100109913 | 201 |
| 186 | 3300005985 | Ga0081539_10036540 | Ga0081539_100365404 | 201 |
| 187 | 3300006058 | Ga0075432_10004080 | Ga0075432_100040803 | 201 |
| 188 | 3300006194 | Ga0075427_10002455 | Ga0075427_100024553 | 201 |
| 189 | 3300006237 | Ga0097621_100199279 | Ga0097621_1001992792 | 201 |
| 190 | 3300006844 | Ga0075428_100031225 | Ga0075428_1000312253 | 201 |
| 191 | 3300006844 | Ga0075428_100184721 | Ga0075428_1001847212 | 201 |
| 192 | 3300006846 | Ga0075430_100012632 | Ga0075430_1000126326 | 201 |
| 193 | 3300006846 | Ga0075430_100085531 | Ga0075430_1000855312 | 201 |
| 194 | 3300006847 | Ga0075431_100530893 | Ga0075431_1005308931 | 201 |
| 195 | 3300006852 | Ga0075433_10034014 | Ga0075433_100340142 | 201 |
| 196 | 3300006871 | Ga0075434_100000282 | Ga0075434_1000002824 | 201 |
| 197 | 3300006880 | Ga0075429_100007437 | Ga0075429_1000074377 | 201 |
| 198 | 3300006880 | Ga0075429_100030139 | Ga0075429_1000301392 | 201 |
| 199 | 3300006881 | Ga0068865_100034162 | Ga0068865_1000341624 | 201 |
| 200 | 3300007076 | Ga0075435_100003603 | Ga0075435_1000036033 | 201 |
| 201 | 3300009094 | Ga0111539_10002959 | Ga0111539_1000295910 | 201 |
| 202 | 3300009098 | Ga0105245_10244560 | Ga0105245_102445602 | 201 |
| 203 | 3300009098 | Ga0105245_10258061 | Ga0105245_102580611 | 201 |
| 204 | 3300009147 | Ga0114129_10025352 | Ga0114129_100253527 | 201 |
| 205 | 3300009147 | Ga0114129_10194547 | Ga0114129_101945472 | 201 |
| 206 | 3300009147 | Ga0114129_10228966 | Ga0114129_102289664 | 201 |
| 207 | 3300009148 | Ga0105243_10018567 | Ga0105243_100185674 | 201 |
| 208 | 3300009148 | Ga0105243_10191433 | Ga0105243_101914333 | 201 |
| 209 | 3300009176 | Ga0105242_10004050 | Ga0105242_1000405011 | 201 |
| 210 | 3300009176 | Ga0105242_11214742 | Ga0105242_112147421 | 201 |
| 211 | 3300009553 | Ga0105249_10688941 | Ga0105249_106889411 | 201 |
| 212 | 3300013306 | Ga0163162_10069118 | Ga0163162_100691185 | 201 |
| 213 | 3300014325 | Ga0163163_10103155 | Ga0163163_101031552 | 201 |
| 214 | 3300014325 | Ga0163163_10548264 | Ga0163163_105482642 | 201 |
| 215 | 3300014497 | Ga0182008_10062143 | Ga0182008_100621432 | 201 |
| 216 | 3300025885 | Ga0207653_10000003 | Ga0207653_1000000340 | 201 |
| 217 | 3300025908 | Ga0207643_10032727 | Ga0207643_100327273 | 201 |
| 218 | 3300025910 | Ga0207684_10000025 | Ga0207684_10000025158 | 201 |
| 219 | 3300025910 | Ga0207684_10033061 | Ga0207684_100330615 | 201 |
| 220 | 3300025922 | Ga0207646_10145306 | Ga0207646_101453063 | 201 |
| 221 | 3300025934 | Ga0207686_10440743 | Ga0207686_104407432 | 201 |
| 222 | 3300025935 | Ga0207709_10026602 | Ga0207709_100266023 | 201 |
| 223 | 3300025937 | Ga0207669_10048065 | Ga0207669_100480653 | 201 |
| 224 | 3300025938 | Ga0207704_10145453 | Ga0207704_101454532 | 201 |
| 225 | 3300025938 | Ga0207704_10313815 | Ga0207704_103138152 | 201 |
| 226 | 3300025981 | Ga0207640_10506344 | Ga0207640_105063441 | 201 |
| 227 | 3300026121 | Ga0207683_10109861 | Ga0207683_101098612 | 201 |
| 228 | 3300027907 | Ga0207428_10002935 | Ga0207428_100029355 | 201 |
| 229 | 3300031456 | Ga0307513_10027910 | Ga0307513_100279105 | 201 |
| 230 | 3300031548 | Ga0307408_100882324 | Ga0307408_1008823241 | 201 |
| 231 | 3300031731 | Ga0307405_10020715 | Ga0307405_100207153 | 201 |
| 232 | 3300031824 | Ga0307413_10243594 | Ga0307413_102435941 | 201 |
| 233 | 3300031852 | Ga0307410_10051632 | Ga0307410_100516323 | 201 |
| 234 | 3300031852 | Ga0307410_10072240 | Ga0307410_100722403 | 201 |
| 235 | 3300031852 | Ga0307410_10144960 | Ga0307410_101449602 | 201 |
| 236 | 3300031852 | Ga0307410_10256704 | Ga0307410_102567042 | 201 |
| 237 | 3300031901 | Ga0307406_10081837 | Ga0307406_100818372 | 201 |
| 238 | 3300031903 | Ga0307407_10012672 | Ga0307407_100126724 | 201 |
| 239 | 3300031911 | Ga0307412_10106316 | Ga0307412_101063163 | 201 |
| 240 | 3300031911 | Ga0307412_10131567 | Ga0307412_101315672 | 201 |
| 241 | 3300031911 | Ga0307412_10149791 | Ga0307412_101497911 | 201 |
| 242 | 3300031995 | Ga0307409_100065983 | Ga0307409_1000659834 | 201 |
| 243 | 3300031995 | Ga0307409_100076990 | Ga0307409_1000769903 | 201 |
| 244 | 3300032002 | Ga0307416_100098752 | Ga0307416_1000987522 | 201 |
| 245 | 3300032004 | Ga0307414_10497169 | Ga0307414_104971692 | 201 |
| 246 | 3300032005 | Ga0307411_10260369 | Ga0307411_102603692 | 201 |
| 247 | 3300032126 | Ga0307415_100028001 | Ga0307415_1000280013 | 201 |
| 248 | 3300032126 | Ga0307415_100053976 | Ga0307415_1000539765 | 201 |
| 249 | 3300032126 | Ga0307415_100081504 | Ga0307415_1000815042 | 201 |
| 250 | 3300035171 | Ga0373946_0056616 | Ga0373946_0056616_108_713 | 201 |
| 251 | 3300035695 | Ga0373927_0181566 | Ga0373927_0181566_372_977 | 201 |
| 252 | 3300037068 | Ga0373925_0259179 | Ga0373925_0259179_130_735 | 201 |
| 253 | 3300037312 | Ga0395899_0229359 | Ga0395899_0229359_602_1213 | 201 |
| 254 | 3300037418 | Ga0395900_0773398 | Ga0395900_0773398_59_670 | 201 |
| 255 | 3300037466 | Ga0395898_0241614 | Ga0395898_0241614_841_1452 | 201 |
| 256 | 3300037466 | Ga0395898_0360754 | Ga0395898_0360754_572_1177 | 201 |
| 257 | 3300037471 | Ga0395905_0317558 | Ga0395905_0317558_55_666 | 201 |
| 258 | 3300037471 | Ga0395905_0480191 | Ga0395905_0480191_304_915 | 201 |
| 259 | 3300038443 | Ga0395901_0031026 | Ga0395901_0031026_2793_3398 | 201 |
| 260 | 3300038443 | Ga0395901_0178070 | Ga0395901_0178070_273_884 | 201 |
| 261 | 3300038443 | Ga0395901_0224988 | Ga0395901_0224988_1295_1906 | 201 |
| 262 | 3300038443 | Ga0395901_0647415 | Ga0395901_0647415_301_912 | 201 |
| 263 | 3300042005 | Ga0439448_0006352 | Ga0439448_0006352_2406_3017 | 201 |
| 264 | 3300042005 | Ga0439448_0020975 | Ga0439448_0020975_230_841 | 201 |
| 265 | 3300042011 | Ga0439454_033046 | Ga0439454_033046_163_774 | 201 |
| 266 | 3300042012 | Ga0439455_0024379 | Ga0439455_0024379_372_983 | 201 |
| 267 | 3300042016 | Ga0439463_000643 | Ga0439463_000643_6156_6767 | 201 |
| 268 | 3300042126 | Ga0450888_003953 | Ga0450888_003953_249_854 | 201 |
| 269 | 3300042142 | Ga0450905_019267 | Ga0450905_019267_372_983 | 201 |
| 270 | 3300042436 | Ga0439435_0095006 | Ga0439435_0095006_94_705 | 201 |
| 271 | 3300042437 | Ga0439444_0004731 | Ga0439444_0004731_1074_1685 | 201 |
| 272 | 3300042439 | Ga0439464_0047898 | Ga0439464_0047898_16_627 | 201 |
| 273 | 3300042461 | Ga0439460_0005360 | Ga0439460_0005360_376_987 | 201 |
| 274 | 3300042461 | Ga0439460_0031842 | Ga0439460_0031842_598_1209 | 201 |
| 275 | 3300042993 | Ga0439440_0001730 | Ga0439440_0001730_607_1218 | 201 |
| 276 | 3300042993 | Ga0439440_0020710 | Ga0439440_0020710_251_856 | 201 |
| 277 | 3300046455 | Ga0495603_0045446 | Ga0495603_0045446_1913_2518 | 201 |
| 278 | 3300046459 | Ga0495629_0044346 | Ga0495629_0044346_1652_2257 | 201 |
| 279 | 3300046460 | Ga0495638_0175602 | Ga0495638_0175602_511_1173 | 201 |
| 280 | 3300046461 | Ga0495641_0135009 | Ga0495641_0135009_391_996 | 201 |
| 281 | 3300046463 | Ga0495653_0090967 | Ga0495653_0090967_722_1327 | 201 |
| 282 | 3300046472 | Ga0495580_0106218 | Ga0495580_0106218_422_1027 | 201 |
| 283 | 3300046475 | Ga0495639_0030829 | Ga0495639_0030829_378_983 | 201 |
| 284 | 3300046517 | Ga0495630_0106981 | Ga0495630_0106981_1160_1765 | 201 |
| 285 | 3300046523 | Ga0495644_0055671 | Ga0495644_0055671_692_1303 | 201 |
| 286 | 3300046533 | Ga0495640_0040979 | Ga0495640_0040979_247_852 | 201 |
| 287 | 3300046542 | Ga0495597_0277111 | Ga0495597_0277111_33_644 | 201 |
| 288 | 3300046681 | Ga0495647_0010919 | Ga0495647_0010919_1864_2469 | 201 |
| 289 | 3300046681 | Ga0495647_0324010 | Ga0495647_0324010_20_631 | 201 |
| 290 | 3300046689 | Ga0495613_0015690 | Ga0495613_0015690_1494_2099 | 201 |
| 291 | 3300046690 | Ga0495624_0134648 | Ga0495624_0134648_34_639 | 201 |
| 292 | 3300046691 | Ga0495670_0021632 | Ga0495670_0021632_1595_2212 | 201 |
| 293 | 3300047315 | Ga0495581_0123450 | Ga0495581_0123450_316_921 | 201 |
| 294 | 3300047321 | Ga0495676_0105673 | Ga0495676_0105673_884_1489 | 201 |
| 295 | 3300047322 | Ga0495680_0016288 | Ga0495680_0016288_3103_3708 | 201 |
| 296 | 3300047471 | Ga0495684_0012395 | Ga0495684_0012395_3554_4159 | 201 |
| 297 | 3300048903 | Ga0496100_0460340 | Ga0496100_0460340_341_952 | 201 |
| 298 | 3300048903 | Ga0496100_0858696 | Ga0496100_0858696_30_635 | 201 |
| 299 | 3300048905 | Ga0496102_0014708 | Ga0496102_0014708_4716_5327 | 201 |
| 300 | 3300048906 | Ga0496103_0125416 | Ga0496103_0125416_264_875 | 201 |
| 301 | 3300048907 | Ga0496104_0704972 | Ga0496104_0704972_95_700 | 201 |
| 302 | 3300048911 | Ga0496108_0115926 | Ga0496108_0115926_365_982 | 201 |
| 303 | 3300048912 | Ga0496109_0013024 | Ga0496109_0013024_4651_5268 | 201 |
| 304 | 3300048914 | Ga0496111_0367247 | Ga0496111_0367247_69_680 | 201 |
| 305 | 3300049522 | Ga0501299_034483 | Ga0501299_034483_192_803 | 201 |
| 306 | 3300049571 | Ga0501034_0193216 | Ga0501034_0193216_841_1464 | 201 |
| 307 | 3300049587 | Ga0501071_0530338 | Ga0501071_0530338_238_849 | 201 |
| 308 | 3300049653 | Ga0501206_032409 | Ga0501206_032409_78_728 | 201 |
| 309 | 3300049675 | Ga0501243_021472 | Ga0501243_021472_116_766 | 201 |
| 310 | 3300049768 | Ga0501271_008019 | Ga0501271_008019_221_871 | 201 |
| 311 | 3300050507 | nmdc:mga05p37_17510_c1 | nmdc:mga05p37_17510_c1_6901_7512 | 201 |
| 312 | 3300050507 | nmdc:mga05p37_198700_c2 | nmdc:mga05p37_198700_c2_615_1220 | 201 |
| 313 | 3300050507 | nmdc:mga05p37_59323_c1 | nmdc:mga05p37_59323_c1_564_1175 | 201 |
| 314 | 3300050508 | nmdc:mga09592_23642_c1 | nmdc:mga09592_23642_c1_2343_2948 | 201 |
| 315 | 3300050508 | nmdc:mga09592_40109_c1 | nmdc:mga09592_40109_c1_1954_2565 | 201 |
| 316 | 3300050509 | nmdc:mga0qj67_17946_c1 | nmdc:mga0qj67_17946_c1_4302_4907 | 201 |
| 317 | 3300050509 | nmdc:mga0qj67_1820_c1 | nmdc:mga0qj67_1820_c1_9397_10008 | 201 |
| 318 | 3300050510 | nmdc:mga06r32_29218_c1 | nmdc:mga06r32_29218_c1_193_798 | 201 |
| 319 | 3300050510 | nmdc:mga06r32_5618_c1 | nmdc:mga06r32_5618_c1_8585_9196 | 201 |
| 320 | 3300050511 | nmdc:mga08y16_8129_c1 | nmdc:mga08y16_8129_c1_6473_7084 | 201 |
| 321 | 3300050512 | nmdc:mga0n895_1197_c1 | nmdc:mga0n895_1197_c1_5252_5863 | 201 |
| 322 | 3300050513 | nmdc:mga0rr50_9139_c1 | nmdc:mga0rr50_9139_c1_3707_4318 | 201 |
| 323 | 3300050514 | nmdc:mga08x19_61623_c1 | nmdc:mga08x19_61623_c1_406_1017 | 201 |
| 324 | 3300050515 | nmdc:mga0a205_1542_c1 | nmdc:mga0a205_1542_c1_1059_1670 | 201 |
| 325 | 3300050515 | nmdc:mga0a205_3599_c1 | nmdc:mga0a205_3599_c1_8177_8788 | 201 |
| 326 | 3300053085 | Ga0495619_0012186 | Ga0495619_0012186_3305_3910 | 201 |
| 327 | 3300003203 | JGI25406J46586_10011940 | JGI25406J46586_100119403 | 202 |
| 328 | 3300003911 | JGI25405J52794_10053470 | JGI25405J52794_100534701 | 202 |
| 329 | 3300005937 | Ga0081455_10001839 | Ga0081455_100018397 | 202 |
| 330 | 3300005937 | Ga0081455_10009825 | Ga0081455_100098257 | 202 |
| 331 | 3300005937 | Ga0081455_10033822 | Ga0081455_100338224 | 202 |
| 332 | 3300005937 | Ga0081455_10058395 | Ga0081455_100583952 | 202 |
| 333 | 3300005937 | Ga0081455_10062331 | Ga0081455_100623312 | 202 |
| 334 | 3300005985 | Ga0081539_10003126 | Ga0081539_100031269 | 202 |
| 335 | 3300005985 | Ga0081539_10030978 | Ga0081539_100309782 | 202 |
| 336 | 3300006844 | Ga0075428_100019243 | Ga0075428_1000192435 | 202 |
| 337 | 3300009147 | Ga0114129_10642365 | Ga0114129_106423652 | 202 |
| 338 | 3300031548 | Ga0307408_101168827 | Ga0307408_1011688271 | 202 |
| 339 | 3300031731 | Ga0307405_10512884 | Ga0307405_105128841 | 202 |
| 340 | 3300031852 | Ga0307410_10148680 | Ga0307410_101486802 | 202 |
| 341 | 3300032002 | Ga0307416_100414826 | Ga0307416_1004148262 | 202 |
| 342 | 3300032004 | Ga0307414_10631175 | Ga0307414_106311752 | 202 |
| 343 | 3300032005 | Ga0307411_10703546 | Ga0307411_107035461 | 202 |
| 344 | 3300032126 | Ga0307415_100065316 | Ga0307415_1000653162 | 202 |
| 345 | 3300032126 | Ga0307415_100157592 | Ga0307415_1001575923 | 202 |
| 346 | 3300037312 | Ga0395899_0265174 | Ga0395899_0265174_522_1148 | 202 |
| 347 | 3300037418 | Ga0395900_0420028 | Ga0395900_0420028_76_702 | 202 |
| 348 | 3300037466 | Ga0395898_0127802 | Ga0395898_0127802_535_1161 | 202 |
| 349 | 3300037471 | Ga0395905_0010556 | Ga0395905_0010556_6778_7389 | 202 |
| 350 | 3300037471 | Ga0395905_0081776 | Ga0395905_0081776_1145_1771 | 202 |
| 351 | 3300038443 | Ga0395901_0312375 | Ga0395901_0312375_457_1083 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.8043 | 2 | 191 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.7844 | 1 | 193 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.7804 | 1 | 193 |
| 2gd9-assembly1.cif.gz_A | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.7784 | 2 | 191 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.7694 | 3 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8064 | 3 | 197 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8034 | 2 | 189 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7978 | 3 | 197 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7942 | 2 | 189 | 3.40.430.10 |
| 3ky8B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7611 | 4 | 191 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y0BKG4-F1-model_v4 | H148 | 0.9416 | 1 | 193 |
GO:0008703
GO:0009231 |
| AF-A0A1H8KVU2-F1-model_v4 | Dihydrofolate reductase | 0.9413 | 1 | 193 |
GO:0008703
GO:0009231 |
| AF-D3CVG2-F1-model_v4 | Bifunctional deaminase-reductase domain protein | 0.9402 | 1 | 193 |
GO:0008703
GO:0009231 |
| AF-A0A6G9H8H5-F1-model_v4 | Dihydrofolate reductase | 0.9398 | 1 | 193 |
GO:0008703
GO:0009231 |
| AF-A0A6G9H8H5-F1-model_v4 | Dihydrofolate reductase | 0.9347 | 1 | 193 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar