F418588

General Info

Members Datasets Scaffolds Average Seq Length
351 251 350 118

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100006029|Ga0070716_1000060298
Length 133
Sequence MSPDRLSATFAALADPTRRAILARLASGETTVSELARPFEMSLPAVTKHLKVLQRAGLISQGRQAQWRPCKLEAEPLQDVSNWVEQYRQFWEQRLDRLEEYLRELQASAADEQMGKAPAAVSKAKGKKEGKKK

Samples

Sample ID Description Type Environment
1 2849660919 Nostoc sp. T09 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0.57
Rhizoplane 1.99
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10041416 3300003322 Bacteria 2499
2 Ga0055524_1000038 3300003775 Bacteria 162683
3 Ga0065165_1080963 3300005262 Bacteria 843
4 Ga0070676_10063803 3300005328 Bacteria 2195
5 Ga0070676_10497159 3300005328 Bacteria 865
6 Ga0070683_100996038 3300005329 Bacteria 805
7 Ga0070670_100091612 3300005331 Bacteria 2613
8 Ga0070670_102106486 3300005331 Bacteria 520
9 Ga0070677_10234492 3300005333 Unclassified 903
10 Ga0070677_10395583 3300005333 Bacteria 727
11 Ga0068869_100353147 3300005334 Bacteria 1199
12 Ga0068869_100929957 3300005334 Bacteria 754
13 Ga0070666_10663215 3300005335 Bacteria 764
14 Ga0070680_100500550 3300005336 Bacteria 1040
15 Ga0070682_100026718 3300005337 Bacteria 3458
16 Ga0070682_100113132 3300005337 Bacteria 1812
17 Ga0070682_101125205 3300005337 Bacteria 659
18 Ga0070682_101519621 3300005337 Bacteria 576
19 Ga0068868_102409066 3300005338 Bacteria 503
20 Ga0070689_100464227 3300005340 Bacteria 1079
21 Ga0070691_10110247 3300005341 Bacteria 1376
22 Ga0070661_100207787 3300005344 Bacteria 1498
23 Ga0070661_100397506 3300005344 Bacteria 1089
24 Ga0070661_101332029 3300005344 Bacteria 603
25 Ga0070668_100387141 3300005347 Bacteria 1191
26 Ga0070669_100020291 3300005353 Bacteria 4746
27 Ga0070675_100282138 3300005354 Bacteria 1460
28 Ga0070675_101122289 3300005354 Bacteria 723
29 Ga0070675_101375244 3300005354 Bacteria 651
30 Ga0070671_101572101 3300005355 Bacteria 583
31 Ga0070674_100035393 3300005356 Bacteria 3344
32 Ga0070674_100445273 3300005356 Bacteria 1068
33 Ga0070688_100077407 3300005365 Bacteria 2143
34 Ga0070659_100698572 3300005366 Bacteria 877
35 Ga0070703_10366235 3300005406 Bacteria 619
36 Ga0070713_100098198 3300005436 Bacteria 2532
37 Ga0070701_10125753 3300005438 Bacteria 1451
38 Ga0070705_101205477 3300005440 Bacteria 624
39 Ga0070700_100030763 3300005441 Bacteria 3212
40 Ga0070700_100477808 3300005441 Bacteria 954
41 Ga0070694_100047705 3300005444 Bacteria 2880
42 Ga0070708_100221011 3300005445 Bacteria 1776
43 Ga0070663_100211456 3300005455 Bacteria 1519
44 Ga0070663_100409372 3300005455 Bacteria 1110
45 Ga0070678_101988621 3300005456 Bacteria 550
46 Ga0070662_100614570 3300005457 Bacteria 915
47 Ga0070681_11124606 3300005458 Bacteria 706
48 Ga0068867_100014234 3300005459 Bacteria 5635
49 Ga0070706_100788371 3300005467 Bacteria 880
50 Ga0070706_101339022 3300005467 Bacteria 656
51 Ga0070707_100001366 3300005468 Bacteria 23969
52 Ga0070707_100036366 3300005468 Bacteria 4698
53 Ga0070707_100716251 3300005468 Bacteria 964
54 Ga0070698_101774508 3300005471 Bacteria 570
55 Ga0070699_100002889 3300005518 Bacteria 15295
56 Ga0070699_100030337 3300005518 Bacteria 4667
57 Ga0070699_100954253 3300005518 Bacteria 786
58 Ga0068853_100759348 3300005539 Bacteria 927
59 Ga0070672_100179515 3300005543 Bacteria 1764
60 Ga0070672_100231930 3300005543 Bacteria 1551
61 Ga0070686_100479987 3300005544 Bacteria 961
62 Ga0070695_100042751 3300005545 Bacteria 2878
63 Ga0070695_100457122 3300005545 Bacteria 979
64 Ga0070696_100027108 3300005546 Bacteria 3901
65 Ga0070696_100178166 3300005546 Bacteria 1575
66 Ga0070693_100041090 3300005547 Bacteria 2600
67 Ga0070693_101031102 3300005547 Bacteria 624
68 Ga0070665_100000506 3300005548 Bacteria 55878
69 Ga0070665_100010886 3300005548 Bacteria 9202
70 Ga0068855_100548914 3300005563 Bacteria 1251
71 Ga0070664_100373169 3300005564 Bacteria 1301
72 Ga0070664_101216507 3300005564 Bacteria 711
73 Ga0068857_101025057 3300005577 Bacteria 795
74 Ga0068856_100704261 3300005614 Bacteria 1030
75 Ga0070702_100783015 3300005615 Bacteria 736
76 Ga0068852_100113176 3300005616 Bacteria 2471
77 Ga0068852_101237462 3300005616 Bacteria 768
78 Ga0068859_100529470 3300005617 Bacteria 1273
79 Ga0068864_100505682 3300005618 Bacteria 1163
80 Ga0068864_100712860 3300005618 Bacteria 981
81 Ga0068864_100871594 3300005618 Bacteria 888
82 Ga0068861_100026151 3300005719 Bacteria 4241
83 Ga0068862_100149645 3300005844 Bacteria 2077
84 Ga0068862_100240436 3300005844 Bacteria 1646
85 Ga0068862_101821539 3300005844 Bacteria 618
86 Ga0081539_10003773 3300005985 Bacteria 17925
87 Ga0075365_10003028 3300006038 Bacteria 8524
88 Ga0070715_10756052 3300006163 Bacteria 586
89 Ga0070716_100006029 3300006173 Bacteria 5905
90 Ga0075369_10021726 3300006186 Bacteria 2641
91 Ga0075366_10051467 3300006195 Bacteria 2447
92 Ga0075366_10169508 3300006195 Bacteria 1325
93 Ga0075366_10413788 3300006195 Bacteria 830
94 Ga0097621_100005834 3300006237 Bacteria 8698
95 Ga0068871_100031256 3300006358 Bacteria 4198
96 Ga0068871_100479284 3300006358 Bacteria 1119
97 Ga0068871_100689528 3300006358 Bacteria 935
98 Ga0075428_100112618 3300006844 Bacteria 2964
99 Ga0075428_100793935 3300006844 Bacteria 1006
100 Ga0075428_100864505 3300006844 Bacteria 960
101 Ga0075428_101139529 3300006844 Bacteria 823
102 Ga0075430_100610809 3300006846 Bacteria 900
103 Ga0075430_100685205 3300006846 Bacteria 845
104 Ga0075430_101540177 3300006846 Bacteria 546
105 Ga0075431_100001035 3300006847 Bacteria 24776
106 Ga0075433_10005572 3300006852 Bacteria 9890
107 Ga0075433_10140582 3300006852 Bacteria 2146
108 Ga0075433_10962120 3300006852 Bacteria 744
109 Ga0075434_101909815 3300006871 Bacteria 600
110 Ga0075429_100539540 3300006880 Bacteria 1022
111 Ga0068865_100381050 3300006881 Bacteria 1150
112 Ga0068865_100902214 3300006881 Bacteria 769
113 Ga0075436_100529217 3300006914 Bacteria 864
114 Ga0097620_100529509 3300006931 Bacteria 1273
115 Ga0099826_10000008 3300006948 Bacteria 380974
116 Ga0111539_10340367 3300009094 Bacteria 1746
117 Ga0114129_10034350 3300009147 Bacteria 7161
118 Ga0114129_10845720 3300009147 Bacteria 1164
119 Ga0114129_11856015 3300009147 Bacteria 732
120 Ga0105243_10366004 3300009148 Bacteria 1329
121 Ga0105243_10594436 3300009148 Bacteria 1064
122 Ga0105243_11766272 3300009148 Bacteria 649
123 Ga0105243_12600024 3300009148 Bacteria 546
124 Ga0105241_11090551 3300009174 Bacteria 751
125 Ga0105242_11119461 3300009176 Bacteria 802
126 Ga0105237_10000005 3300009545 Bacteria 390765
127 Ga0105237_10640499 3300009545 Unclassified 1070
128 Ga0105238_10028358 3300009551 Bacteria 5705
129 Ga0105238_10133302 3300009551 Bacteria 2462
130 Ga0105249_10402294 3300009553 Bacteria 1400
131 Ga0105249_11328450 3300009553 Bacteria 791
132 Ga0105249_12701507 3300009553 Bacteria 568
133 Ga0157373_10835550 3300013100 Bacteria 681
134 Ga0157370_10007517 3300013104 Bacteria 11839
135 Ga0157369_10028416 3300013105 Bacteria 6190
136 Ga0157378_11975482 3300013297 Bacteria 633
137 Ga0157378_12476486 3300013297 Bacteria 571
138 Ga0157372_10002223 3300013307 Bacteria 21051
139 Ga0157372_12006239 3300013307 Bacteria 665
140 Ga0157375_10521710 3300013308 Bacteria 1351
141 Ga0157375_11641469 3300013308 Bacteria 760
142 Ga0163163_10478371 3300014325 Bacteria 1306
143 Ga0157380_10009780 3300014326 Bacteria 6884
144 Ga0157377_10540369 3300014745 Bacteria 821
145 Ga0157376_10264869 3300014969 Bacteria 1612
146 Ga0157376_10271566 3300014969 Unclassified 1593
147 Ga0157376_10411972 3300014969 Bacteria 1309
148 Ga0163161_10366260 3300017792 Bacteria 1149
149 Ga0209565_1004596 3300025263 Bacteria 4163
150 Ga0209564_1029956 3300025295 Bacteria 1698
151 Ga0209256_1000018 3300025299 Bacteria 568467
152 Ga0209257_1001468 3300025304 Bacteria 27780
153 Ga0207653_10129600 3300025885 Bacteria 915
154 Ga0207682_10022479 3300025893 Bacteria 2485
155 Ga0207682_10042318 3300025893 Bacteria 1861
156 Ga0207682_10245776 3300025893 Bacteria 832
157 Ga0207710_10089056 3300025900 Bacteria 1442
158 Ga0207680_10693063 3300025903 Bacteria 730
159 Ga0207699_10020130 3300025906 Bacteria 3571
160 Ga0207699_10492811 3300025906 Unclassified 884
161 Ga0207645_10504588 3300025907 Bacteria 819
162 Ga0207705_10581168 3300025909 Bacteria 871
163 Ga0207684_10179544 3300025910 Bacteria 1825
164 Ga0207671_10000004 3300025914 Bacteria 1022356
165 Ga0207660_10199277 3300025917 Bacteria 1563
166 Ga0207649_10173231 3300025920 Bacteria 1505
167 Ga0207649_11269358 3300025920 Bacteria 582
168 Ga0207646_10059529 3300025922 Bacteria 3411
169 Ga0207646_10128926 3300025922 Bacteria 2276
170 Ga0207646_10614821 3300025922 Bacteria 975
171 Ga0207694_10134484 3300025924 Bacteria 1984
172 Ga0207659_10278042 3300025926 Bacteria 1368
173 Ga0207659_10865574 3300025926 Bacteria 777
174 Ga0207700_10145946 3300025928 Bacteria 1950
175 Ga0207664_10342007 3300025929 Bacteria 1323
176 Ga0207690_10279538 3300025932 Bacteria 1300
177 Ga0207690_10579197 3300025932 Bacteria 915
178 Ga0207690_11571688 3300025932 Bacteria 550
179 Ga0207686_11174457 3300025934 Bacteria 628
180 Ga0207709_10670085 3300025935 Bacteria 828
181 Ga0207709_10741373 3300025935 Bacteria 789
182 Ga0207709_11762155 3300025935 Bacteria 515
183 Ga0207670_10492162 3300025936 Bacteria 995
184 Ga0207670_10496126 3300025936 Bacteria 991
185 Ga0207669_10270802 3300025937 Bacteria 1275
186 Ga0207669_10670863 3300025937 Bacteria 850
187 Ga0207665_10010245 3300025939 Bacteria 6158
188 Ga0207691_10161961 3300025940 Bacteria 1962
189 Ga0207691_10240483 3300025940 Bacteria 1565
190 Ga0207689_10098217 3300025942 Bacteria 2405
191 Ga0207689_10401698 3300025942 Bacteria 1142
192 Ga0207689_11162336 3300025942 Bacteria 650
193 Ga0207661_10215524 3300025944 Bacteria 1694
194 Ga0207679_10035641 3300025945 Bacteria 3522
195 Ga0207679_10110515 3300025945 Bacteria 2168
196 Ga0207679_11253564 3300025945 Bacteria 680
197 Ga0207668_10103126 3300025972 Bacteria 2124
198 Ga0207640_11117674 3300025981 Bacteria 698
199 Ga0207677_11680958 3300026023 Bacteria 588
200 Ga0207678_10880450 3300026067 Bacteria 792
201 Ga0207678_11232025 3300026067 Bacteria 662
202 Ga0207708_10034163 3300026075 Bacteria 3867
203 Ga0207702_11069338 3300026078 Bacteria 801
204 Ga0207676_10431718 3300026095 Bacteria 1238
205 Ga0207674_10610657 3300026116 Bacteria 1053
206 Ga0207675_100102990 3300026118 Bacteria 2690
207 Ga0207675_100204454 3300026118 Bacteria 1897
208 Ga0207683_11089565 3300026121 Bacteria 741
209 Ga0207698_10331001 3300026142 Bacteria 1431
210 Ga0209282_1000005 3300027666 Bacteria 380858
211 Ga0268266_10005963 3300028379 Bacteria 11261
212 Ga0268266_10010750 3300028379 Bacteria 7975
213 Ga0268265_11090043 3300028380 Bacteria 792
214 Ga0268265_11815927 3300028380 Bacteria 616
215 Ga0307511_10000022 3300030521 Bacteria 116875
216 Ga0265325_10001851 3300031241 Bacteria 14616
217 Ga0265339_10003286 3300031249 Bacteria 11320
218 Ga0307513_10017244 3300031456 Bacteria 8663
219 Ga0307408_100115649 3300031548 Bacteria 2069
220 Ga0307408_100449066 3300031548 Bacteria 1118
221 Ga0307408_100522172 3300031548 Bacteria 1043
222 Ga0307514_10462085 3300031649 Bacteria 619
223 Ga0307405_10147879 3300031731 Bacteria 1648
224 Ga0307405_10607685 3300031731 Bacteria 893
225 Ga0307405_10683403 3300031731 Bacteria 848
226 Ga0307413_10038288 3300031824 Bacteria 2778
227 Ga0307406_10007638 3300031901 Bacteria 6005
228 Ga0307407_10011162 3300031903 Bacteria 4265
229 Ga0307412_10658129 3300031911 Bacteria 894
230 Ga0307409_101465753 3300031995 Bacteria 709
231 Ga0307416_100009952 3300032002 Bacteria 6257
232 Ga0307411_10001622 3300032005 Bacteria 9376
233 Ga0307411_10354487 3300032005 Bacteria 1197
234 Ga0307415_100035464 3300032126 Bacteria 3258
235 Ga0307415_100833912 3300032126 Bacteria 844
236 Ga0307415_102125082 3300032126 Bacteria 548
237 Ga0373950_0161752 3300034818 Bacteria 518
238 Ga0373952_0194649 3300035092 Bacteria 591
239 Ga0373936_0052099 3300035113 Bacteria 1658
240 Ga0373960_0354624 3300035121 Bacteria 557
241 Ga0373961_0156007 3300035241 Bacteria 781
242 Ga0373924_0003018 3300035410 Bacteria 5732
243 Ga0395898_1454620 3300037466 Bacteria 612
244 Ga0395905_1302780 3300037471 Unclassified 630
245 Ga0436364_0294406 3300037853 Bacteria 4598
246 Ga0436360_0389148 3300039438 Bacteria 641
247 Ga0436363_0108953 3300039450 Bacteria 2916
248 Ga0436363_1214520 3300039450 Bacteria 933
249 Ga0451795_0896776 3300041456 Unclassified 567
250 Ga0451802_2075871 3300041460 Bacteria 890
251 Ga0451807_0661896 3300041486 Bacteria 1660
252 Ga0451853_1004436 3300041512 Bacteria 1473
253 Ga0450914_023233 3300042118 Bacteria 705
254 Ga0439446_0369409 3300042156 Bacteria 514
255 Ga0450916_011619 3300042530 Bacteria 1115
256 Ga0466972_0018781 3300044658 Bacteria 3455
257 Ga0453683_0028902 3300044673 Bacteria 3508
258 Ga0451576_0065418 3300045051 Bacteria 3786
259 Ga0495620_0305229 3300046515 Bacteria 605
260 Ga0495628_0537394 3300046516 Bacteria 841
261 Ga0495644_0198004 3300046523 Bacteria 774
262 Ga0495652_0186688 3300046529 Bacteria 1586
263 Ga0495640_0454962 3300046533 Bacteria 782
264 Ga0495587_0414450 3300046536 Bacteria 748
265 Ga0495587_0685858 3300046536 Bacteria 562
266 Ga0495621_0024834 3300046539 Bacteria 2006
267 Ga0495645_0002908 3300046543 Bacteria 11624
268 Ga0495656_0346555 3300046615 Bacteria 769
269 Ga0495625_0039187 3300046660 Bacteria 3462
270 Ga0495635_0921451 3300046663 Bacteria 559
271 Ga0495599_0442617 3300046678 Bacteria 770
272 Ga0495647_0133732 3300046681 Bacteria 1053
273 Ga0495649_0330554 3300046694 Bacteria 772
274 Ga0495600_0447391 3300046809 Bacteria 799
275 Ga0495604_0166444 3300047317 Bacteria 1554
276 Ga0495686_0321728 3300047472 Bacteria 848
277 Ga0496102_0066835 3300048905 Bacteria 3296
278 Ga0496110_0072510 3300048913 Bacteria 3055
279 Ga0496111_0159933 3300048914 Bacteria 1672
280 Ga0496115_0920592 3300048918 Bacteria 673
281 Ga0501031_0008874 3300049568 Bacteria 6535
282 Ga0501032_0589623 3300049569 Bacteria 707
283 Ga0501033_0027619 3300049570 Bacteria 4267
284 Ga0501034_0667737 3300049571 Bacteria 940
285 Ga0501034_1468895 3300049571 Bacteria 556
286 Ga0501036_0039552 3300049572 Bacteria 3991
287 Ga0501037_0033509 3300049573 Bacteria 3793
288 Ga0501038_0006809 3300049574 Bacteria 10558
289 Ga0501039_0070464 3300049575 Bacteria 2716
290 Ga0501040_0396023 3300049576 Bacteria 991
291 Ga0501041_0000862 3300049577 Bacteria 16353
292 Ga0501042_0022865 3300049578 Bacteria 4368
293 Ga0501042_0091805 3300049578 Bacteria 2180
294 Ga0501043_0602094 3300049579 Bacteria 812
295 Ga0501047_0142786 3300049581 Bacteria 2272
296 Ga0501048_0084417 3300049582 Bacteria 2239
297 Ga0501048_0338373 3300049582 Bacteria 1073
298 Ga0501068_0107925 3300049584 Bacteria 1729
299 Ga0501069_0377470 3300049585 Bacteria 837
300 Ga0501070_0179958 3300049586 Bacteria 1740
301 Ga0501071_0002788 3300049587 Bacteria 10742
302 Ga0501071_0299513 3300049587 Bacteria 1219
303 Ga0501072_0004279 3300049588 Bacteria 10832
304 Ga0501072_0848419 3300049588 Bacteria 714
305 Ga0501073_0419675 3300049589 Bacteria 925
306 Ga0501074_0013170 3300049590 Bacteria 6014
307 Ga0501075_0018821 3300049591 Bacteria 5005
308 Ga0501076_0005038 3300049592 Bacteria 9456
309 Ga0501238_002153 3300049671 Bacteria 2328
310 Ga0501079_0020264 3300049741 Bacteria 5082
311 Ga0501080_0032312 3300049742 Bacteria 4880
312 Ga0501081_0028935 3300049743 Bacteria 3741
313 Ga0501083_0029590 3300049744 Bacteria 3765
314 Ga0501035_0053909 3300049822 Bacteria 3594
315 Ga0501044_0890238 3300049823 Bacteria 765
316 Ga0501045_0009318 3300049824 Bacteria 6866
317 nmdc:mga0yw44_34986_c1 3300050492 Bacteria 2948
318 nmdc:mga0k408_27933_c1 3300050493 Bacteria 3206
319 nmdc:mga0k408_546359_c1 3300050493 Bacteria 685
320 nmdc:mga05p37_1000531_c1 3300050507 Bacteria 888
321 nmdc:mga05p37_1172048_c1 3300050507 Bacteria 797
322 nmdc:mga05p37_1472672_c1 3300050507 Bacteria 680
323 nmdc:mga05p37_552605_c1 3300050507 Bacteria 1310
324 nmdc:mga09592_149990_c1 3300050508 Bacteria 2011
325 nmdc:mga0qj67_575622_c1 3300050509 Bacteria 902
326 nmdc:mga06r32_15794_c1 3300050510 Bacteria 6864
327 nmdc:mga06r32_780559_c1 3300050510 Bacteria 917
328 nmdc:mga08y16_309673_c1 3300050511 Bacteria 1626
329 nmdc:mga0rr50_1836010_c1 3300050513 Bacteria 510
330 nmdc:mga08x19_301253_c1 3300050514 Bacteria 1113
331 nmdc:mga0a205_1587_c1 3300050515 Bacteria 19495
332 nmdc:mga0a205_23647_c1 3300050515 Bacteria 5828
333 nmdc:mga0sz30_21166_c1 3300050516 Bacteria 2629
334 Ga0500646_0001668 3300053090 Bacteria 5866
335 Ga0500583_0013954 3300053092 Bacteria 3128
336 Ga0500555_003271 3300053103 Bacteria 4613
337 Ga0500595_000224 3300053119 Bacteria 38743
338 Ga0500628_190559 3300053129 Bacteria 588
339 Ga0500642_0045246 3300053130 Bacteria 1920
340 Ga0500655_003159 3300053133 Bacteria 2989
341 Ga0500568_0020704 3300053139 Bacteria 2841
342 Ga0500604_0000093 3300053151 Bacteria 28700
343 Ga0500636_0444849 3300053177 Bacteria 588
344 Ga0500637_0160735 3300053178 Bacteria 1295
345 Ga0500645_070259 3300053730 Bacteria 1005
346 Ga0501084_0023605 3300054114 Bacteria 5129
347 Ga0590075_021711 3300059424 Bacteria 1604
348 Ga0501082_0003928 3300060353 Bacteria 12975
349 Ga0501082_0017158 3300060353 Bacteria 6236
350 Ga0501082_1743878 3300060353 Bacteria 543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10594436 Ga0105243_105944362 103
2 3300025934 Ga0207686_11174457 Ga0207686_111744572 104
3 3300025937 Ga0207669_10670863 Ga0207669_106708631 104
4 3300026067 Ga0207678_11232025 Ga0207678_112320252 104
5 3300046529 Ga0495652_0186688 Ga0495652_0186688_631_1026 105
6 3300046536 Ga0495587_0414450 Ga0495587_0414450_293_688 105
7 3300046543 Ga0495645_0002908 Ga0495645_0002908_294_689 105
8 3300046663 Ga0495635_0921451 Ga0495635_0921451_38_433 105
9 3300046678 Ga0495599_0442617 Ga0495599_0442617_179_574 105
10 3300046809 Ga0495600_0447391 Ga0495600_0447391_350_745 105
11 3300047317 Ga0495604_0166444 Ga0495604_0166444_38_433 105
12 3300005355 Ga0070671_101572101 Ga0070671_1015721012 107
13 3300005618 Ga0068864_100712860 Ga0068864_1007128602 107
14 3300006358 Ga0068871_100689528 Ga0068871_1006895282 107
15 3300013308 Ga0157375_10521710 Ga0157375_105217102 107
16 3300005337 Ga0070682_101519621 Ga0070682_1015196211 109
17 3300005518 Ga0070699_100954253 Ga0070699_1009542532 109
18 3300009545 Ga0105237_10000005 Ga0105237_1000000525 109
19 3300025914 Ga0207671_10000004 Ga0207671_1000000475 109
20 3300046516 Ga0495628_0537394 Ga0495628_0537394_494_823 109
21 3300046533 Ga0495640_0454962 Ga0495640_0454962_35_364 109
22 3300006844 Ga0075428_100793935 Ga0075428_1007939352 110
23 3300006880 Ga0075429_100539540 Ga0075429_1005395401 110
24 3300009147 Ga0114129_10845720 Ga0114129_108457202 110
25 3300049579 Ga0501043_0602094 Ga0501043_0602094_458_799 110
26 3300050507 nmdc:mga05p37_1000531_c1 nmdc:mga05p37_1000531_c1_405_737 110
27 3300050508 nmdc:mga09592_149990_c1 nmdc:mga09592_149990_c1_1130_1462 110
28 3300050510 nmdc:mga06r32_780559_c1 nmdc:mga06r32_780559_c1_533_865 110
29 3300005335 Ga0070666_10663215 Ga0070666_106632152 111
30 3300005436 Ga0070713_100098198 Ga0070713_1000981984 111
31 3300005445 Ga0070708_100221011 Ga0070708_1002210112 111
32 3300005468 Ga0070707_100036366 Ga0070707_1000363664 111
33 3300006852 Ga0075433_10962120 Ga0075433_109621202 111
34 3300025304 Ga0209257_1001468 Ga0209257_100146819 111
35 3300025906 Ga0207699_10020130 Ga0207699_100201305 111
36 3300025922 Ga0207646_10128926 Ga0207646_101289263 111
37 3300025928 Ga0207700_10145946 Ga0207700_101459463 111
38 3300025929 Ga0207664_10342007 Ga0207664_103420072 111
39 3300032005 Ga0307411_10354487 Ga0307411_103544873 111
40 3300039450 Ga0436363_0108953 Ga0436363_0108953_1950_2330 111
41 3300049568 Ga0501031_0008874 Ga0501031_0008874_5628_5972 111
42 3300049569 Ga0501032_0589623 Ga0501032_0589623_256_600 111
43 3300049570 Ga0501033_0027619 Ga0501033_0027619_2204_2548 111
44 3300049571 Ga0501034_0667737 Ga0501034_0667737_500_841 111
45 3300049571 Ga0501034_1468895 Ga0501034_1468895_194_538 111
46 3300049572 Ga0501036_0039552 Ga0501036_0039552_2118_2462 111
47 3300049573 Ga0501037_0033509 Ga0501037_0033509_3288_3638 111
48 3300049574 Ga0501038_0006809 Ga0501038_0006809_844_1188 111
49 3300049575 Ga0501039_0070464 Ga0501039_0070464_784_1128 111
50 3300049576 Ga0501040_0396023 Ga0501040_0396023_592_936 111
51 3300049577 Ga0501041_0000862 Ga0501041_0000862_4255_4599 111
52 3300049578 Ga0501042_0022865 Ga0501042_0022865_3307_3651 111
53 3300049581 Ga0501047_0142786 Ga0501047_0142786_874_1215 111
54 3300049582 Ga0501048_0084417 Ga0501048_0084417_1491_1835 111
55 3300049584 Ga0501068_0107925 Ga0501068_0107925_923_1267 111
56 3300049585 Ga0501069_0377470 Ga0501069_0377470_287_631 111
57 3300049586 Ga0501070_0179958 Ga0501070_0179958_330_674 111
58 3300049587 Ga0501071_0002788 Ga0501071_0002788_9854_10198 111
59 3300049588 Ga0501072_0004279 Ga0501072_0004279_2543_2887 111
60 3300049589 Ga0501073_0419675 Ga0501073_0419675_131_475 111
61 3300049590 Ga0501074_0013170 Ga0501074_0013170_1310_1654 111
62 3300049591 Ga0501075_0018821 Ga0501075_0018821_3308_3652 111
63 3300049592 Ga0501076_0005038 Ga0501076_0005038_7538_7882 111
64 3300049741 Ga0501079_0020264 Ga0501079_0020264_471_815 111
65 3300049742 Ga0501080_0032312 Ga0501080_0032312_3307_3651 111
66 3300049743 Ga0501081_0028935 Ga0501081_0028935_174_518 111
67 3300049744 Ga0501083_0029590 Ga0501083_0029590_2306_2650 111
68 3300049822 Ga0501035_0053909 Ga0501035_0053909_259_603 111
69 3300049823 Ga0501044_0890238 Ga0501044_0890238_389_730 111
70 3300049824 Ga0501045_0009318 Ga0501045_0009318_1326_1670 111
71 3300054114 Ga0501084_0023605 Ga0501084_0023605_1273_1617 111
72 3300060353 Ga0501082_0017158 Ga0501082_0017158_4599_4943 111
73 3300005333 Ga0070677_10395583 Ga0070677_103955832 112
74 3300005334 Ga0068869_100353147 Ga0068869_1003531472 112
75 3300005340 Ga0070689_100464227 Ga0070689_1004642271 112
76 3300005354 Ga0070675_101122289 Ga0070675_1011222892 112
77 3300005365 Ga0070688_100077407 Ga0070688_1000774072 112
78 3300005438 Ga0070701_10125753 Ga0070701_101257532 112
79 3300005441 Ga0070700_100030763 Ga0070700_1000307632 112
80 3300005456 Ga0070678_101988621 Ga0070678_1019886211 112
81 3300005548 Ga0070665_100010886 Ga0070665_1000108865 112
82 3300005719 Ga0068861_100026151 Ga0068861_1000261515 112
83 3300005844 Ga0068862_100149645 Ga0068862_1001496452 112
84 3300005844 Ga0068862_100240436 Ga0068862_1002404363 112
85 3300006195 Ga0075366_10051467 Ga0075366_100514673 112
86 3300006846 Ga0075430_100610809 Ga0075430_1006108092 112
87 3300009148 Ga0105243_12600024 Ga0105243_126000241 112
88 3300009545 Ga0105237_10640499 Ga0105237_106404992 112
89 3300014325 Ga0163163_10478371 Ga0163163_104783712 112
90 3300025893 Ga0207682_10245776 Ga0207682_102457762 112
91 3300025936 Ga0207670_10492162 Ga0207670_104921622 112
92 3300025940 Ga0207691_10161961 Ga0207691_101619613 112
93 3300025942 Ga0207689_10098217 Ga0207689_100982173 112
94 3300026075 Ga0207708_10034163 Ga0207708_100341635 112
95 3300026118 Ga0207675_100102990 Ga0207675_1001029902 112
96 3300026121 Ga0207683_11089565 Ga0207683_110895652 112
97 3300028379 Ga0268266_10010750 Ga0268266_100107503 112
98 3300028380 Ga0268265_11090043 Ga0268265_110900432 112
99 3300031548 Ga0307408_100115649 Ga0307408_1001156492 112
100 3300031731 Ga0307405_10147879 Ga0307405_101478793 112
101 3300031824 Ga0307413_10038288 Ga0307413_100382883 112
102 3300031901 Ga0307406_10007638 Ga0307406_100076384 112
103 3300031903 Ga0307407_10011162 Ga0307407_100111624 112
104 3300032002 Ga0307416_100009952 Ga0307416_1000099526 112
105 3300032005 Ga0307411_10001622 Ga0307411_100016227 112
106 3300032126 Ga0307415_100035464 Ga0307415_1000354642 112
107 3300050493 nmdc:mga0k408_27933_c1 nmdc:mga0k408_27933_c1_1724_2062 112
108 3300050509 nmdc:mga0qj67_575622_c1 nmdc:mga0qj67_575622_c1_246_587 112
109 3300053119 Ga0500595_000224 Ga0500595_000224_35380_35733 112
110 3300053129 Ga0500628_190559 Ga0500628_190559_82_420 112
111 iso_pu_bacteria 2849660919 2849665920 112
112 3300005406 Ga0070703_10366235 Ga0070703_103662351 113
113 3300005467 Ga0070706_100788371 Ga0070706_1007883712 113
114 3300005468 Ga0070707_100001366 Ga0070707_10000136611 113
115 3300005518 Ga0070699_100002889 Ga0070699_10000288910 113
116 3300005547 Ga0070693_101031102 Ga0070693_1010311022 113
117 3300006846 Ga0075430_100685205 Ga0075430_1006852052 113
118 3300014969 Ga0157376_10264869 Ga0157376_102648693 113
119 3300014969 Ga0157376_10271566 Ga0157376_102715662 113
120 3300025900 Ga0207710_10089056 Ga0207710_100890562 113
121 3300025910 Ga0207684_10179544 Ga0207684_101795442 113
122 3300025922 Ga0207646_10059529 Ga0207646_100595292 113
123 3300031548 Ga0307408_100522172 Ga0307408_1005221722 113
124 3300031731 Ga0307405_10607685 Ga0307405_106076852 113
125 3300032126 Ga0307415_102125082 Ga0307415_1021250821 113
126 3300046523 Ga0495644_0198004 Ga0495644_0198004_59_418 113
127 3300046615 Ga0495656_0346555 Ga0495656_0346555_333_692 113
128 3300005336 Ga0070680_100500550 Ga0070680_1005005502 114
129 3300005440 Ga0070705_101205477 Ga0070705_1012054771 114
130 3300005444 Ga0070694_100047705 Ga0070694_1000477053 114
131 3300005467 Ga0070706_101339022 Ga0070706_1013390222 114
132 3300005468 Ga0070707_100716251 Ga0070707_1007162512 114
133 3300005518 Ga0070699_100030337 Ga0070699_1000303376 114
134 3300005539 Ga0068853_100759348 Ga0068853_1007593481 114
135 3300005545 Ga0070695_100042751 Ga0070695_1000427512 114
136 3300005546 Ga0070696_100027108 Ga0070696_1000271082 114
137 3300005547 Ga0070693_100041090 Ga0070693_1000410903 114
138 3300005563 Ga0068855_100548914 Ga0068855_1005489141 114
139 3300005617 Ga0068859_100529470 Ga0068859_1005294702 114
140 3300006038 Ga0075365_10003028 Ga0075365_1000302810 114
141 3300006852 Ga0075433_10140582 Ga0075433_101405822 114
142 3300006931 Ga0097620_100529509 Ga0097620_1005295092 114
143 3300009148 Ga0105243_11766272 Ga0105243_117662722 114
144 3300009176 Ga0105242_11119461 Ga0105242_111194612 114
145 3300013297 Ga0157378_12476486 Ga0157378_124764862 114
146 3300013307 Ga0157372_12006239 Ga0157372_120062391 114
147 3300014745 Ga0157377_10540369 Ga0157377_105403691 114
148 3300025885 Ga0207653_10129600 Ga0207653_101296002 114
149 3300025917 Ga0207660_10199277 Ga0207660_101992773 114
150 3300025922 Ga0207646_10614821 Ga0207646_106148212 114
151 3300025932 Ga0207690_11571688 Ga0207690_115716881 114
152 3300025935 Ga0207709_10670085 Ga0207709_106700852 114
153 3300025981 Ga0207640_11117674 Ga0207640_111176742 114
154 3300031456 Ga0307513_10017244 Ga0307513_100172443 114
155 3300046681 Ga0495647_0133732 Ga0495647_0133732_169_534 114
156 3300048905 Ga0496102_0066835 Ga0496102_0066835_759_1133 114
157 3300048918 Ga0496115_0920592 Ga0496115_0920592_136_486 114
158 3300050492 nmdc:mga0yw44_34986_c1 nmdc:mga0yw44_34986_c1_2552_2896 114
159 3300050515 nmdc:mga0a205_23647_c1 nmdc:mga0a205_23647_c1_4035_4409 114
160 3300060353 Ga0501082_0003928 Ga0501082_0003928_5114_5482 114
161 3300003775 Ga0055524_1000038 Ga0055524_1000038105 115
162 3300005262 Ga0065165_1080963 Ga0065165_10809631 115
163 3300005329 Ga0070683_100996038 Ga0070683_1009960382 115
164 3300005334 Ga0068869_100929957 Ga0068869_1009299572 115
165 3300005337 Ga0070682_100026718 Ga0070682_1000267182 115
166 3300005337 Ga0070682_101125205 Ga0070682_1011252052 115
167 3300005344 Ga0070661_101332029 Ga0070661_1013320291 115
168 3300005353 Ga0070669_100020291 Ga0070669_1000202916 115
169 3300005354 Ga0070675_100282138 Ga0070675_1002821381 115
170 3300005356 Ga0070674_100445273 Ga0070674_1004452732 115
171 3300005455 Ga0070663_100211456 Ga0070663_1002114562 115
172 3300005455 Ga0070663_100409372 Ga0070663_1004093722 115
173 3300005457 Ga0070662_100614570 Ga0070662_1006145702 115
174 3300005458 Ga0070681_11124606 Ga0070681_111246062 115
175 3300005459 Ga0068867_100014234 Ga0068867_1000142344 115
176 3300005543 Ga0070672_100179515 Ga0070672_1001795152 115
177 3300005545 Ga0070695_100457122 Ga0070695_1004571222 115
178 3300005546 Ga0070696_100178166 Ga0070696_1001781663 115
179 3300005614 Ga0068856_100704261 Ga0068856_1007042612 115
180 3300005616 Ga0068852_100113176 Ga0068852_1001131762 115
181 3300005616 Ga0068852_101237462 Ga0068852_1012374622 115
182 3300005985 Ga0081539_10003773 Ga0081539_100037739 115
183 3300006186 Ga0075369_10021726 Ga0075369_100217263 115
184 3300006195 Ga0075366_10169508 Ga0075366_101695082 115
185 3300006195 Ga0075366_10413788 Ga0075366_104137882 115
186 3300006844 Ga0075428_100112618 Ga0075428_1001126183 115
187 3300006852 Ga0075433_10005572 Ga0075433_100055729 115
188 3300006914 Ga0075436_100529217 Ga0075436_1005292172 115
189 3300006948 Ga0099826_10000008 Ga0099826_10000008177 115
190 3300009147 Ga0114129_10034350 Ga0114129_100343503 115
191 3300009174 Ga0105241_11090551 Ga0105241_110905512 115
192 3300009551 Ga0105238_10028358 Ga0105238_100283584 115
193 3300013100 Ga0157373_10835550 Ga0157373_108355501 115
194 3300013104 Ga0157370_10007517 Ga0157370_100075172 115
195 3300013105 Ga0157369_10028416 Ga0157369_100284166 115
196 3300013307 Ga0157372_10002223 Ga0157372_1000222313 115
197 3300025263 Ga0209565_1004596 Ga0209565_10045964 115
198 3300025295 Ga0209564_1029956 Ga0209564_10299563 115
199 3300025299 Ga0209256_1000018 Ga0209256_1000018179 115
200 3300025893 Ga0207682_10042318 Ga0207682_100423182 115
201 3300025906 Ga0207699_10492811 Ga0207699_104928111 115
202 3300025909 Ga0207705_10581168 Ga0207705_105811682 115
203 3300025932 Ga0207690_10279538 Ga0207690_102795383 115
204 3300025942 Ga0207689_11162336 Ga0207689_111623362 115
205 3300025944 Ga0207661_10215524 Ga0207661_102155243 115
206 3300025945 Ga0207679_10110515 Ga0207679_101105151 115
207 3300026067 Ga0207678_10880450 Ga0207678_108804501 115
208 3300026078 Ga0207702_11069338 Ga0207702_110693382 115
209 3300026142 Ga0207698_10331001 Ga0207698_103310011 115
210 3300027666 Ga0209282_1000005 Ga0209282_1000005177 115
211 3300030521 Ga0307511_10000022 Ga0307511_10000022103 115
212 3300031548 Ga0307408_100449066 Ga0307408_1004490662 115
213 3300031731 Ga0307405_10683403 Ga0307405_106834032 115
214 3300031911 Ga0307412_10658129 Ga0307412_106581291 115
215 3300031995 Ga0307409_101465753 Ga0307409_1014657532 115
216 3300032126 Ga0307415_100833912 Ga0307415_1008339122 115
217 3300035241 Ga0373961_0156007 Ga0373961_0156007_105_467 115
218 3300041456 Ga0451795_0896776 Ga0451795_0896776_87_437 115
219 3300041460 Ga0451802_2075871 Ga0451802_2075871_265_615 115
220 3300041486 Ga0451807_0661896 Ga0451807_0661896_975_1325 115
221 3300046539 Ga0495621_0024834 Ga0495621_0024834_1544_1906 115
222 3300046660 Ga0495625_0039187 Ga0495625_0039187_2884_3234 115
223 3300047472 Ga0495686_0321728 Ga0495686_0321728_94_444 115
224 3300049671 Ga0501238_002153 Ga0501238_002153_130_477 115
225 3300050493 nmdc:mga0k408_546359_c1 nmdc:mga0k408_546359_c1_293_640 115
226 3300050514 nmdc:mga08x19_301253_c1 nmdc:mga08x19_301253_c1_401_769 115
227 3300050515 nmdc:mga0a205_1587_c1 nmdc:mga0a205_1587_c1_7534_7881 115
228 3300050516 nmdc:mga0sz30_21166_c1 nmdc:mga0sz30_21166_c1_720_1067 115
229 3300053090 Ga0500646_0001668 Ga0500646_0001668_4338_4685 115
230 3300053092 Ga0500583_0013954 Ga0500583_0013954_468_815 115
231 3300053103 Ga0500555_003271 Ga0500555_003271_3026_3373 115
232 3300053130 Ga0500642_0045246 Ga0500642_0045246_499_846 115
233 3300053133 Ga0500655_003159 Ga0500655_003159_2406_2753 115
234 3300053139 Ga0500568_0020704 Ga0500568_0020704_168_515 115
235 3300053151 Ga0500604_0000093 Ga0500604_0000093_22299_22646 115
236 3300053177 Ga0500636_0444849 Ga0500636_0444849_101_448 115
237 3300053178 Ga0500637_0160735 Ga0500637_0160735_581_928 115
238 3300053730 Ga0500645_070259 Ga0500645_070259_310_657 115
239 3300003322 rootL2_10041416 rootL2_100414163 116
240 3300005328 Ga0070676_10063803 Ga0070676_100638032 116
241 3300005328 Ga0070676_10497159 Ga0070676_104971591 116
242 3300005331 Ga0070670_100091612 Ga0070670_1000916124 116
243 3300005331 Ga0070670_102106486 Ga0070670_1021064862 116
244 3300005333 Ga0070677_10234492 Ga0070677_102344921 116
245 3300005337 Ga0070682_100113132 Ga0070682_1001131322 116
246 3300005338 Ga0068868_102409066 Ga0068868_1024090661 116
247 3300005341 Ga0070691_10110247 Ga0070691_101102472 116
248 3300005344 Ga0070661_100207787 Ga0070661_1002077873 116
249 3300005344 Ga0070661_100397506 Ga0070661_1003975062 116
250 3300005347 Ga0070668_100387141 Ga0070668_1003871411 116
251 3300005354 Ga0070675_101375244 Ga0070675_1013752441 116
252 3300005356 Ga0070674_100035393 Ga0070674_1000353933 116
253 3300005366 Ga0070659_100698572 Ga0070659_1006985721 116
254 3300005441 Ga0070700_100477808 Ga0070700_1004778081 116
255 3300005471 Ga0070698_101774508 Ga0070698_1017745082 116
256 3300005543 Ga0070672_100231930 Ga0070672_1002319301 116
257 3300005544 Ga0070686_100479987 Ga0070686_1004799872 116
258 3300005548 Ga0070665_100000506 Ga0070665_1000005065 116
259 3300005564 Ga0070664_100373169 Ga0070664_1003731692 116
260 3300005564 Ga0070664_101216507 Ga0070664_1012165072 116
261 3300005577 Ga0068857_101025057 Ga0068857_1010250572 116
262 3300005615 Ga0070702_100783015 Ga0070702_1007830151 116
263 3300005618 Ga0068864_100505682 Ga0068864_1005056822 116
264 3300005618 Ga0068864_100871594 Ga0068864_1008715942 116
265 3300005844 Ga0068862_101821539 Ga0068862_1018215392 116
266 3300006163 Ga0070715_10756052 Ga0070715_107560521 116
267 3300006173 Ga0070716_100006029 Ga0070716_1000060298 116
268 3300006237 Ga0097621_100005834 Ga0097621_1000058343 116
269 3300006358 Ga0068871_100031256 Ga0068871_1000312562 116
270 3300006358 Ga0068871_100479284 Ga0068871_1004792843 116
271 3300006844 Ga0075428_100864505 Ga0075428_1008645052 116
272 3300006844 Ga0075428_101139529 Ga0075428_1011395292 116
273 3300006846 Ga0075430_101540177 Ga0075430_1015401772 116
274 3300006847 Ga0075431_100001035 Ga0075431_10000103522 116
275 3300006871 Ga0075434_101909815 Ga0075434_1019098152 116
276 3300006881 Ga0068865_100381050 Ga0068865_1003810502 116
277 3300006881 Ga0068865_100902214 Ga0068865_1009022141 116
278 3300009094 Ga0111539_10340367 Ga0111539_103403672 116
279 3300009147 Ga0114129_11856015 Ga0114129_118560151 116
280 3300009148 Ga0105243_10366004 Ga0105243_103660041 116
281 3300009551 Ga0105238_10133302 Ga0105238_101333022 116
282 3300009553 Ga0105249_10402294 Ga0105249_104022942 116
283 3300009553 Ga0105249_11328450 Ga0105249_113284502 116
284 3300009553 Ga0105249_12701507 Ga0105249_127015072 116
285 3300013297 Ga0157378_11975482 Ga0157378_119754822 116
286 3300013308 Ga0157375_11641469 Ga0157375_116414692 116
287 3300014326 Ga0157380_10009780 Ga0157380_100097802 116
288 3300014969 Ga0157376_10411972 Ga0157376_104119721 116
289 3300017792 Ga0163161_10366260 Ga0163161_103662603 116
290 3300025893 Ga0207682_10022479 Ga0207682_100224792 116
291 3300025903 Ga0207680_10693063 Ga0207680_106930632 116
292 3300025907 Ga0207645_10504588 Ga0207645_105045882 116
293 3300025920 Ga0207649_10173231 Ga0207649_101732313 116
294 3300025920 Ga0207649_11269358 Ga0207649_112693582 116
295 3300025924 Ga0207694_10134484 Ga0207694_101344842 116
296 3300025926 Ga0207659_10278042 Ga0207659_102780421 116
297 3300025926 Ga0207659_10865574 Ga0207659_108655742 116
298 3300025932 Ga0207690_10579197 Ga0207690_105791972 116
299 3300025935 Ga0207709_10741373 Ga0207709_107413731 116
300 3300025935 Ga0207709_11762155 Ga0207709_117621551 116
301 3300025936 Ga0207670_10496126 Ga0207670_104961261 116
302 3300025937 Ga0207669_10270802 Ga0207669_102708021 116
303 3300025939 Ga0207665_10010245 Ga0207665_100102456 116
304 3300025940 Ga0207691_10240483 Ga0207691_102404831 116
305 3300025942 Ga0207689_10401698 Ga0207689_104016982 116
306 3300025945 Ga0207679_10035641 Ga0207679_100356414 116
307 3300025945 Ga0207679_11253564 Ga0207679_112535642 116
308 3300025972 Ga0207668_10103126 Ga0207668_101031262 116
309 3300026023 Ga0207677_11680958 Ga0207677_116809581 116
310 3300026095 Ga0207676_10431718 Ga0207676_104317182 116
311 3300026116 Ga0207674_10610657 Ga0207674_106106572 116
312 3300026118 Ga0207675_100204454 Ga0207675_1002044541 116
313 3300028379 Ga0268266_10005963 Ga0268266_100059635 116
314 3300028380 Ga0268265_11815927 Ga0268265_118159272 116
315 3300031241 Ga0265325_10001851 Ga0265325_100018519 116
316 3300031249 Ga0265339_10003286 Ga0265339_100032865 116
317 3300031649 Ga0307514_10462085 Ga0307514_104620851 116
318 3300034818 Ga0373950_0161752 Ga0373950_0161752_102_455 116
319 3300035092 Ga0373952_0194649 Ga0373952_0194649_210_566 116
320 3300035113 Ga0373936_0052099 Ga0373936_0052099_1220_1591 116
321 3300035121 Ga0373960_0354624 Ga0373960_0354624_92_445 116
322 3300035410 Ga0373924_0003018 Ga0373924_0003018_148_501 116
323 3300037466 Ga0395898_1454620 Ga0395898_1454620_130_519 116
324 3300037471 Ga0395905_1302780 Ga0395905_1302780_208_558 116
325 3300037853 Ga0436364_0294406 Ga0436364_0294406_225_575 116
326 3300039438 Ga0436360_0389148 Ga0436360_0389148_233_598 116
327 3300039450 Ga0436363_1214520 Ga0436363_1214520_34_384 116
328 3300041512 Ga0451853_1004436 Ga0451853_1004436_941_1330 116
329 3300042118 Ga0450914_023233 Ga0450914_023233_335_694 116
330 3300042156 Ga0439446_0369409 Ga0439446_0369409_87_455 116
331 3300042530 Ga0450916_011619 Ga0450916_011619_472_825 116
332 3300044658 Ga0466972_0018781 Ga0466972_0018781_348_749 116
333 3300044673 Ga0453683_0028902 Ga0453683_0028902_2125_2478 116
334 3300045051 Ga0451576_0065418 Ga0451576_0065418_2161_2514 116
335 3300046515 Ga0495620_0305229 Ga0495620_0305229_80_433 116
336 3300046536 Ga0495587_0685858 Ga0495587_0685858_144_506 116
337 3300046694 Ga0495649_0330554 Ga0495649_0330554_46_396 116
338 3300048913 Ga0496110_0072510 Ga0496110_0072510_883_1233 116
339 3300048914 Ga0496111_0159933 Ga0496111_0159933_544_894 116
340 3300049578 Ga0501042_0091805 Ga0501042_0091805_170_538 116
341 3300049582 Ga0501048_0338373 Ga0501048_0338373_670_1038 116
342 3300049587 Ga0501071_0299513 Ga0501071_0299513_413_781 116
343 3300049588 Ga0501072_0848419 Ga0501072_0848419_241_627 116
344 3300050507 nmdc:mga05p37_1172048_c1 nmdc:mga05p37_1172048_c1_280_630 116
345 3300050507 nmdc:mga05p37_1472672_c1 nmdc:mga05p37_1472672_c1_96_446 116
346 3300050507 nmdc:mga05p37_552605_c1 nmdc:mga05p37_552605_c1_65_415 116
347 3300050510 nmdc:mga06r32_15794_c1 nmdc:mga06r32_15794_c1_3410_3769 116
348 3300050511 nmdc:mga08y16_309673_c1 nmdc:mga08y16_309673_c1_472_831 116
349 3300050513 nmdc:mga0rr50_1836010_c1 nmdc:mga0rr50_1836010_c1_142_492 116
350 3300059424 Ga0590075_021711 Ga0590075_021711_745_1134 116
351 3300060353 Ga0501082_1743878 Ga0501082_1743878_35_403 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

61

0.98

PF12840

HTH_20

Helix-turn-helix domain

13

61

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

15

60

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9542 4 92
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9459 4 87
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.942 5 103
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9402 4 89
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9244 4 92
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 17 72 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 4 92 1.10.10.10
2oqgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9462 5 103 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.938 5 84 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9351 15 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538A3G2-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9944 5 102 GO:0003700
AF-A0A3D1LEA8-F1-model_v4 ArsR family transcriptional regulator 0.992 6 88 GO:0003700
AF-Q16AN0-F1-model_v4 Transcriptional regulator, ArsR family, putative 0.9913 5 87 GO:0003700
AF-A0A1H0HWH6-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9908 5 87 GO:0003677
GO:0003700
AF-A0A2I9DLQ2-F1-model_v4 ArsR family transcriptional regulator 0.9896 5 87 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.59 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map