F418562

General Info

Members Datasets Scaffolds Average Seq Length
351 245 702 146

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_101429129|Ga0068855_1014291292
Length 155
Sequence VSETRTTYYLPPGLPAPRPTEPALEQPYWDAVRKERLQVQRCGACAGWQWGPEWICHRCLSRDMRWEEVAPEGRIYSWERVWHAAHPALVGHTPYVAVLVELPQAGGVRMVGNLLGDPQQEVRIGAPVKAVFEHHEDAEPPFTLVHWRTVEDAKG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.25
Nodule 0
Rhizoplane 0.57
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_101429129 3300005563 Bacteria 712
2 JGI25405J52794_10059056 3300003911 Bacteria 828
3 Ga0065715_10165715 3300005293 Bacteria 1588
4 Ga0070676_10028193 3300005328 Bacteria 3188
5 Ga0070676_10989300 3300005328 Bacteria 631
6 Ga0070690_100034416 3300005330 Bacteria 3175
7 Ga0070690_100220746 3300005330 Bacteria 1328
8 Ga0070690_100811826 3300005330 Bacteria 726
9 Ga0070670_100009779 3300005331 Bacteria 8190
10 Ga0068869_100046454 3300005334 Bacteria 3131
11 Ga0070680_100000809 3300005336 Bacteria 22038
12 Ga0070682_100000343 3300005337 Bacteria 32035
13 Ga0068868_100061985 3300005338 Bacteria 2963
14 Ga0068868_100804989 3300005338 Bacteria 848
15 Ga0070660_100000092 3300005339 Bacteria 54311
16 Ga0070689_100402816 3300005340 Bacteria 1157
17 Ga0070689_100796573 3300005340 Bacteria 831
18 Ga0070687_100180111 3300005343 Bacteria 1265
19 Ga0070661_100001263 3300005344 Bacteria 17772
20 Ga0070668_100279470 3300005347 Bacteria 1394
21 Ga0070669_100113766 3300005353 Bacteria 2056
22 Ga0070671_100396639 3300005355 Bacteria 1180
23 Ga0070673_100030976 3300005364 Bacteria 4010
24 Ga0070659_100002620 3300005366 Bacteria 12789
25 Ga0070667_101388537 3300005367 Bacteria 659
26 Ga0070703_10002360 3300005406 Bacteria 5444
27 Ga0070710_10759802 3300005437 Bacteria 689
28 Ga0070705_100000097 3300005440 Bacteria 49136
29 Ga0070694_100001563 3300005444 Bacteria 13463
30 Ga0070708_100017201 3300005445 Bacteria 6023
31 Ga0070708_100164854 3300005445 Bacteria 2067
32 Ga0070708_100284432 3300005445 Bacteria 1557
33 Ga0070678_100043397 3300005456 Bacteria 3203
34 Ga0070662_100004633 3300005457 Bacteria 8716
35 Ga0068867_100000688 3300005459 Bacteria 22451
36 Ga0070685_10941612 3300005466 Bacteria 645
37 Ga0070706_100021182 3300005467 Bacteria 5986
38 Ga0070706_100031496 3300005467 Bacteria 4890
39 Ga0070706_101104758 3300005467 Bacteria 730
40 Ga0070707_100012260 3300005468 Bacteria 8006
41 Ga0070707_100103697 3300005468 Bacteria 2756
42 Ga0070707_100367824 3300005468 Bacteria 1397
43 Ga0070698_100001984 3300005471 Bacteria 22716
44 Ga0070698_100003330 3300005471 Bacteria 17684
45 Ga0070698_100287771 3300005471 Bacteria 1574
46 Ga0070699_100023184 3300005518 Bacteria 5348
47 Ga0070699_100062335 3300005518 Bacteria 3232
48 Ga0070699_100210315 3300005518 Bacteria 1731
49 Ga0070699_100929663 3300005518 Bacteria 797
50 Ga0070699_101175257 3300005518 Bacteria 704
51 Ga0070679_100008626 3300005530 Bacteria 9608
52 Ga0070684_100032545 3300005535 Bacteria 4444
53 Ga0070697_100033060 3300005536 Bacteria 4164
54 Ga0070697_100176255 3300005536 Bacteria 1811
55 Ga0070697_100384704 3300005536 Bacteria 1216
56 Ga0070697_101367527 3300005536 Bacteria 632
57 Ga0068853_100001921 3300005539 Bacteria 15321
58 Ga0070672_100274539 3300005543 Bacteria 1424
59 Ga0070672_100532347 3300005543 Bacteria 1019
60 Ga0070672_101019340 3300005543 Bacteria 734
61 Ga0070695_100046499 3300005545 Bacteria 2769
62 Ga0070696_100069341 3300005546 Bacteria 2477
63 Ga0070693_100011674 3300005547 Bacteria 4427
64 Ga0070665_100007700 3300005548 Bacteria 10937
65 Ga0070665_100010905 3300005548 Bacteria 9192
66 Ga0070704_100000208 3300005549 Bacteria 24431
67 Ga0070704_100238172 3300005549 Bacteria 1488
68 Ga0068855_100001162 3300005563 Bacteria 32633
69 Ga0068855_101399985 3300005563 Bacteria 721
70 Ga0070664_100856939 3300005564 Bacteria 851
71 Ga0068857_100009260 3300005577 Bacteria 8544
72 Ga0068857_100026061 3300005577 Bacteria 5150
73 Ga0068854_100001418 3300005578 Bacteria 14479
74 Ga0068856_100001410 3300005614 Bacteria 25205
75 Ga0068864_100020734 3300005618 Bacteria 5500
76 Ga0068864_100613480 3300005618 Bacteria 1057
77 Ga0068866_10664500 3300005718 Bacteria 711
78 Ga0068870_10000045 3300005840 Bacteria 37970
79 Ga0068863_100020310 3300005841 Bacteria 6352
80 Ga0068858_100062388 3300005842 Bacteria 3446
81 Ga0068860_100042183 3300005843 Bacteria 4359
82 Ga0068862_100221839 3300005844 Bacteria 1712
83 Ga0081455_10001289 3300005937 Bacteria 31161
84 Ga0081455_10001486 3300005937 Bacteria 29017
85 Ga0081455_10003938 3300005937 Bacteria 16882
86 Ga0081455_10039261 3300005937 Bacteria 4185
87 Ga0081455_10777546 3300005937 Bacteria 603
88 Ga0081538_10071210 3300005981 Bacteria 1914
89 Ga0081539_10014281 3300005985 Bacteria 5888
90 Ga0075365_10095308 3300006038 Bacteria 2032
91 Ga0075365_10254444 3300006038 Bacteria 1234
92 Ga0075365_10451930 3300006038 Bacteria 907
93 Ga0075365_10556265 3300006038 Bacteria 811
94 Ga0075365_10873126 3300006038 Bacteria 634
95 Ga0075368_10212362 3300006042 Bacteria 821
96 Ga0075363_100067882 3300006048 Bacteria 1933
97 Ga0075363_100157185 3300006048 Bacteria 1286
98 Ga0075363_100568429 3300006048 Bacteria 677
99 Ga0075364_10602653 3300006051 Bacteria 750
100 Ga0075362_10011833 3300006177 Bacteria 3447
101 Ga0075362_10134091 3300006177 Bacteria 1180
102 Ga0075362_10153104 3300006177 Bacteria 1107
103 Ga0075362_10247858 3300006177 Bacteria 876
104 Ga0075367_10013803 3300006178 Bacteria 4357
105 Ga0075367_10019275 3300006178 Bacteria 3781
106 Ga0075367_10290471 3300006178 Bacteria 1028
107 Ga0075367_10395804 3300006178 Bacteria 873
108 Ga0075369_10002040 3300006186 Bacteria 7116
109 Ga0075369_10095563 3300006186 Bacteria 1329
110 Ga0097621_100571068 3300006237 Bacteria 1031
111 Ga0075370_10145366 3300006353 Bacteria 1387
112 Ga0075370_10336841 3300006353 Bacteria 900
113 Ga0068871_100432410 3300006358 Bacteria 1177
114 Ga0075428_100024710 3300006844 Bacteria 6648
115 Ga0075428_100367988 3300006844 Bacteria 1542
116 Ga0075428_101302182 3300006844 Bacteria 764
117 Ga0075430_100001163 3300006846 Bacteria 21045
118 Ga0075430_101253535 3300006846 Bacteria 610
119 Ga0075431_100004149 3300006847 Bacteria 14151
120 Ga0075434_100117690 3300006871 Bacteria 2670
121 Ga0075429_100616507 3300006880 Bacteria 951
122 Ga0068865_100533756 3300006881 Bacteria 983
123 Ga0068865_101089724 3300006881 Bacteria 703
124 Ga0075436_100160843 3300006914 Bacteria 1583
125 Ga0075435_100085430 3300007076 Bacteria 2597
126 Ga0075435_100152992 3300007076 Bacteria 1940
127 Ga0099794_10157712 3300007265 Bacteria 1153
128 Ga0099794_10217062 3300007265 Bacteria 982
129 Ga0105240_11170010 3300009093 Bacteria 815
130 Ga0105240_11312118 3300009093 Bacteria 763
131 Ga0111539_10001599 3300009094 Bacteria 30206
132 Ga0111539_10892142 3300009094 Bacteria 1034
133 Ga0111539_11729824 3300009094 Bacteria 725
134 Ga0105245_10258932 3300009098 Bacteria 1693
135 Ga0105245_11307990 3300009098 Bacteria 774
136 Ga0105247_10878616 3300009101 Bacteria 690
137 Ga0114129_10006586 3300009147 Bacteria 16490
138 Ga0105243_10094623 3300009148 Bacteria 2467
139 Ga0105241_10003277 3300009174 Bacteria 12046
140 Ga0105248_10860099 3300009177 Bacteria 1024
141 Ga0105248_11041900 3300009177 Bacteria 924
142 Ga0105248_11595871 3300009177 Bacteria 739
143 Ga0105237_10305257 3300009545 Bacteria 1594
144 Ga0105238_11484989 3300009551 Bacteria 706
145 Ga0105238_12444184 3300009551 Bacteria 558
146 Ga0105238_12828941 3300009551 Bacteria 522
147 Ga0105249_10032591 3300009553 Bacteria 4715
148 Ga0105249_10507717 3300009553 Bacteria 1251
149 Ga0105249_12071466 3300009553 Bacteria 642
150 Ga0105249_12561755 3300009553 Bacteria 582
151 Ga0099796_10113965 3300010159 Bacteria 1032
152 Ga0105239_10368277 3300010375 Bacteria 1624
153 Ga0105246_10227446 3300011119 Bacteria 1466
154 Ga0157373_10000370 3300013100 Bacteria 36005
155 Ga0157369_10027879 3300013105 Bacteria 6256
156 Ga0157374_10534561 3300013296 Bacteria 1179
157 Ga0163162_11254227 3300013306 Bacteria 842
158 Ga0157515_130084 3300013875 Bacteria 827
159 Ga0163163_10144825 3300014325 Bacteria 2419
160 Ga0182008_10069601 3300014497 Bacteria 1731
161 Ga0206354_10361920 3300020081 Bacteria 1734
162 Ga0213871_10001086 3300021441 Bacteria 4300
163 Ga0207697_10082813 3300025315 Bacteria 1353
164 Ga0207697_10194147 3300025315 Bacteria 892
165 Ga0207653_10007293 3300025885 Bacteria 3448
166 Ga0207688_10076957 3300025901 Bacteria 1900
167 Ga0207688_10131162 3300025901 Bacteria 1469
168 Ga0207680_10705466 3300025903 Bacteria 723
169 Ga0207645_10000264 3300025907 Bacteria 43356
170 Ga0207645_10398025 3300025907 Bacteria 926
171 Ga0207643_10000077 3300025908 Bacteria 64121
172 Ga0207684_10002667 3300025910 Bacteria 17847
173 Ga0207684_10006341 3300025910 Bacteria 10787
174 Ga0207684_10310724 3300025910 Bacteria 1359
175 Ga0207654_10006156 3300025911 Bacteria 6030
176 Ga0207707_10000234 3300025912 Bacteria 59924
177 Ga0207671_10209882 3300025914 Bacteria 1523
178 Ga0207660_10000890 3300025917 Bacteria 19670
179 Ga0207662_10036728 3300025918 Bacteria 2865
180 Ga0207657_10000419 3300025919 Bacteria 45112
181 Ga0207649_10024279 3300025920 Bacteria 3522
182 Ga0207652_10000306 3300025921 Bacteria 50379
183 Ga0207646_10000905 3300025922 Bacteria 38211
184 Ga0207646_10036211 3300025922 Bacteria 4455
185 Ga0207681_10007590 3300025923 Bacteria 6646
186 Ga0207694_11057135 3300025924 Bacteria 687
187 Ga0207650_10049884 3300025925 Bacteria 3093
188 Ga0207644_10753106 3300025931 Bacteria 814
189 Ga0207690_10019619 3300025932 Bacteria 4167
190 Ga0207706_10011147 3300025933 Bacteria 8192
191 Ga0207709_10097241 3300025935 Bacteria 1938
192 Ga0207670_10292038 3300025936 Bacteria 1274
193 Ga0207670_10894559 3300025936 Bacteria 743
194 Ga0207669_10142103 3300025937 Bacteria 1668
195 Ga0207704_10472651 3300025938 Bacteria 1005
196 Ga0207704_11029882 3300025938 Bacteria 697
197 Ga0207691_10410521 3300025940 Bacteria 1154
198 Ga0207691_10546723 3300025940 Bacteria 982
199 Ga0207689_10000138 3300025942 Bacteria 62632
200 Ga0207679_10006218 3300025945 Bacteria 7539
201 Ga0207667_10000287 3300025949 Bacteria 69607
202 Ga0207667_10629465 3300025949 Bacteria 1080
203 Ga0207651_10026375 3300025960 Bacteria 3629
204 Ga0207651_10303630 3300025960 Bacteria 1328
205 Ga0207651_10411830 3300025960 Bacteria 1152
206 Ga0207712_10324979 3300025961 Bacteria 1271
207 Ga0207712_10809384 3300025961 Bacteria 824
208 Ga0207668_10372396 3300025972 Bacteria 1200
209 Ga0207640_10060659 3300025981 Bacteria 2501
210 Ga0207658_11237712 3300025986 Bacteria 682
211 Ga0207677_10420184 3300026023 Bacteria 1138
212 Ga0207703_10175012 3300026035 Bacteria 1890
213 Ga0207703_10893500 3300026035 Bacteria 850
214 Ga0207703_11807690 3300026035 Bacteria 587
215 Ga0207639_10113786 3300026041 Bacteria 2210
216 Ga0207678_10002675 3300026067 Bacteria 16172
217 Ga0207702_10031800 3300026078 Bacteria 4401
218 Ga0207641_10158689 3300026088 Bacteria 2054
219 Ga0207641_10711875 3300026088 Bacteria 989
220 Ga0207648_10001989 3300026089 Bacteria 22320
221 Ga0207674_10000315 3300026116 Bacteria 61743
222 Ga0207674_10014929 3300026116 Bacteria 8560
223 Ga0207674_10269247 3300026116 Bacteria 1651
224 Ga0207675_100015103 3300026118 Bacteria 7205
225 Ga0207683_10047609 3300026121 Bacteria 3755
226 Ga0207428_10082130 3300027907 Bacteria 2515
227 Ga0268266_10181903 3300028379 Bacteria 1914
228 Ga0268265_10828328 3300028380 Bacteria 904
229 Ga0265332_10067846 3300031238 Bacteria 1521
230 Ga0265316_10326425 3300031344 Bacteria 1114
231 Ga0307408_101591979 3300031548 Unclassified 620
232 Ga0307405_10299151 3300031731 Bacteria 1220
233 Ga0307410_10378245 3300031852 Bacteria 1139
234 Ga0307412_10974720 3300031911 Archaea 748
235 Ga0307409_100491161 3300031995 Bacteria 1193
236 Ga0307416_100992930 3300032002 Bacteria 942
237 Ga0307415_100215958 3300032126 Bacteria 1534
238 Ga0307415_100224045 3300032126 Bacteria 1510
239 Ga0373948_0050443 3300034817 Bacteria 893
240 Ga0373959_0076006 3300034820 Bacteria 766
241 Ga0373934_0056385 3300035086 Bacteria 1563
242 Ga0373940_0009299 3300035088 Bacteria 2282
243 Ga0373952_0058054 3300035092 Bacteria 939
244 Ga0373936_0387924 3300035113 Bacteria 640
245 Ga0373939_0078390 3300035114 Bacteria 1092
246 Ga0373939_0236253 3300035114 Bacteria 706
247 Ga0373939_0475998 3300035114 Bacteria 530
248 Ga0373954_0120540 3300035118 Bacteria 1273
249 Ga0373946_0499524 3300035171 Bacteria 624
250 Ga0373961_0176072 3300035241 Bacteria 743
251 Ga0373927_0112821 3300035695 Bacteria 1772
252 Ga0373933_0139654 3300035724 Bacteria 1529
253 Ga0373937_0413330 3300036401 Bacteria 1280
254 Ga0373925_0215942 3300037068 Bacteria 1529
255 Ga0395899_0408721 3300037312 Bacteria 897
256 Ga0395900_1422640 3300037418 Bacteria 606
257 Ga0395901_0030605 3300038443 Bacteria 5546
258 Ga0436365_1159260 3300039437 Bacteria 848
259 Ga0436360_1052254 3300039438 Bacteria 3557
260 Ga0436361_0787177 3300039447 Bacteria 3898
261 Ga0436363_0349805 3300039450 Bacteria 879
262 Ga0451839_0738751 3300041496 Bacteria 1003
263 Ga0451843_1460392 3300041509 Bacteria 641
264 Ga0439448_0002151 3300042005 Bacteria 5309
265 Ga0439458_0003842 3300042157 Bacteria 3473
266 Ga0439444_0011949 3300042437 Bacteria 1416
267 Ga0439459_0001033 3300042438 Bacteria 3971
268 Ga0439460_0027409 3300042461 Bacteria 1600
269 Ga0451577_0016612 3300042876 Bacteria 6810
270 Ga0451577_0082178 3300042876 Bacteria 2873
271 Ga0453683_0009761 3300044673 Bacteria 6399
272 Ga0466963_0032443 3300044694 Bacteria 3382
273 Ga0453684_0033681 3300044712 Bacteria 7134
274 Ga0453684_0257533 3300044712 Bacteria 2000
275 Ga0451576_0174876 3300045051 Bacteria 2241
276 Ga0495629_0297921 3300046459 Bacteria 1105
277 Ga0495580_0187117 3300046472 Bacteria 1429
278 Ga0495669_0020102 3300046684 Bacteria 2887
279 Ga0495581_0608377 3300047315 Bacteria 633
280 Ga0496102_0070421 3300048905 Bacteria 3211
281 Ga0496103_0186006 3300048906 Bacteria 1335
282 Ga0501033_0238735 3300049570 Bacteria 1290
283 Ga0501034_0003169 3300049571 Bacteria 18910
284 Ga0501034_0011580 3300049571 Bacteria 9132
285 Ga0501034_0188285 3300049571 Bacteria 2026
286 Ga0501034_0596145 3300049571 Bacteria 1011
287 Ga0501036_0174517 3300049572 Bacteria 1810
288 Ga0501037_0418867 3300049573 Bacteria 917
289 Ga0501037_1047608 3300049573 Unclassified 530
290 Ga0501038_1040321 3300049574 Bacteria 600
291 Ga0501039_0395297 3300049575 Bacteria 1086
292 Ga0501039_0780010 3300049575 Bacteria 746
293 Ga0501040_0049792 3300049576 Bacteria 2865
294 Ga0501042_0328932 3300049578 Bacteria 1105
295 Ga0501043_0403489 3300049579 Bacteria 1033
296 Ga0501046_0095210 3300049580 Bacteria 2288
297 Ga0501047_0452992 3300049581 Bacteria 1112
298 Ga0501048_0063379 3300049582 Bacteria 2615
299 Ga0501067_0033966 3300049583 Bacteria 2831
300 Ga0501068_0015808 3300049584 Bacteria 4343
301 Ga0501068_0422102 3300049584 Bacteria 861
302 Ga0501071_0415051 3300049587 Bacteria 1028
303 Ga0501072_0220857 3300049588 Bacteria 1510
304 Ga0501074_0275919 3300049590 Bacteria 1195
305 Ga0501075_0083661 3300049591 Bacteria 2417
306 Ga0501077_0027791 3300049593 Bacteria 3593
307 Ga0501079_0131301 3300049741 Bacteria 1949
308 Ga0501079_0554930 3300049741 Bacteria 903
309 Ga0501080_0504614 3300049742 Bacteria 1081
310 Ga0501081_0033176 3300049743 Bacteria 3506
311 Ga0501044_0015018 3300049823 Bacteria 8349
312 Ga0501044_1150947 3300049823 Bacteria 644
313 Ga0501045_0061359 3300049824 Bacteria 2758
314 nmdc:mga03683_11102_c1 3300050489 Bacteria 3248
315 nmdc:mga03683_11321_c1 3300050489 Bacteria 3226
316 nmdc:mga03683_275214_c1 3300050489 Bacteria 786
317 nmdc:mga03683_375756_c1 3300050489 Bacteria 676
318 nmdc:mga03683_5033_c1 3300050489 Bacteria 4430
319 nmdc:mga00v17_625530_c1 3300050491 Bacteria 693
320 nmdc:mga0yw44_202668_c1 3300050492 Bacteria 1311
321 nmdc:mga0yw44_481416_c1 3300050492 Bacteria 842
322 nmdc:mga0yw44_91025_c1 3300050492 Bacteria 1928
323 nmdc:mga0k408_77410_c1 3300050493 Bacteria 1945
324 nmdc:mga06z11_290845_c1 3300050494 Bacteria 969
325 nmdc:mga06z11_8596_c1 3300050494 Bacteria 4268
326 nmdc:mga04h51_70816_c1 3300050495 Bacteria 1217
327 nmdc:mga07m45_326540_c1 3300050496 Bacteria 892
328 nmdc:mga07m45_33878_c1 3300050496 Bacteria 2837
329 nmdc:mga07m45_676190_c1 3300050496 Bacteria 594
330 nmdc:mga07m45_78297_c1 3300050496 Bacteria 1886
331 nmdc:mga0qj67_720_c1 3300050509 Bacteria 22534
332 nmdc:mga06r32_4338_c1 3300050510 Bacteria 12703
333 nmdc:mga08y16_1975_c1 3300050511 Bacteria 20910
334 nmdc:mga0n895_38035_c1 3300050512 Bacteria 4660
335 nmdc:mga0rr50_296605_c1 3300050513 Bacteria 1352
336 nmdc:mga08x19_210786_c1 3300050514 Bacteria 1333
337 nmdc:mga0a205_53004_c1 3300050515 Bacteria 3915
338 nmdc:mga0sz30_211408_c1 3300050516 Bacteria 862
339 nmdc:mga0sz30_567_c1 3300050516 Bacteria 13853
340 Ga0495619_0774566 3300053085 Bacteria 650
341 Ga0500644_0173446 3300053088 Bacteria 878
342 Ga0500646_0327196 3300053090 Bacteria 555
343 Ga0500651_0086312 3300053093 Bacteria 1939
344 Ga0500566_0509363 3300053094 Bacteria 517
345 Ga0500641_0000273 3300053096 Bacteria 19298
346 Ga0500652_282754 3300053131 Bacteria 647
347 Ga0500658_0159653 3300053134 Bacteria 1020
348 Ga0500616_0018966 3300053153 Bacteria 3884
349 Ga0500620_060967 3300053155 Bacteria 1284
350 Ga0501084_0178958 3300054114 Bacteria 1790
351 Ga0501084_0325388 3300054114 Bacteria 1298
352 Ga0068855_101429129
353 JGI25405J52794_10059056
354 Ga0065715_10165715
355 Ga0070676_10028193
356 Ga0070676_10989300
357 Ga0070690_100034416
358 Ga0070690_100220746
359 Ga0070690_100811826
360 Ga0070670_100009779
361 Ga0068869_100046454
362 Ga0070680_100000809
363 Ga0070682_100000343
364 Ga0068868_100061985
365 Ga0068868_100804989
366 Ga0070660_100000092
367 Ga0070689_100402816
368 Ga0070689_100796573
369 Ga0070687_100180111
370 Ga0070661_100001263
371 Ga0070668_100279470
372 Ga0070669_100113766
373 Ga0070671_100396639
374 Ga0070673_100030976
375 Ga0070659_100002620
376 Ga0070667_101388537
377 Ga0070703_10002360
378 Ga0070710_10759802
379 Ga0070705_100000097
380 Ga0070694_100001563
381 Ga0070708_100017201
382 Ga0070708_100164854
383 Ga0070708_100284432
384 Ga0070678_100043397
385 Ga0070662_100004633
386 Ga0068867_100000688
387 Ga0070685_10941612
388 Ga0070706_100021182
389 Ga0070706_100031496
390 Ga0070706_101104758
391 Ga0070707_100012260
392 Ga0070707_100103697
393 Ga0070707_100367824
394 Ga0070698_100001984
395 Ga0070698_100003330
396 Ga0070698_100287771
397 Ga0070699_100023184
398 Ga0070699_100062335
399 Ga0070699_100210315
400 Ga0070699_100929663
401 Ga0070699_101175257
402 Ga0070679_100008626
403 Ga0070684_100032545
404 Ga0070697_100033060
405 Ga0070697_100176255
406 Ga0070697_100384704
407 Ga0070697_101367527
408 Ga0068853_100001921
409 Ga0070672_100274539
410 Ga0070672_100532347
411 Ga0070672_101019340
412 Ga0070695_100046499
413 Ga0070696_100069341
414 Ga0070693_100011674
415 Ga0070665_100007700
416 Ga0070665_100010905
417 Ga0070704_100000208
418 Ga0070704_100238172
419 Ga0068855_100001162
420 Ga0068855_101399985
421 Ga0070664_100856939
422 Ga0068857_100009260
423 Ga0068857_100026061
424 Ga0068854_100001418
425 Ga0068856_100001410
426 Ga0068864_100020734
427 Ga0068864_100613480
428 Ga0068866_10664500
429 Ga0068870_10000045
430 Ga0068863_100020310
431 Ga0068858_100062388
432 Ga0068860_100042183
433 Ga0068862_100221839
434 Ga0081455_10001289
435 Ga0081455_10001486
436 Ga0081455_10003938
437 Ga0081455_10039261
438 Ga0081455_10777546
439 Ga0081538_10071210
440 Ga0081539_10014281
441 Ga0075365_10095308
442 Ga0075365_10254444
443 Ga0075365_10451930
444 Ga0075365_10556265
445 Ga0075365_10873126
446 Ga0075368_10212362
447 Ga0075363_100067882
448 Ga0075363_100157185
449 Ga0075363_100568429
450 Ga0075364_10602653
451 Ga0075362_10011833
452 Ga0075362_10134091
453 Ga0075362_10153104
454 Ga0075362_10247858
455 Ga0075367_10013803
456 Ga0075367_10019275
457 Ga0075367_10290471
458 Ga0075367_10395804
459 Ga0075369_10002040
460 Ga0075369_10095563
461 Ga0097621_100571068
462 Ga0075370_10145366
463 Ga0075370_10336841
464 Ga0068871_100432410
465 Ga0075428_100024710
466 Ga0075428_100367988
467 Ga0075428_101302182
468 Ga0075430_100001163
469 Ga0075430_101253535
470 Ga0075431_100004149
471 Ga0075434_100117690
472 Ga0075429_100616507
473 Ga0068865_100533756
474 Ga0068865_101089724
475 Ga0075436_100160843
476 Ga0075435_100085430
477 Ga0075435_100152992
478 Ga0099794_10157712
479 Ga0099794_10217062
480 Ga0105240_11170010
481 Ga0105240_11312118
482 Ga0111539_10001599
483 Ga0111539_10892142
484 Ga0111539_11729824
485 Ga0105245_10258932
486 Ga0105245_11307990
487 Ga0105247_10878616
488 Ga0114129_10006586
489 Ga0105243_10094623
490 Ga0105241_10003277
491 Ga0105248_10860099
492 Ga0105248_11041900
493 Ga0105248_11595871
494 Ga0105237_10305257
495 Ga0105238_11484989
496 Ga0105238_12444184
497 Ga0105238_12828941
498 Ga0105249_10032591
499 Ga0105249_10507717
500 Ga0105249_12071466
501 Ga0105249_12561755
502 Ga0099796_10113965
503 Ga0105239_10368277
504 Ga0105246_10227446
505 Ga0157373_10000370
506 Ga0157369_10027879
507 Ga0157374_10534561
508 Ga0163162_11254227
509 Ga0157515_130084
510 Ga0163163_10144825
511 Ga0182008_10069601
512 Ga0206354_10361920
513 Ga0213871_10001086
514 Ga0207697_10082813
515 Ga0207697_10194147
516 Ga0207653_10007293
517 Ga0207688_10076957
518 Ga0207688_10131162
519 Ga0207680_10705466
520 Ga0207645_10000264
521 Ga0207645_10398025
522 Ga0207643_10000077
523 Ga0207684_10002667
524 Ga0207684_10006341
525 Ga0207684_10310724
526 Ga0207654_10006156
527 Ga0207707_10000234
528 Ga0207671_10209882
529 Ga0207660_10000890
530 Ga0207662_10036728
531 Ga0207657_10000419
532 Ga0207649_10024279
533 Ga0207652_10000306
534 Ga0207646_10000905
535 Ga0207646_10036211
536 Ga0207681_10007590
537 Ga0207694_11057135
538 Ga0207650_10049884
539 Ga0207644_10753106
540 Ga0207690_10019619
541 Ga0207706_10011147
542 Ga0207709_10097241
543 Ga0207670_10292038
544 Ga0207670_10894559
545 Ga0207669_10142103
546 Ga0207704_10472651
547 Ga0207704_11029882
548 Ga0207691_10410521
549 Ga0207691_10546723
550 Ga0207689_10000138
551 Ga0207679_10006218
552 Ga0207667_10000287
553 Ga0207667_10629465
554 Ga0207651_10026375
555 Ga0207651_10303630
556 Ga0207651_10411830
557 Ga0207712_10324979
558 Ga0207712_10809384
559 Ga0207668_10372396
560 Ga0207640_10060659
561 Ga0207658_11237712
562 Ga0207677_10420184
563 Ga0207703_10175012
564 Ga0207703_10893500
565 Ga0207703_11807690
566 Ga0207639_10113786
567 Ga0207678_10002675
568 Ga0207702_10031800
569 Ga0207641_10158689
570 Ga0207641_10711875
571 Ga0207648_10001989
572 Ga0207674_10000315
573 Ga0207674_10014929
574 Ga0207674_10269247
575 Ga0207675_100015103
576 Ga0207683_10047609
577 Ga0207428_10082130
578 Ga0268266_10181903
579 Ga0268265_10828328
580 Ga0265332_10067846
581 Ga0265316_10326425
582 Ga0307408_101591979
583 Ga0307405_10299151
584 Ga0307410_10378245
585 Ga0307412_10974720
586 Ga0307409_100491161
587 Ga0307416_100992930
588 Ga0307415_100215958
589 Ga0307415_100224045
590 Ga0373948_0050443
591 Ga0373959_0076006
592 Ga0373934_0056385
593 Ga0373940_0009299
594 Ga0373952_0058054
595 Ga0373936_0387924
596 Ga0373939_0078390
597 Ga0373939_0236253
598 Ga0373939_0475998
599 Ga0373954_0120540
600 Ga0373946_0499524
601 Ga0373961_0176072
602 Ga0373927_0112821
603 Ga0373933_0139654
604 Ga0373937_0413330
605 Ga0373925_0215942
606 Ga0395899_0408721
607 Ga0395900_1422640
608 Ga0395901_0030605
609 Ga0436365_1159260
610 Ga0436360_1052254
611 Ga0436361_0787177
612 Ga0436363_0349805
613 Ga0451839_0738751
614 Ga0451843_1460392
615 Ga0439448_0002151
616 Ga0439458_0003842
617 Ga0439444_0011949
618 Ga0439459_0001033
619 Ga0439460_0027409
620 Ga0451577_0016612
621 Ga0451577_0082178
622 Ga0453683_0009761
623 Ga0466963_0032443
624 Ga0453684_0033681
625 Ga0453684_0257533
626 Ga0451576_0174876
627 Ga0495629_0297921
628 Ga0495580_0187117
629 Ga0495669_0020102
630 Ga0495581_0608377
631 Ga0496102_0070421
632 Ga0496103_0186006
633 Ga0501033_0238735
634 Ga0501034_0003169
635 Ga0501034_0011580
636 Ga0501034_0188285
637 Ga0501034_0596145
638 Ga0501036_0174517
639 Ga0501037_0418867
640 Ga0501037_1047608
641 Ga0501038_1040321
642 Ga0501039_0395297
643 Ga0501039_0780010
644 Ga0501040_0049792
645 Ga0501042_0328932
646 Ga0501043_0403489
647 Ga0501046_0095210
648 Ga0501047_0452992
649 Ga0501048_0063379
650 Ga0501067_0033966
651 Ga0501068_0015808
652 Ga0501068_0422102
653 Ga0501071_0415051
654 Ga0501072_0220857
655 Ga0501074_0275919
656 Ga0501075_0083661
657 Ga0501077_0027791
658 Ga0501079_0131301
659 Ga0501079_0554930
660 Ga0501080_0504614
661 Ga0501081_0033176
662 Ga0501044_0015018
663 Ga0501044_1150947
664 Ga0501045_0061359
665 nmdc:mga03683_11102_c1
666 nmdc:mga03683_11321_c1
667 nmdc:mga03683_275214_c1
668 nmdc:mga03683_375756_c1
669 nmdc:mga03683_5033_c1
670 nmdc:mga00v17_625530_c1
671 nmdc:mga0yw44_202668_c1
672 nmdc:mga0yw44_481416_c1
673 nmdc:mga0yw44_91025_c1
674 nmdc:mga0k408_77410_c1
675 nmdc:mga06z11_290845_c1
676 nmdc:mga06z11_8596_c1
677 nmdc:mga04h51_70816_c1
678 nmdc:mga07m45_326540_c1
679 nmdc:mga07m45_33878_c1
680 nmdc:mga07m45_676190_c1
681 nmdc:mga07m45_78297_c1
682 nmdc:mga0qj67_720_c1
683 nmdc:mga06r32_4338_c1
684 nmdc:mga08y16_1975_c1
685 nmdc:mga0n895_38035_c1
686 nmdc:mga0rr50_296605_c1
687 nmdc:mga08x19_210786_c1
688 nmdc:mga0a205_53004_c1
689 nmdc:mga0sz30_211408_c1
690 nmdc:mga0sz30_567_c1
691 Ga0495619_0774566
692 Ga0500644_0173446
693 Ga0500646_0327196
694 Ga0500651_0086312
695 Ga0500566_0509363
696 Ga0500641_0000273
697 Ga0500652_282754
698 Ga0500658_0159653
699 Ga0500616_0018966
700 Ga0500620_060967
701 Ga0501084_0178958
702 Ga0501084_0325388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

66

133

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8914 37 64
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8891 18 148
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8752 18 148
4ddx-assembly2.cif.gz_B thermotoga maritima reverse gyrase, primitive monoclinic form 0.8593 37 62
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.8592 14 147
ID Description Score Start End Superfamily
2ayjA00 Few Secondary Structures;Irregular;ZNF265 like; 0.7919 37 64 4.10.1060.50
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.782 22 67 6.10.30.10
6g5hc00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7705 69 125 2.40.50.140
af_A8DYY3_2_62_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7365 67 127 2.40.50.140
af_A0A1D6MEG7_37_119_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6745 70 115 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A328XIJ5-F1-model_v4 deleted 0.9772 5 148
AF-A0A2A2VAX7-F1-model_v4 DNA-binding protein 0.9757 6 148 GO:0003677
AF-A0A849N338-F1-model_v4 DNA-binding protein 0.9756 8 148 GO:0003677
AF-A0A6N9CPB7-F1-model_v4 deleted 0.9736 6 148
AF-A0A6I2WMU1-F1-model_v4 DNA-binding protein 0.9716 6 148 GO:0003677

Map