F418542

General Info

Members Datasets Scaffolds Average Seq Length
351 211 702 329

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100033905|Ga0070708_1000339054
Length 361
Sequence VTVEGSGVGAGVSAGAERFLVTGALGCIGAWTVRELVREGVPVVAYDIGSDPRRLALILTPDELARVTFVAGDITDLDALDRTLGDHGITNVVHLAALQVPFCRADPPLGARVNVVGTVNVFEAVRRRRDGGSPMAPVVYTGSIGMFVASDADPATGQLREDAEPHPGNHYGVYKFANEGTGRIYWADAGVPSVGLRPMTVYGAGRDQGMTSSPTVAIAAAVLGTPFRISFGGSTLFQYAEDVAKTLLIASRAAPAGPRVFNFGGSQVPIEDWIEAIDDAVAGASELITFDPTPLPFPSDIQHDRLAELGAVPVTPHREAIAATARIFQQLAAEGRLVGSEHGVPVPPAAAQPAPTAASSA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.83
Rhizosphere 90.03
Stem 0
Stem Tuber 0
Unclassified 9.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100033905 3300005445 Bacteria 4437
2 rootH1_10046196 3300003323 Bacteria 4049
3 Ga0070683_100404979 3300005329 Unclassified 1301
4 Ga0070690_100020962 3300005330 Bacteria 3987
5 Ga0070690_100147119 3300005330 Bacteria 1604
6 Ga0070690_100206465 3300005330 Bacteria 1369
7 Ga0070670_100064619 3300005331 Bacteria 3140
8 Ga0070670_100177252 3300005331 Unclassified 1850
9 Ga0068869_100000379 3300005334 Bacteria 24141
10 Ga0068869_100263746 3300005334 Bacteria 1380
11 Ga0070680_100125108 3300005336 Unclassified 2148
12 Ga0070689_100008131 3300005340 Bacteria 7372
13 Ga0070689_100037514 3300005340 Bacteria 3705
14 Ga0070687_100001383 3300005343 Bacteria 8499
15 Ga0070687_100208442 3300005343 Unclassified 1189
16 Ga0070692_10007481 3300005345 Bacteria 4811
17 Ga0070692_10091452 3300005345 Bacteria 1654
18 Ga0070692_10126967 3300005345 Bacteria 1429
19 Ga0070675_100012214 3300005354 Bacteria 6732
20 Ga0070674_100012227 3300005356 Bacteria 5268
21 Ga0070659_100036240 3300005366 Bacteria 3844
22 Ga0070710_10166578 3300005437 Bacteria 1370
23 Ga0070701_10006163 3300005438 Bacteria 5028
24 Ga0070701_10048092 3300005438 Bacteria 2199
25 Ga0070705_100006367 3300005440 Bacteria 5784
26 Ga0070705_100019152 3300005440 Bacteria 3599
27 Ga0070705_100068933 3300005440 Bacteria 2131
28 Ga0070700_100012384 3300005441 Bacteria 4757
29 Ga0070700_100020227 3300005441 Bacteria 3852
30 Ga0070700_100027239 3300005441 Bacteria 3386
31 Ga0070694_100033763 3300005444 Bacteria 3370
32 Ga0070694_100069624 3300005444 Bacteria 2421
33 Ga0070694_100076816 3300005444 Bacteria 2312
34 Ga0070694_100120840 3300005444 Bacteria 1879
35 Ga0070663_100040423 3300005455 Bacteria 3265
36 Ga0070678_100021859 3300005456 Bacteria 4228
37 Ga0070678_100041881 3300005456 Bacteria 3250
38 Ga0070678_100196765 3300005456 Bacteria 1661
39 Ga0070662_100100575 3300005457 Bacteria 2187
40 Ga0068867_100045172 3300005459 Bacteria 3229
41 Ga0068867_100059493 3300005459 Bacteria 2832
42 Ga0070706_100042018 3300005467 Bacteria 4222
43 Ga0070706_100251634 3300005467 Bacteria 1649
44 Ga0070707_100003116 3300005468 Bacteria 15677
45 Ga0070707_100034358 3300005468 Bacteria 4836
46 Ga0070707_100064736 3300005468 Bacteria 3511
47 Ga0070707_100069385 3300005468 Bacteria 3394
48 Ga0070698_100003942 3300005471 Bacteria 16322
49 Ga0070698_100066762 3300005471 Bacteria 3619
50 Ga0070698_100547269 3300005471 Unclassified 1097
51 Ga0070699_100009244 3300005518 Bacteria 8542
52 Ga0070699_100012647 3300005518 Bacteria 7280
53 Ga0070699_100166388 3300005518 Archaea 1953
54 Ga0070684_100020594 3300005535 Bacteria 5470
55 Ga0070697_100093799 3300005536 Bacteria 2486
56 Ga0070697_100144400 3300005536 Bacteria 2002
57 Ga0070686_100001801 3300005544 Bacteria 11947
58 Ga0070686_100032506 3300005544 Bacteria 3199
59 Ga0070686_100095981 3300005544 Bacteria 1993
60 Ga0070695_100051339 3300005545 Bacteria 2646
61 Ga0070695_100098554 3300005545 Archaea 1964
62 Ga0070696_100014783 3300005546 Bacteria 5238
63 Ga0070696_100020092 3300005546 Bacteria 4528
64 Ga0070696_100069543 3300005546 Bacteria 2474
65 Ga0070696_100084420 3300005546 Archaea 2253
66 Ga0070696_100110026 3300005546 Bacteria 1983
67 Ga0070696_100146271 3300005546 Archaea 1731
68 Ga0070696_100206802 3300005546 Bacteria 1468
69 Ga0070693_100007996 3300005547 Bacteria 5190
70 Ga0070693_100082549 3300005547 Unclassified 1919
71 Ga0070693_100154762 3300005547 Unclassified 1455
72 Ga0070704_100208345 3300005549 Bacteria 1583
73 Ga0068855_100156932 3300005563 Bacteria 2585
74 Ga0070664_100268624 3300005564 Bacteria 1536
75 Ga0070702_100013975 3300005615 Bacteria 4065
76 Ga0070702_100021758 3300005615 Bacteria 3381
77 Ga0068859_100300136 3300005617 Unclassified 1699
78 Ga0068864_100002055 3300005618 Bacteria 16613
79 Ga0068861_100052104 3300005719 Bacteria 3109
80 Ga0068858_100046670 3300005842 Bacteria 4015
81 Ga0068858_100224607 3300005842 Unclassified 1779
82 Ga0068860_100153721 3300005843 Bacteria 2217
83 Ga0068862_100054380 3300005844 Bacteria 3428
84 Ga0068862_100433976 3300005844 Unclassified 1235
85 Ga0081455_10067939 3300005937 Bacteria 2968
86 Ga0081539_10003699 3300005985 Bacteria 18239
87 Ga0070716_100002490 3300006173 Bacteria 8508
88 Ga0075431_100002531 3300006847 Bacteria 17634
89 Ga0075431_100331716 3300006847 Bacteria 1532
90 Ga0075433_10008779 3300006852 Bacteria 8064
91 Ga0075433_10194637 3300006852 Bacteria 1803
92 Ga0068865_100002121 3300006881 Bacteria 11719
93 Ga0075436_100134837 3300006914 Bacteria 1733
94 Ga0097620_100300125 3300006931 Unclassified 1699
95 Ga0075435_100306790 3300007076 Bacteria 1358
96 Ga0099794_10007863 3300007265 Bacteria 4404
97 Ga0099795_10068162 3300007788 Bacteria 1337
98 Ga0111539_10040815 3300009094 Bacteria 5584
99 Ga0105245_10002514 3300009098 Bacteria 16531
100 Ga0105245_10026299 3300009098 Bacteria 5121
101 Ga0105245_10100511 3300009098 Bacteria 2675
102 Ga0105245_10319523 3300009098 Unclassified 1529
103 Ga0105245_10438085 3300009098 Unclassified 1313
104 Ga0114129_10029545 3300009147 Bacteria 7762
105 Ga0114129_10176589 3300009147 Bacteria 2909
106 Ga0105243_10007861 3300009148 Bacteria 8192
107 Ga0105243_10053990 3300009148 Unclassified 3188
108 Ga0105243_10074237 3300009148 Bacteria 2758
109 Ga0105242_10026773 3300009176 Bacteria 4572
110 Ga0105242_10081704 3300009176 Bacteria 2703
111 Ga0105248_10106746 3300009177 Bacteria 3157
112 Ga0105248_10301337 3300009177 Bacteria 1805
113 Ga0105238_10148643 3300009551 Bacteria 2319
114 Ga0105249_10152765 3300009553 Bacteria 2224
115 Ga0105249_10385816 3300009553 Unclassified 1428
116 Ga0105239_10491269 3300010375 Unclassified 1395
117 Ga0157378_10006099 3300013297 Bacteria 10558
118 Ga0157378_10336235 3300013297 Bacteria 1471
119 Ga0157378_10456801 3300013297 Bacteria 1269
120 Ga0163162_10110846 3300013306 Bacteria 2841
121 Ga0157372_10435489 3300013307 Bacteria 1528
122 Ga0157375_10006045 3300013308 Bacteria 10558
123 Ga0157375_10217876 3300013308 Unclassified 2067
124 Ga0163163_10067547 3300014325 Bacteria 3555
125 Ga0157380_10036967 3300014326 Bacteria 3782
126 Ga0157380_10098980 3300014326 Bacteria 2424
127 Ga0157377_10103855 3300014745 Bacteria 1698
128 Ga0157379_10006437 3300014968 Bacteria 10119
129 Ga0157379_10013210 3300014968 Bacteria 7232
130 Ga0163161_10044118 3300017792 Bacteria 3211
131 Ga0207653_10059357 3300025885 Unclassified 1287
132 Ga0207692_10130850 3300025898 Bacteria 1417
133 Ga0207642_10009287 3300025899 Bacteria 3416
134 Ga0207688_10256062 3300025901 Bacteria 1061
135 Ga0207647_10095843 3300025904 Bacteria 1766
136 Ga0207684_10041324 3300025910 Bacteria 3910
137 Ga0207684_10062651 3300025910 Bacteria 3158
138 Ga0207684_10108897 3300025910 Bacteria 2371
139 Ga0207662_10007362 3300025918 Bacteria 5989
140 Ga0207646_10014462 3300025922 Bacteria 7495
141 Ga0207646_10015272 3300025922 Bacteria 7262
142 Ga0207646_10050724 3300025922 Bacteria 3713
143 Ga0207650_10046138 3300025925 Bacteria 3208
144 Ga0207659_10069801 3300025926 Bacteria 2560
145 Ga0207659_10119655 3300025926 Bacteria 2016
146 Ga0207687_10037933 3300025927 Bacteria 3291
147 Ga0207687_10152454 3300025927 Bacteria 1765
148 Ga0207687_10185330 3300025927 Bacteria 1615
149 Ga0207664_10226209 3300025929 Bacteria 1625
150 Ga0207706_10016839 3300025933 Bacteria 6597
151 Ga0207686_10000589 3300025934 Bacteria 22694
152 Ga0207686_10021368 3300025934 Bacteria 3714
153 Ga0207709_10265464 3300025935 Bacteria 1261
154 Ga0207670_10023477 3300025936 Bacteria 3840
155 Ga0207670_10028129 3300025936 Bacteria 3564
156 Ga0207669_10070236 3300025937 Unclassified 2195
157 Ga0207669_10073718 3300025937 Bacteria 2155
158 Ga0207704_10134150 3300025938 Bacteria 1720
159 Ga0207665_10087469 3300025939 Bacteria 2154
160 Ga0207665_10301686 3300025939 Bacteria 1197
161 Ga0207691_10140975 3300025940 Bacteria 2125
162 Ga0207689_10000373 3300025942 Bacteria 42264
163 Ga0207689_10265046 3300025942 Unclassified 1422
164 Ga0207651_10149941 3300025960 Bacteria 1814
165 Ga0207640_10160809 3300025981 Bacteria 1661
166 Ga0207703_10041456 3300026035 Bacteria 3688
167 Ga0207703_10180625 3300026035 Archaea 1862
168 Ga0207639_10204491 3300026041 Bacteria 1696
169 Ga0207678_10019142 3300026067 Bacteria 6011
170 Ga0207708_10002323 3300026075 Bacteria 13969
171 Ga0207708_10003513 3300026075 Bacteria 11555
172 Ga0207648_10001402 3300026089 Bacteria 26514
173 Ga0207648_10007203 3300026089 Bacteria 10967
174 Ga0207675_100001212 3300026118 Bacteria 25701
175 Ga0207675_100046514 3300026118 Bacteria 4054
176 Ga0207683_10007154 3300026121 Bacteria 9568
177 Ga0207683_10074797 3300026121 Bacteria 2998
178 Ga0207428_10079758 3300027907 Bacteria 2559
179 Ga0268265_10177964 3300028380 Bacteria 1825
180 Ga0265319_1039628 3300028563 Bacteria 1596
181 Ga0265328_10075176 3300031239 Bacteria 1243
182 Ga0265342_10026896 3300031712 Bacteria 3601
183 Ga0307405_10047504 3300031731 Bacteria 2644
184 Ga0307405_10062488 3300031731 Bacteria 2359
185 Ga0307413_10287658 3300031824 Bacteria 1240
186 Ga0307406_10051172 3300031901 Bacteria 2622
187 Ga0307409_100014314 3300031995 Bacteria 5153
188 Ga0307416_100002318 3300032002 Bacteria 10881
189 Ga0307415_100010058 3300032126 Bacteria 5338
190 Ga0307415_100034814 3300032126 Bacteria 3283
191 Ga0307415_100068128 3300032126 Bacteria 2490
192 Ga0373923_0029489 3300035111 Bacteria 2201
193 Ga0373936_0007382 3300035113 Bacteria 4137
194 Ga0373945_0009822 3300035116 Bacteria 3139
195 Ga0373953_0011130 3300035117 Bacteria 3147
196 Ga0373954_0003046 3300035118 Bacteria 7073
197 Ga0373954_0011008 3300035118 Bacteria 4002
198 Ga0373956_0013522 3300035119 Bacteria 3395
199 Ga0373957_0005787 3300035120 Bacteria 3855
200 Ga0373957_0087096 3300035120 Unclassified 1237
201 Ga0373943_0005337 3300035170 Bacteria 5778
202 Ga0373946_0038401 3300035171 Bacteria 1950
203 Ga0316574_0005638 3300035398 Bacteria 6697
204 Ga0373924_0015350 3300035410 Bacteria 2911
205 Ga0373931_0042030 3300035691 Bacteria 2402
206 Ga0373935_0109156 3300035692 Unclassified 1834
207 Ga0373933_0016553 3300035724 Bacteria 4125
208 Ga0373933_0110868 3300035724 Bacteria 1711
209 Ga0373947_0029022 3300035725 Bacteria 3245
210 Ga0373937_0152998 3300036401 Bacteria 2161
211 Ga0316582_0128547 3300036647 Bacteria 1700
212 Ga0316584_0014929 3300036712 Bacteria 5547
213 Ga0316584_0041238 3300036712 Bacteria 3441
214 Ga0373925_0019447 3300037068 Bacteria 4939
215 Ga0373925_0191632 3300037068 Bacteria 1622
216 Ga0395900_0200448 3300037418 Bacteria 2020
217 Ga0395901_0368111 3300038443 Bacteria 1481
218 Ga0400483_117802 3300039062 Bacteria 8782
219 Ga0400483_223906 3300039062 Bacteria 10451
220 Ga0400483_223961 3300039062 Bacteria 2686
221 Ga0466972_0008058 3300044658 Bacteria 5280
222 Ga0466965_0006350 3300044683 Bacteria 5359
223 Ga0453684_0140679 3300044712 Bacteria 2882
224 Ga0453684_0188995 3300044712 Bacteria 2411
225 Ga0453684_0245485 3300044712 Bacteria 2059
226 Ga0466968_0006098 3300044735 Bacteria 4527
227 Ga0466960_0023686 3300044901 Bacteria 2759
228 Ga0466960_0167246 3300044901 Unclassified 1185
229 Ga0451576_0103126 3300045051 Bacteria 2968
230 Ga0495629_0041160 3300046459 Bacteria 3252
231 Ga0495641_0016284 3300046461 Bacteria 3921
232 Ga0495651_0007305 3300046462 Bacteria 8446
233 Ga0495651_0037211 3300046462 Bacteria 3788
234 Ga0495653_0016904 3300046463 Bacteria 5934
235 Ga0495580_0036664 3300046472 Bacteria 3519
236 Ga0495662_0015098 3300046476 Bacteria 3752
237 Ga0495608_0007913 3300046511 Bacteria 7469
238 Ga0495608_0153646 3300046511 Bacteria 1466
239 Ga0495618_0051681 3300046514 Bacteria 2596
240 Ga0495628_0019146 3300046516 Bacteria 5662
241 Ga0495628_0379160 3300046516 Bacteria 1036
242 Ga0495630_0051976 3300046517 Bacteria 3067
243 Ga0495630_0173617 3300046517 Archaea 1643
244 Ga0495586_0170590 3300046535 Unclassified 1229
245 Ga0495587_0019743 3300046536 Bacteria 4167
246 Ga0495667_0113540 3300046559 Unclassified 1750
247 Ga0495634_0027303 3300046642 Bacteria 3972
248 Ga0495635_0026777 3300046663 Bacteria 4010
249 Ga0495657_0022849 3300046675 Bacteria 4474
250 Ga0495657_0105287 3300046675 Bacteria 1793
251 Ga0495599_0005279 3300046678 Bacteria 7709
252 Ga0495647_0038824 3300046681 Bacteria 1801
253 Ga0495624_0110281 3300046690 Bacteria 1692
254 Ga0495600_0012121 3300046809 Bacteria 5384
255 Ga0495604_0200203 3300047317 Bacteria 1386
256 Ga0495604_0232465 3300047317 Bacteria 1264
257 Ga0495636_0010138 3300047318 Bacteria 3716
258 Ga0495674_0044343 3300047319 Bacteria 3954
259 Ga0495674_0223607 3300047319 Bacteria 1555
260 Ga0495680_0074049 3300047322 Bacteria 2587
261 Ga0495680_0094267 3300047322 Bacteria 2240
262 Ga0495675_0012789 3300047444 Bacteria 5286
263 Ga0495684_0017923 3300047471 Bacteria 5455
264 Ga0496101_0073415 3300048904 Bacteria 2513
265 Ga0496102_0047200 3300048905 Bacteria 3912
266 Ga0496102_0380755 3300048905 Bacteria 1328
267 Ga0496103_0006156 3300048906 Bacteria 7170
268 Ga0496103_0232027 3300048906 Bacteria 1187
269 Ga0496104_0074848 3300048907 Bacteria 3223
270 Ga0496106_0008542 3300048909 Bacteria 7576
271 Ga0496106_0079668 3300048909 Bacteria 2515
272 Ga0496108_0000118 3300048911 Bacteria 78011
273 Ga0496108_0018954 3300048911 Bacteria 5642
274 Ga0496108_0042146 3300048911 Bacteria 3810
275 Ga0496108_0050765 3300048911 Bacteria 3473
276 Ga0496108_0344594 3300048911 Unclassified 1300
277 Ga0496109_0046001 3300048912 Bacteria 3962
278 Ga0496109_0061773 3300048912 Bacteria 3426
279 Ga0496109_0076313 3300048912 Bacteria 3082
280 Ga0496109_0222228 3300048912 Unclassified 1776
281 Ga0496109_0384599 3300048912 Unclassified 1326
282 Ga0496110_0033625 3300048913 Bacteria 4437
283 Ga0496110_0186823 3300048913 Bacteria 1882
284 Ga0496112_0004554 3300048915 Bacteria 11779
285 Ga0496112_0081832 3300048915 Bacteria 3194
286 Ga0496112_0147063 3300048915 Archaea 2325
287 Ga0496112_0150117 3300048915 Bacteria 2298
288 Ga0496112_0160906 3300048915 Bacteria 2212
289 Ga0496112_0349697 3300048915 Bacteria 1421
290 Ga0496113_0060273 3300048916 Bacteria 2860
291 Ga0496113_0070602 3300048916 Bacteria 2655
292 Ga0496113_0119564 3300048916 Bacteria 2059
293 Ga0496114_0232995 3300048917 Bacteria 1618
294 Ga0496114_0327527 3300048917 Bacteria 1354
295 Ga0501031_0047074 3300049568 Bacteria 2811
296 Ga0501031_0146873 3300049568 Bacteria 1541
297 Ga0501032_0056515 3300049569 Bacteria 2638
298 Ga0501034_0004340 3300049571 Bacteria 15803
299 Ga0501034_0035882 3300049571 Bacteria 5027
300 Ga0501036_0061224 3300049572 Bacteria 3188
301 Ga0501038_0070080 3300049574 Bacteria 2977
302 Ga0501040_0083069 3300049576 Bacteria 2221
303 Ga0501041_0011768 3300049577 Bacteria 5179
304 Ga0501068_0001056 3300049584 Bacteria 14595
305 Ga0501068_0023152 3300049584 Bacteria 3639
306 Ga0501068_0108841 3300049584 Bacteria 1722
307 Ga0501070_0242733 3300049586 Unclassified 1474
308 Ga0501071_0050062 3300049587 Bacteria 3009
309 Ga0501071_0274215 3300049587 Bacteria 1276
310 Ga0501071_0383724 3300049587 Bacteria 1072
311 Ga0501072_0025101 3300049588 Bacteria 4640
312 Ga0501072_0035659 3300049588 Bacteria 3897
313 Ga0501072_0093113 3300049588 Bacteria 2394
314 Ga0501073_0011340 3300049589 Bacteria 6519
315 Ga0501075_0009334 3300049591 Bacteria 6862
316 Ga0501075_0444921 3300049591 Bacteria 988
317 Ga0501076_0082902 3300049592 Bacteria 2574
318 Ga0501076_0148075 3300049592 Bacteria 1909
319 Ga0501079_0028380 3300049741 Bacteria 4294
320 Ga0501079_0300416 3300049741 Bacteria 1256
321 Ga0501080_0055558 3300049742 Bacteria 3688
322 Ga0501080_0061744 3300049742 Bacteria 3488
323 Ga0501083_0052732 3300049744 Unclassified 2732
324 Ga0501035_0057902 3300049822 Bacteria 3454
325 Ga0501044_0383616 3300049823 Unclassified 1320
326 Ga0501045_0016615 3300049824 Bacteria 5228
327 nmdc:mga05p37_31234_c1 3300050507 Bacteria 6142
328 nmdc:mga09592_297838_c1 3300050508 Unclassified 1398
329 nmdc:mga06r32_384999_c1 3300050510 Bacteria 1385
330 nmdc:mga06r32_47640_c1 3300050510 Bacteria 4095
331 nmdc:mga08y16_23335_c1 3300050511 Bacteria 6534
332 nmdc:mga0n895_546022_c1 3300050512 Bacteria 1165
333 nmdc:mga08x19_29214_c1 3300050514 Bacteria 3457
334 nmdc:mga08x19_65429_c1 3300050514 Bacteria 2361
335 nmdc:mga0a205_224513_c1 3300050515 Bacteria 1763
336 nmdc:mga0a205_8257_c1 3300050515 Bacteria 9466
337 Ga0495601_0007519 3300053077 Bacteria 6392
338 Ga0495601_0065478 3300053077 Bacteria 2313
339 Ga0495601_0214475 3300053077 Unclassified 1257
340 Ga0495601_0239302 3300053077 Unclassified 1185
341 Ga0495612_0000082 3300053078 Bacteria 42620
342 Ga0495595_0015964 3300053084 Bacteria 3207
343 Ga0495619_0044946 3300053085 Bacteria 2900
344 Ga0495619_0071134 3300053085 Bacteria 2327
345 Ga0501084_0034218 3300054114 Bacteria 4249
346 Ga0501084_0255341 3300054114 Bacteria 1480
347 Ga0501082_0134479 3300060353 Bacteria 2145
348 Ga0530510_0022351 3300061734 Bacteria 4504
349 Ga0530510_0042686 3300061734 Bacteria 3276
350 Ga0530510_0056945 3300061734 Bacteria 2825
351 Ga0530510_0113222 3300061734 Bacteria 1988
352 Ga0070708_100033905
353 rootH1_10046196
354 Ga0070683_100404979
355 Ga0070690_100020962
356 Ga0070690_100147119
357 Ga0070690_100206465
358 Ga0070670_100064619
359 Ga0070670_100177252
360 Ga0068869_100000379
361 Ga0068869_100263746
362 Ga0070680_100125108
363 Ga0070689_100008131
364 Ga0070689_100037514
365 Ga0070687_100001383
366 Ga0070687_100208442
367 Ga0070692_10007481
368 Ga0070692_10091452
369 Ga0070692_10126967
370 Ga0070675_100012214
371 Ga0070674_100012227
372 Ga0070659_100036240
373 Ga0070710_10166578
374 Ga0070701_10006163
375 Ga0070701_10048092
376 Ga0070705_100006367
377 Ga0070705_100019152
378 Ga0070705_100068933
379 Ga0070700_100012384
380 Ga0070700_100020227
381 Ga0070700_100027239
382 Ga0070694_100033763
383 Ga0070694_100069624
384 Ga0070694_100076816
385 Ga0070694_100120840
386 Ga0070663_100040423
387 Ga0070678_100021859
388 Ga0070678_100041881
389 Ga0070678_100196765
390 Ga0070662_100100575
391 Ga0068867_100045172
392 Ga0068867_100059493
393 Ga0070706_100042018
394 Ga0070706_100251634
395 Ga0070707_100003116
396 Ga0070707_100034358
397 Ga0070707_100064736
398 Ga0070707_100069385
399 Ga0070698_100003942
400 Ga0070698_100066762
401 Ga0070698_100547269
402 Ga0070699_100009244
403 Ga0070699_100012647
404 Ga0070699_100166388
405 Ga0070684_100020594
406 Ga0070697_100093799
407 Ga0070697_100144400
408 Ga0070686_100001801
409 Ga0070686_100032506
410 Ga0070686_100095981
411 Ga0070695_100051339
412 Ga0070695_100098554
413 Ga0070696_100014783
414 Ga0070696_100020092
415 Ga0070696_100069543
416 Ga0070696_100084420
417 Ga0070696_100110026
418 Ga0070696_100146271
419 Ga0070696_100206802
420 Ga0070693_100007996
421 Ga0070693_100082549
422 Ga0070693_100154762
423 Ga0070704_100208345
424 Ga0068855_100156932
425 Ga0070664_100268624
426 Ga0070702_100013975
427 Ga0070702_100021758
428 Ga0068859_100300136
429 Ga0068864_100002055
430 Ga0068861_100052104
431 Ga0068858_100046670
432 Ga0068858_100224607
433 Ga0068860_100153721
434 Ga0068862_100054380
435 Ga0068862_100433976
436 Ga0081455_10067939
437 Ga0081539_10003699
438 Ga0070716_100002490
439 Ga0075431_100002531
440 Ga0075431_100331716
441 Ga0075433_10008779
442 Ga0075433_10194637
443 Ga0068865_100002121
444 Ga0075436_100134837
445 Ga0097620_100300125
446 Ga0075435_100306790
447 Ga0099794_10007863
448 Ga0099795_10068162
449 Ga0111539_10040815
450 Ga0105245_10002514
451 Ga0105245_10026299
452 Ga0105245_10100511
453 Ga0105245_10319523
454 Ga0105245_10438085
455 Ga0114129_10029545
456 Ga0114129_10176589
457 Ga0105243_10007861
458 Ga0105243_10053990
459 Ga0105243_10074237
460 Ga0105242_10026773
461 Ga0105242_10081704
462 Ga0105248_10106746
463 Ga0105248_10301337
464 Ga0105238_10148643
465 Ga0105249_10152765
466 Ga0105249_10385816
467 Ga0105239_10491269
468 Ga0157378_10006099
469 Ga0157378_10336235
470 Ga0157378_10456801
471 Ga0163162_10110846
472 Ga0157372_10435489
473 Ga0157375_10006045
474 Ga0157375_10217876
475 Ga0163163_10067547
476 Ga0157380_10036967
477 Ga0157380_10098980
478 Ga0157377_10103855
479 Ga0157379_10006437
480 Ga0157379_10013210
481 Ga0163161_10044118
482 Ga0207653_10059357
483 Ga0207692_10130850
484 Ga0207642_10009287
485 Ga0207688_10256062
486 Ga0207647_10095843
487 Ga0207684_10041324
488 Ga0207684_10062651
489 Ga0207684_10108897
490 Ga0207662_10007362
491 Ga0207646_10014462
492 Ga0207646_10015272
493 Ga0207646_10050724
494 Ga0207650_10046138
495 Ga0207659_10069801
496 Ga0207659_10119655
497 Ga0207687_10037933
498 Ga0207687_10152454
499 Ga0207687_10185330
500 Ga0207664_10226209
501 Ga0207706_10016839
502 Ga0207686_10000589
503 Ga0207686_10021368
504 Ga0207709_10265464
505 Ga0207670_10023477
506 Ga0207670_10028129
507 Ga0207669_10070236
508 Ga0207669_10073718
509 Ga0207704_10134150
510 Ga0207665_10087469
511 Ga0207665_10301686
512 Ga0207691_10140975
513 Ga0207689_10000373
514 Ga0207689_10265046
515 Ga0207651_10149941
516 Ga0207640_10160809
517 Ga0207703_10041456
518 Ga0207703_10180625
519 Ga0207639_10204491
520 Ga0207678_10019142
521 Ga0207708_10002323
522 Ga0207708_10003513
523 Ga0207648_10001402
524 Ga0207648_10007203
525 Ga0207675_100001212
526 Ga0207675_100046514
527 Ga0207683_10007154
528 Ga0207683_10074797
529 Ga0207428_10079758
530 Ga0268265_10177964
531 Ga0265319_1039628
532 Ga0265328_10075176
533 Ga0265342_10026896
534 Ga0307405_10047504
535 Ga0307405_10062488
536 Ga0307413_10287658
537 Ga0307406_10051172
538 Ga0307409_100014314
539 Ga0307416_100002318
540 Ga0307415_100010058
541 Ga0307415_100034814
542 Ga0307415_100068128
543 Ga0373923_0029489
544 Ga0373936_0007382
545 Ga0373945_0009822
546 Ga0373953_0011130
547 Ga0373954_0003046
548 Ga0373954_0011008
549 Ga0373956_0013522
550 Ga0373957_0005787
551 Ga0373957_0087096
552 Ga0373943_0005337
553 Ga0373946_0038401
554 Ga0316574_0005638
555 Ga0373924_0015350
556 Ga0373931_0042030
557 Ga0373935_0109156
558 Ga0373933_0016553
559 Ga0373933_0110868
560 Ga0373947_0029022
561 Ga0373937_0152998
562 Ga0316582_0128547
563 Ga0316584_0014929
564 Ga0316584_0041238
565 Ga0373925_0019447
566 Ga0373925_0191632
567 Ga0395900_0200448
568 Ga0395901_0368111
569 Ga0400483_117802
570 Ga0400483_223906
571 Ga0400483_223961
572 Ga0466972_0008058
573 Ga0466965_0006350
574 Ga0453684_0140679
575 Ga0453684_0188995
576 Ga0453684_0245485
577 Ga0466968_0006098
578 Ga0466960_0023686
579 Ga0466960_0167246
580 Ga0451576_0103126
581 Ga0495629_0041160
582 Ga0495641_0016284
583 Ga0495651_0007305
584 Ga0495651_0037211
585 Ga0495653_0016904
586 Ga0495580_0036664
587 Ga0495662_0015098
588 Ga0495608_0007913
589 Ga0495608_0153646
590 Ga0495618_0051681
591 Ga0495628_0019146
592 Ga0495628_0379160
593 Ga0495630_0051976
594 Ga0495630_0173617
595 Ga0495586_0170590
596 Ga0495587_0019743
597 Ga0495667_0113540
598 Ga0495634_0027303
599 Ga0495635_0026777
600 Ga0495657_0022849
601 Ga0495657_0105287
602 Ga0495599_0005279
603 Ga0495647_0038824
604 Ga0495624_0110281
605 Ga0495600_0012121
606 Ga0495604_0200203
607 Ga0495604_0232465
608 Ga0495636_0010138
609 Ga0495674_0044343
610 Ga0495674_0223607
611 Ga0495680_0074049
612 Ga0495680_0094267
613 Ga0495675_0012789
614 Ga0495684_0017923
615 Ga0496101_0073415
616 Ga0496102_0047200
617 Ga0496102_0380755
618 Ga0496103_0006156
619 Ga0496103_0232027
620 Ga0496104_0074848
621 Ga0496106_0008542
622 Ga0496106_0079668
623 Ga0496108_0000118
624 Ga0496108_0018954
625 Ga0496108_0042146
626 Ga0496108_0050765
627 Ga0496108_0344594
628 Ga0496109_0046001
629 Ga0496109_0061773
630 Ga0496109_0076313
631 Ga0496109_0222228
632 Ga0496109_0384599
633 Ga0496110_0033625
634 Ga0496110_0186823
635 Ga0496112_0004554
636 Ga0496112_0081832
637 Ga0496112_0147063
638 Ga0496112_0150117
639 Ga0496112_0160906
640 Ga0496112_0349697
641 Ga0496113_0060273
642 Ga0496113_0070602
643 Ga0496113_0119564
644 Ga0496114_0232995
645 Ga0496114_0327527
646 Ga0501031_0047074
647 Ga0501031_0146873
648 Ga0501032_0056515
649 Ga0501034_0004340
650 Ga0501034_0035882
651 Ga0501036_0061224
652 Ga0501038_0070080
653 Ga0501040_0083069
654 Ga0501041_0011768
655 Ga0501068_0001056
656 Ga0501068_0023152
657 Ga0501068_0108841
658 Ga0501070_0242733
659 Ga0501071_0050062
660 Ga0501071_0274215
661 Ga0501071_0383724
662 Ga0501072_0025101
663 Ga0501072_0035659
664 Ga0501072_0093113
665 Ga0501073_0011340
666 Ga0501075_0009334
667 Ga0501075_0444921
668 Ga0501076_0082902
669 Ga0501076_0148075
670 Ga0501079_0028380
671 Ga0501079_0300416
672 Ga0501080_0055558
673 Ga0501080_0061744
674 Ga0501083_0052732
675 Ga0501035_0057902
676 Ga0501044_0383616
677 Ga0501045_0016615
678 nmdc:mga05p37_31234_c1
679 nmdc:mga09592_297838_c1
680 nmdc:mga06r32_384999_c1
681 nmdc:mga06r32_47640_c1
682 nmdc:mga08y16_23335_c1
683 nmdc:mga0n895_546022_c1
684 nmdc:mga08x19_29214_c1
685 nmdc:mga08x19_65429_c1
686 nmdc:mga0a205_224513_c1
687 nmdc:mga0a205_8257_c1
688 Ga0495601_0007519
689 Ga0495601_0065478
690 Ga0495601_0214475
691 Ga0495601_0239302
692 Ga0495612_0000082
693 Ga0495595_0015964
694 Ga0495619_0044946
695 Ga0495619_0071134
696 Ga0501084_0034218
697 Ga0501084_0255341
698 Ga0501082_0134479
699 Ga0530510_0022351
700 Ga0530510_0042686
701 Ga0530510_0056945
702 Ga0530510_0113222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

19

264

0.86

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

20

283

0.83

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

19

129

0.81

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

20

256

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yrb-assembly1.cif.gz_A mouse tdh mutant r180k with nad+ bound 0.8817 4 248
3wmx-assembly2.cif.gz_B gale-like l-threonine dehydrogenase from cupriavidus necator (holo form) 0.8764 4 308
4yr9-assembly2.cif.gz_B mouse tdh with nad+ bound 0.8762 4 308
4yr9-assembly1.cif.gz_C mouse tdh with nad+ bound 0.8742 4 308
7eps-assembly2.cif.gz_D partial consensus l-threonine 3-dehydrogenase (e-change) 0.8727 6 312
ID Description Score Start End Superfamily
af_Q8IZJ6_42_212_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.893 1 170 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8825 4 295 3.40.50.720
4yrbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8817 4 248 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8764 1 246 3.40.50.720
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8763 4 246 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A160TV36-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9792 1 316 GO:0003978
AF-A0A7W1I5B6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9764 1 235
AF-A0A7V9N7V9-F1-model_v4 SDR family oxidoreductase 0.9752 1 316
AF-A0A6L8DIT7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9737 4 316
AF-A0A6N8YKE6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9727 157 313

Map