F418492

General Info

Members Datasets Scaffolds Average Seq Length
351 175 351 198

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10083897|Ga0065712_100838972
Length 217
Sequence VRWFFSTLGFLLSWWGALIVSALDSSLLVVLPFGVDALLIYLVARHRDTFWLYPLIMTAGSVAGAAVTFWIGRKIGDKGLPKFVSEKRLDRLREKVRNAGAGTLALSAVLPPPFPLTPFVLACGALEVNRRLFFSVFAIMRLVRFGIEAMLARWQGERLLILLQSDAFKTAVIALAVVAMAGTAASIVVLWRRTRGSPSNERGKSRRAGNTRRRHAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 99.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2041146 2162886007 Bacteria 1037
2 Ga0065704_10077645 3300005289 Bacteria 4672
3 Ga0065712_10017283 3300005290 Bacteria 1987
4 Ga0065712_10083897 3300005290 Unclassified 2803
5 Ga0065715_10009651 3300005293 Bacteria 3459
6 Ga0065715_10326034 3300005293 Bacteria 993
7 Ga0065715_10527640 3300005293 Bacteria 758
8 Ga0065707_10091754 3300005295 Unclassified 3874
9 Ga0065707_10096855 3300005295 Bacteria 3227
10 Ga0070658_10263130 3300005327 Bacteria 1465
11 Ga0070690_100013057 3300005330 Bacteria 4901
12 Ga0070670_100016121 3300005331 Bacteria 6414
13 Ga0070670_100163695 3300005331 Bacteria 1928
14 Ga0070670_100299681 3300005331 Bacteria 1406
15 Ga0070670_100595929 3300005331 Unclassified 989
16 Ga0070670_100878344 3300005331 Bacteria 812
17 Ga0070677_10331208 3300005333 Unclassified 783
18 Ga0070682_100597411 3300005337 Bacteria 871
19 Ga0068868_100630399 3300005338 Unclassified 953
20 Ga0068868_100723899 3300005338 Unclassified 892
21 Ga0070689_100012827 3300005340 Bacteria 6050
22 Ga0070689_100046390 3300005340 Bacteria 3349
23 Ga0070689_100297918 3300005340 Bacteria 1342
24 Ga0070691_10030183 3300005341 Bacteria 2539
25 Ga0070687_100030225 3300005343 Bacteria 2647
26 Ga0070661_100444371 3300005344 Unclassified 1031
27 Ga0070661_100583663 3300005344 Bacteria 902
28 Ga0070692_10034644 3300005345 Bacteria 2552
29 Ga0070692_10040332 3300005345 Bacteria 2388
30 Ga0070668_100151415 3300005347 Bacteria 1876
31 Ga0070669_100004079 3300005353 Bacteria 10576
32 Ga0070675_100000288 3300005354 Bacteria 33540
33 Ga0070675_100011482 3300005354 Bacteria 6935
34 Ga0070675_100022974 3300005354 Bacteria 4983
35 Ga0070675_100601624 3300005354 Bacteria 997
36 Ga0070671_100001767 3300005355 Bacteria 16427
37 Ga0070674_100213789 3300005356 Bacteria 1496
38 Ga0070674_100656683 3300005356 Unclassified 892
39 Ga0070674_100675088 3300005356 Unclassified 881
40 Ga0070673_100231236 3300005364 Bacteria 1604
41 Ga0070688_100004179 3300005365 Bacteria 7498
42 Ga0070688_100011773 3300005365 Bacteria 4876
43 Ga0070703_10119342 3300005406 Unclassified 955
44 Ga0070701_10000218 3300005438 Bacteria 18070
45 Ga0070701_10004211 3300005438 Bacteria 5796
46 Ga0070701_10268713 3300005438 Bacteria 1037
47 Ga0070705_100002674 3300005440 Bacteria 8908
48 Ga0070705_100055532 3300005440 Bacteria 2328
49 Ga0070700_100085898 3300005441 Bacteria 2042
50 Ga0070694_100002846 3300005444 Bacteria 10274
51 Ga0070694_100114637 3300005444 Bacteria 1925
52 Ga0070694_100232308 3300005444 Unclassified 1388
53 Ga0070708_100148739 3300005445 Bacteria 2177
54 Ga0070708_101265709 3300005445 Unclassified 689
55 Ga0070708_101377253 3300005445 Bacteria 658
56 Ga0070678_100039671 3300005456 Bacteria 3325
57 Ga0070662_100472225 3300005457 Unclassified 1043
58 Ga0068867_100004574 3300005459 Bacteria 9729
59 Ga0070685_10126891 3300005466 Unclassified 1591
60 Ga0070706_100177188 3300005467 Bacteria 1991
61 Ga0070706_100334131 3300005467 Unclassified 1413
62 Ga0070706_100357751 3300005467 Unclassified 1360
63 Ga0070707_100029254 3300005468 Bacteria 5246
64 Ga0070707_100534628 3300005468 Bacteria 1134
65 Ga0070698_100000065 3300005471 Bacteria 77879
66 Ga0070698_100000742 3300005471 Bacteria 35105
67 Ga0070698_100022417 3300005471 Bacteria 6607
68 Ga0070698_100147065 3300005471 Bacteria 2305
69 Ga0070698_100528053 3300005471 Bacteria 1119
70 Ga0070699_100001259 3300005518 Bacteria 23354
71 Ga0070699_100003772 3300005518 Bacteria 13395
72 Ga0070699_100004083 3300005518 Bacteria 12907
73 Ga0070699_100032389 3300005518 Bacteria 4513
74 Ga0070684_100340086 3300005535 Bacteria 1380
75 Ga0070684_100763969 3300005535 Unclassified 903
76 Ga0070697_100064731 3300005536 Bacteria 2986
77 Ga0070672_100110079 3300005543 Bacteria 2244
78 Ga0070672_100240080 3300005543 Bacteria 1524
79 Ga0070672_100407733 3300005543 Bacteria 1166
80 Ga0070686_100089170 3300005544 Bacteria 2060
81 Ga0070695_100000291 3300005545 Bacteria 25256
82 Ga0070695_100207417 3300005545 Bacteria 1404
83 Ga0070695_100443891 3300005545 Unclassified 993
84 Ga0070695_100464664 3300005545 Bacteria 972
85 Ga0070696_100002518 3300005546 Bacteria 12135
86 Ga0070696_100006031 3300005546 Bacteria 8084
87 Ga0070665_100221619 3300005548 Bacteria 1892
88 Ga0070704_100000822 3300005549 Bacteria 15411
89 Ga0070704_100016810 3300005549 Bacteria 4634
90 Ga0070704_100034176 3300005549 Bacteria 3445
91 Ga0070704_100070048 3300005549 Bacteria 2543
92 Ga0070704_100405839 3300005549 Bacteria 1164
93 Ga0070704_101329459 3300005549 Bacteria 658
94 Ga0070664_100004597 3300005564 Bacteria 11076
95 Ga0070664_100056776 3300005564 Bacteria 3326
96 Ga0070664_100126123 3300005564 Bacteria 2246
97 Ga0070664_100145670 3300005564 Bacteria 2088
98 Ga0070664_100317155 3300005564 Bacteria 1412
99 Ga0070664_100963783 3300005564 Bacteria 801
100 Ga0068857_100086515 3300005577 Bacteria 2803
101 Ga0068857_100176326 3300005577 Bacteria 1944
102 Ga0068857_100752272 3300005577 Unclassified 928
103 Ga0068854_100441820 3300005578 Bacteria 1084
104 Ga0070702_100270310 3300005615 Bacteria 1162
105 Ga0070702_100414312 3300005615 Bacteria 968
106 Ga0068852_100522623 3300005616 Bacteria 1184
107 Ga0068859_100003581 3300005617 Bacteria 15820
108 Ga0068859_100058443 3300005617 Bacteria 3885
109 Ga0068859_100277102 3300005617 Bacteria 1770
110 Ga0068859_100332535 3300005617 Bacteria 1613
111 Ga0068864_100033709 3300005618 Bacteria 4354
112 Ga0068864_100068397 3300005618 Bacteria 3085
113 Ga0068864_100497029 3300005618 Unclassified 1173
114 Ga0068861_100042705 3300005719 Bacteria 3399
115 Ga0068861_100853048 3300005719 Unclassified 859
116 Ga0068870_10001418 3300005840 Bacteria 9688
117 Ga0068863_100307485 3300005841 Bacteria 1538
118 Ga0068863_100455997 3300005841 Bacteria 1255
119 Ga0068863_100552807 3300005841 Bacteria 1137
120 Ga0068858_100026364 3300005842 Bacteria 5402
121 Ga0068860_100001111 3300005843 Bacteria 29613
122 Ga0068860_100520187 3300005843 Bacteria 1190
123 Ga0068862_100026618 3300005844 Bacteria 4861
124 Ga0081539_10000112 3300005985 Bacteria 190218
125 Ga0075432_10030870 3300006058 Bacteria 1854
126 Ga0097621_100084511 3300006237 Bacteria 2646
127 Ga0097621_100522559 3300006237 Unclassified 1077
128 Ga0097621_100728417 3300006237 Unclassified 915
129 Ga0075428_100000677 3300006844 Bacteria 35042
130 Ga0075428_100212081 3300006844 Unclassified 2093
131 Ga0075428_100417958 3300006844 Unclassified 1437
132 Ga0075430_100172215 3300006846 Bacteria 1801
133 Ga0075431_100139429 3300006847 Bacteria 2500
134 Ga0075433_10183938 3300006852 Bacteria 1859
135 Ga0075433_11203412 3300006852 Bacteria 657
136 Ga0075434_100022987 3300006871 Bacteria 6069
137 Ga0075434_100035978 3300006871 Bacteria 4896
138 Ga0075434_100187650 3300006871 Unclassified 2088
139 Ga0075429_100055872 3300006880 Bacteria 3436
140 Ga0075429_100266322 3300006880 Bacteria 1501
141 Ga0075429_100342372 3300006880 Bacteria 1309
142 Ga0068865_100049060 3300006881 Bacteria 2908
143 Ga0068865_100347771 3300006881 Bacteria 1200
144 Ga0075436_100288145 3300006914 Bacteria 1175
145 Ga0097620_100003581 3300006931 Bacteria 15820
146 Ga0097620_100058443 3300006931 Bacteria 3885
147 Ga0097620_100277108 3300006931 Bacteria 1770
148 Ga0097620_100332552 3300006931 Bacteria 1613
149 Ga0075435_100032272 3300007076 Bacteria 4134
150 Ga0075435_100037142 3300007076 Unclassified 3877
151 Ga0075435_100105425 3300007076 Bacteria 2340
152 Ga0075435_100286414 3300007076 Bacteria 1407
153 Ga0111539_10007690 3300009094 Bacteria 13761
154 Ga0111539_10015225 3300009094 Bacteria 9583
155 Ga0111539_10572996 3300009094 Unclassified 1315
156 Ga0114129_10003565 3300009147 Bacteria 21911
157 Ga0114129_10031356 3300009147 Bacteria 7515
158 Ga0114129_10038920 3300009147 Bacteria 6703
159 Ga0114129_10059815 3300009147 Bacteria 5327
160 Ga0114129_10091610 3300009147 Bacteria 4211
161 Ga0114129_10138077 3300009147 Bacteria 3344
162 Ga0105243_10027166 3300009148 Bacteria 4384
163 Ga0105243_10599404 3300009148 Unclassified 1060
164 Ga0105248_10155278 3300009177 Bacteria 2582
165 Ga0105248_10393679 3300009177 Bacteria 1560
166 Ga0105248_11309270 3300009177 Bacteria 820
167 Ga0105249_10084132 3300009553 Bacteria 2963
168 Ga0105249_10839802 3300009553 Unclassified 984
169 Ga0105239_11262864 3300010375 Bacteria 852
170 Ga0105246_11248772 3300011119 Unclassified 686
171 Ga0157374_10049242 3300013296 Bacteria 3913
172 Ga0157374_10292638 3300013296 Bacteria 1610
173 Ga0157378_10071699 3300013297 Bacteria 3112
174 Ga0157378_10204118 3300013297 Bacteria 1871
175 Ga0157375_10012786 3300013308 Bacteria 7453
176 Ga0163163_10087568 3300014325 Bacteria 3124
177 Ga0157380_10101356 3300014326 Bacteria 2399
178 Ga0157380_10621967 3300014326 Bacteria 1072
179 Ga0157380_10819026 3300014326 Unclassified 950
180 Ga0157380_11021309 3300014326 Unclassified 861
181 Ga0157377_10024689 3300014745 Bacteria 3197
182 Ga0157377_10378602 3300014745 Unclassified 957
183 Ga0157379_10114996 3300014968 Bacteria 2419
184 Ga0157376_10193802 3300014969 Bacteria 1865
185 Ga0157376_11176053 3300014969 Unclassified 795
186 Ga0207653_10019906 3300025885 Bacteria 2119
187 Ga0207682_10200599 3300025893 Unclassified 917
188 Ga0207680_10076705 3300025903 Bacteria 2088
189 Ga0207645_10141421 3300025907 Bacteria 1568
190 Ga0207643_10001690 3300025908 Bacteria 12379
191 Ga0207643_10033283 3300025908 Unclassified 2883
192 Ga0207705_10188254 3300025909 Bacteria 1560
193 Ga0207684_10100982 3300025910 Bacteria 2466
194 Ga0207662_10220934 3300025918 Bacteria 1234
195 Ga0207657_10263634 3300025919 Bacteria 1371
196 Ga0207649_10375452 3300025920 Unclassified 1058
197 Ga0207649_10500367 3300025920 Bacteria 924
198 Ga0207646_10077472 3300025922 Bacteria 2971
199 Ga0207681_10014900 3300025923 Bacteria 4842
200 Ga0207681_10121466 3300025923 Unclassified 1916
201 Ga0207650_10002872 3300025925 Bacteria 11896
202 Ga0207650_10004466 3300025925 Bacteria 9562
203 Ga0207650_10380638 3300025925 Bacteria 1165
204 Ga0207650_10455058 3300025925 Bacteria 1066
205 Ga0207650_10821337 3300025925 Unclassified 788
206 Ga0207650_10832026 3300025925 Bacteria 783
207 Ga0207659_10000069 3300025926 Bacteria 65505
208 Ga0207659_10013559 3300025926 Bacteria 5226
209 Ga0207659_10016622 3300025926 Bacteria 4793
210 Ga0207659_10137087 3300025926 Unclassified 1895
211 Ga0207644_10029764 3300025931 Bacteria 3790
212 Ga0207644_11117890 3300025931 Unclassified 662
213 Ga0207706_10483755 3300025933 Unclassified 1069
214 Ga0207709_10014757 3300025935 Bacteria 4319
215 Ga0207670_10003906 3300025936 Bacteria 7953
216 Ga0207670_10025667 3300025936 Bacteria 3702
217 Ga0207670_10033926 3300025936 Bacteria 3293
218 Ga0207669_10078784 3300025937 Unclassified 2101
219 Ga0207704_10161748 3300025938 Bacteria 1594
220 Ga0207704_10164481 3300025938 Bacteria 1583
221 Ga0207704_10535711 3300025938 Bacteria 949
222 Ga0207704_10883869 3300025938 Unclassified 751
223 Ga0207711_10359401 3300025941 Bacteria 1349
224 Ga0207689_10028682 3300025942 Bacteria 4655
225 Ga0207661_10640456 3300025944 Unclassified 977
226 Ga0207679_10061127 3300025945 Bacteria 2803
227 Ga0207679_10106491 3300025945 Bacteria 2204
228 Ga0207679_10850225 3300025945 Unclassified 833
229 Ga0207712_10050855 3300025961 Bacteria 2895
230 Ga0207677_10123415 3300026023 Bacteria 1953
231 Ga0207703_10032013 3300026035 Bacteria 4160
232 Ga0207703_10173426 3300026035 Bacteria 1899
233 Ga0207708_10011735 3300026075 Bacteria 6529
234 Ga0207708_10069522 3300026075 Bacteria 2696
235 Ga0207641_10848143 3300026088 Bacteria 905
236 Ga0207641_11103606 3300026088 Bacteria 792
237 Ga0207648_10005597 3300026089 Bacteria 12632
238 Ga0207648_10520127 3300026089 Bacteria 1090
239 Ga0207648_10546633 3300026089 Bacteria 1063
240 Ga0207676_10134316 3300026095 Bacteria 2108
241 Ga0207676_10447938 3300026095 Unclassified 1216
242 Ga0207674_10080635 3300026116 Bacteria 3257
243 Ga0207674_10135128 3300026116 Bacteria 2428
244 Ga0207674_10174926 3300026116 Bacteria 2099
245 Ga0207675_100004581 3300026118 Bacteria 13329
246 Ga0207675_100128772 3300026118 Bacteria 2399
247 Ga0207675_100530897 3300026118 Bacteria 1174
248 Ga0207683_10514820 3300026121 Unclassified 1106
249 Ga0207428_10003996 3300027907 Bacteria 14156
250 Ga0207428_10029180 3300027907 Bacteria 4575
251 Ga0207428_10189808 3300027907 Bacteria 1549
252 Ga0207428_10275230 3300027907 Bacteria 1251
253 Ga0268266_11139009 3300028379 Unclassified 755
254 Ga0268265_10002628 3300028380 Bacteria 13353
255 Ga0268264_10008424 3300028381 Bacteria 8571
256 Ga0268264_10169950 3300028381 Bacteria 1971
257 Ga0268264_10775248 3300028381 Bacteria 957
258 Ga0307408_100043261 3300031548 Bacteria 3204
259 Ga0307408_100284258 3300031548 Bacteria 1379
260 Ga0307408_100286107 3300031548 Unclassified 1375
261 Ga0307405_10198384 3300031731 Bacteria 1455
262 Ga0307405_10245103 3300031731 Bacteria 1330
263 Ga0307413_10142062 3300031824 Bacteria 1660
264 Ga0307413_10190170 3300031824 Unclassified 1473
265 Ga0307413_10364613 3300031824 Bacteria 1120
266 Ga0307413_10567902 3300031824 Unclassified 923
267 Ga0307410_10014833 3300031852 Bacteria 4600
268 Ga0307410_10320870 3300031852 Bacteria 1229
269 Ga0307410_10578665 3300031852 Unclassified 934
270 Ga0307407_10039215 3300031903 Bacteria 2632
271 Ga0307407_10107927 3300031903 Unclassified 1742
272 Ga0307412_10027710 3300031911 Bacteria 3536
273 Ga0307412_10934645 3300031911 Unclassified 762
274 Ga0307409_100098762 3300031995 Unclassified 2415
275 Ga0307409_100145222 3300031995 Bacteria 2050
276 Ga0307416_100074276 3300032002 Bacteria 2839
277 Ga0307416_100128699 3300032002 Bacteria 2274
278 Ga0307416_100345088 3300032002 Unclassified 1504
279 Ga0307416_100782170 3300032002 Bacteria 1049
280 Ga0307414_10011527 3300032004 Bacteria 5189
281 Ga0307414_10526182 3300032004 Unclassified 1050
282 Ga0307411_10027666 3300032005 Bacteria 3435
283 Ga0307411_10178796 3300032005 Unclassified 1608
284 Ga0307415_100159312 3300032126 Bacteria 1747
285 Ga0373931_0100871 3300035691 Unclassified 1623
286 Ga0373935_0374802 3300035692 Bacteria 1018
287 Ga0373933_0193437 3300035724 Bacteria 1300
288 Ga0373937_0017654 3300036401 Bacteria 6365
289 Ga0373925_0162971 3300037068 Bacteria 1757
290 Ga0451577_0686927 3300042876 Bacteria 927
291 Ga0451576_0016982 3300045051 Bacteria 8015
292 Ga0451576_0058359 3300045051 Bacteria 4033
293 Ga0451576_0507811 3300045051 Bacteria 1266
294 Ga0451576_0763433 3300045051 Unclassified 1016
295 Ga0495582_0071545 3300046473 Bacteria 1919
296 Ga0495594_0017419 3300046499 Bacteria 3797
297 Ga0495643_0003779 3300046522 Bacteria 10947
298 Ga0495642_0074102 3300046528 Bacteria 1427
299 Ga0495586_0355449 3300046535 Unclassified 842
300 Ga0495598_0061963 3300046537 Bacteria 1156
301 Ga0495609_0158428 3300046538 Bacteria 961
302 Ga0495621_0001238 3300046539 Bacteria 6584
303 Ga0495621_0042537 3300046539 Bacteria 1600
304 Ga0495635_0807717 3300046663 Unclassified 604
305 Ga0495659_0032201 3300046664 Bacteria 1834
306 Ga0495659_0046057 3300046664 Bacteria 1574
307 Ga0495659_0140244 3300046664 Unclassified 964
308 Ga0495659_0160421 3300046664 Bacteria 907
309 Ga0495588_0111883 3300046674 Bacteria 1438
310 Ga0495669_0002447 3300046684 Bacteria 7582
311 Ga0495670_0065545 3300046691 Unclassified 1831
312 Ga0495636_0029697 3300047318 Bacteria 2233
313 Ga0495636_0163235 3300047318 Bacteria 1004
314 Ga0495676_0466113 3300047321 Unclassified 832
315 Ga0495677_0227665 3300047445 Bacteria 727
316 Ga0495685_053036 3300047447 Bacteria 1373
317 Ga0496101_0260267 3300048904 Unclassified 1353
318 Ga0496107_0554658 3300048910 Bacteria 851
319 nmdc:mga05p37_102878_c1 3300050507 Bacteria 3517
320 nmdc:mga05p37_1253_c1 3300050507 Bacteria 29454
321 nmdc:mga05p37_235086_c1 3300050507 Unclassified 2206
322 nmdc:mga05p37_316119_c1 3300050507 Bacteria 1850
323 nmdc:mga05p37_39988_c1 3300050507 Bacteria 5758
324 nmdc:mga05p37_59589_c1 3300050507 Unclassified 4701
325 nmdc:mga09592_556010_c1 3300050508 Bacteria 985
326 nmdc:mga09592_61655_c1 3300050508 Bacteria 3172
327 nmdc:mga0qj67_774228_c1 3300050509 Unclassified 760
328 nmdc:mga06r32_260989_c1 3300050510 Unclassified 1720
329 nmdc:mga08y16_11257_c1 3300050511 Bacteria 9396
330 nmdc:mga08y16_69821_c1 3300050511 Bacteria 3662
331 nmdc:mga08y16_9605_c1 3300050511 Bacteria 10158
332 nmdc:mga0n895_117348_c1 3300050512 Bacteria 2681
333 nmdc:mga0n895_25330_c1 3300050512 Bacteria 5604
334 nmdc:mga0n895_542013_c1 3300050512 Bacteria 1170
335 nmdc:mga0n895_5729_c1 3300050512 Bacteria 10427
336 nmdc:mga0n895_856074_c1 3300050512 Bacteria 897
337 nmdc:mga0rr50_17777_c1 3300050513 Bacteria 4758
338 nmdc:mga0rr50_258929_c1 3300050513 Bacteria 1447
339 nmdc:mga0rr50_6784_c1 3300050513 Bacteria 7014
340 nmdc:mga08x19_714819_c1 3300050514 Bacteria 711
341 nmdc:mga0a205_117183_c1 3300050515 Bacteria 2562
342 nmdc:mga0a205_197690_c1 3300050515 Bacteria 1902
343 nmdc:mga0a205_225305_c1 3300050515 Bacteria 1759
344 nmdc:mga0a205_227298_c1 3300050515 Unclassified 1189
345 nmdc:mga0a205_780896_c1 3300050515 Unclassified 803
346 Ga0501084_0842820 3300054114 Bacteria 772
347 Ga0590071_000029 3300059421 Bacteria 37476
348 Ga0590074_000376 3300059423 Bacteria 6339
349 Ga0590075_000491 3300059424 Bacteria 10689
350 Ga0590077_001285 3300059426 Bacteria 5986
351 Ga0590077_014418 3300059426 Bacteria 1647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100058443 Ga0068859_1000584433 167
2 3300005841 Ga0068863_100307485 Ga0068863_1003074852 167
3 3300006931 Ga0097620_100058443 Ga0097620_1000584433 167
4 3300005456 Ga0070678_100039671 Ga0070678_1000396712 174
5 3300005577 Ga0068857_100752272 Ga0068857_1007522721 174
6 3300025903 Ga0207680_10076705 Ga0207680_100767054 174
7 3300025923 Ga0207681_10121466 Ga0207681_101214662 174
8 3300025937 Ga0207669_10078784 Ga0207669_100787842 174
9 3300025938 Ga0207704_10161748 Ga0207704_101617482 174
10 3300005290 Ga0065712_10017283 Ga0065712_100172832 176
11 3300005331 Ga0070670_100163695 Ga0070670_1001636952 176
12 3300005365 Ga0070688_100011773 Ga0070688_1000117732 176
13 3300005440 Ga0070705_100055532 Ga0070705_1000555322 176
14 3300005543 Ga0070672_100240080 Ga0070672_1002400802 176
15 3300005577 Ga0068857_100176326 Ga0068857_1001763262 176
16 3300005617 Ga0068859_100332535 Ga0068859_1003325352 176
17 3300005618 Ga0068864_100033709 Ga0068864_1000337092 176
18 3300005719 Ga0068861_100042705 Ga0068861_1000427054 176
19 3300005841 Ga0068863_100455997 Ga0068863_1004559972 176
20 3300006881 Ga0068865_100049060 Ga0068865_1000490603 176
21 3300006931 Ga0097620_100332552 Ga0097620_1003325522 176
22 3300014325 Ga0163163_10087568 Ga0163163_100875682 176
23 3300025925 Ga0207650_10002872 Ga0207650_100028726 176
24 3300025936 Ga0207670_10025667 Ga0207670_100256672 176
25 3300026035 Ga0207703_10173426 Ga0207703_101734262 176
26 3300026095 Ga0207676_10134316 Ga0207676_101343162 176
27 3300026116 Ga0207674_10174926 Ga0207674_101749262 176
28 3300028379 Ga0268266_11139009 Ga0268266_111390092 176
29 3300046663 Ga0495635_0807717 Ga0495635_0807717_49_579 176
30 3300050512 nmdc:mga0n895_856074_c1 nmdc:mga0n895_856074_c1_345_875 176
31 3300005445 Ga0070708_101265709 Ga0070708_1012657091 181
32 3300005548 Ga0070665_100221619 Ga0070665_1002216194 182
33 3300009177 Ga0105248_10393679 Ga0105248_103936793 182
34 3300010375 Ga0105239_11262864 Ga0105239_112628642 182
35 3300025941 Ga0207711_10359401 Ga0207711_103594012 182
36 3300025944 Ga0207661_10640456 Ga0207661_106404562 182
37 3300005354 Ga0070675_100011482 Ga0070675_1000114823 183
38 3300005564 Ga0070664_100963783 Ga0070664_1009637831 184
39 3300005618 Ga0068864_100497029 Ga0068864_1004970292 184
40 3300006237 Ga0097621_100728417 Ga0097621_1007284172 184
41 3300026095 Ga0207676_10447938 Ga0207676_104479382 184
42 3300031911 Ga0307412_10934645 Ga0307412_109346452 184
43 3300054114 Ga0501084_0842820 Ga0501084_0842820_202_756 184
44 3300006880 Ga0075429_100266322 Ga0075429_1002663222 185
45 3300005344 Ga0070661_100583663 Ga0070661_1005836632 188
46 3300005457 Ga0070662_100472225 Ga0070662_1004722252 188
47 3300005564 Ga0070664_100056776 Ga0070664_1000567762 188
48 3300025920 Ga0207649_10500367 Ga0207649_105003672 188
49 3300025933 Ga0207706_10483755 Ga0207706_104837552 188
50 3300025945 Ga0207679_10106491 Ga0207679_101064912 188
51 3300026088 Ga0207641_11103606 Ga0207641_111036062 188
52 3300050509 nmdc:mga0qj67_774228_c1 nmdc:mga0qj67_774228_c1_109_690 189
53 3300031548 Ga0307408_100284258 Ga0307408_1002842582 192
54 3300031731 Ga0307405_10245103 Ga0307405_102451032 192
55 3300031824 Ga0307413_10364613 Ga0307413_103646132 192
56 3300032002 Ga0307416_100128699 Ga0307416_1001286992 192
57 3300005471 Ga0070698_100022417 Ga0070698_1000224174 193
58 3300005354 Ga0070675_100022974 Ga0070675_1000229743 194
59 3300005356 Ga0070674_100656683 Ga0070674_1006566831 194
60 3300005543 Ga0070672_100110079 Ga0070672_1001100794 194
61 3300025925 Ga0207650_10821337 Ga0207650_108213371 194
62 3300025926 Ga0207659_10013559 Ga0207659_100135593 194
63 3300025938 Ga0207704_10883869 Ga0207704_108838691 194
64 3300009147 Ga0114129_10038920 Ga0114129_100389207 195
65 3300046537 Ga0495598_0061963 Ga0495598_0061963_28_636 195
66 3300050507 nmdc:mga05p37_39988_c1 nmdc:mga05p37_39988_c1_1910_2542 195
67 3300050515 nmdc:mga0a205_780896_c1 nmdc:mga0a205_780896_c1_52_684 195
68 3300005293 Ga0065715_10527640 Ga0065715_105276401 196
69 3300005564 Ga0070664_100126123 Ga0070664_1001261233 196
70 3300031824 Ga0307413_10567902 Ga0307413_105679022 196
71 3300031903 Ga0307407_10107927 Ga0307407_101079272 196
72 3300032002 Ga0307416_100345088 Ga0307416_1003450882 196
73 3300032005 Ga0307411_10027666 Ga0307411_100276663 196
74 3300026118 Ga0207675_100530897 Ga0207675_1005308972 197
75 3300013296 Ga0157374_10049242 Ga0157374_100492422 198
76 3300027907 Ga0207428_10029180 Ga0207428_100291804 198
77 3300048904 Ga0496101_0260267 Ga0496101_0260267_470_1147 198
78 3300050511 nmdc:mga08y16_9605_c1 nmdc:mga08y16_9605_c1_5605_6201 198
79 3300005293 Ga0065715_10009651 Ga0065715_100096512 199
80 3300005295 Ga0065707_10096855 Ga0065707_100968552 199
81 3300005330 Ga0070690_100013057 Ga0070690_1000130575 199
82 3300005347 Ga0070668_100151415 Ga0070668_1001514152 199
83 3300005353 Ga0070669_100004079 Ga0070669_1000040793 199
84 3300005406 Ga0070703_10119342 Ga0070703_101193422 199
85 3300005438 Ga0070701_10000218 Ga0070701_100002187 199
86 3300005459 Ga0068867_100004574 Ga0068867_1000045744 199
87 3300005466 Ga0070685_10126891 Ga0070685_101268912 199
88 3300005471 Ga0070698_100147065 Ga0070698_1001470652 199
89 3300005518 Ga0070699_100032389 Ga0070699_1000323893 199
90 3300005535 Ga0070684_100763969 Ga0070684_1007639692 199
91 3300005545 Ga0070695_100443891 Ga0070695_1004438911 199
92 3300005549 Ga0070704_100016810 Ga0070704_1000168102 199
93 3300005577 Ga0068857_100086515 Ga0068857_1000865153 199
94 3300005578 Ga0068854_100441820 Ga0068854_1004418202 199
95 3300005617 Ga0068859_100003581 Ga0068859_1000035816 199
96 3300005840 Ga0068870_10001418 Ga0068870_100014184 199
97 3300005844 Ga0068862_100026618 Ga0068862_1000266184 199
98 3300006931 Ga0097620_100003581 Ga0097620_1000035816 199
99 3300009094 Ga0111539_10007690 Ga0111539_100076904 199
100 3300009148 Ga0105243_10599404 Ga0105243_105994041 199
101 3300013308 Ga0157375_10012786 Ga0157375_100127863 199
102 3300014326 Ga0157380_10101356 Ga0157380_101013562 199
103 3300014745 Ga0157377_10378602 Ga0157377_103786021 199
104 3300025885 Ga0207653_10019906 Ga0207653_100199062 199
105 3300025907 Ga0207645_10141421 Ga0207645_101414212 199
106 3300025908 Ga0207643_10001690 Ga0207643_1000169010 199
107 3300025919 Ga0207657_10263634 Ga0207657_102636341 199
108 3300025923 Ga0207681_10014900 Ga0207681_100149005 199
109 3300025926 Ga0207659_10016622 Ga0207659_100166222 199
110 3300025936 Ga0207670_10003906 Ga0207670_100039062 199
111 3300025942 Ga0207689_10028682 Ga0207689_100286823 199
112 3300025961 Ga0207712_10050855 Ga0207712_100508551 199
113 3300026023 Ga0207677_10123415 Ga0207677_101234152 199
114 3300026075 Ga0207708_10011735 Ga0207708_100117352 199
115 3300026089 Ga0207648_10005597 Ga0207648_100055973 199
116 3300026116 Ga0207674_10080635 Ga0207674_100806354 199
117 3300026118 Ga0207675_100004581 Ga0207675_1000045814 199
118 3300027907 Ga0207428_10003996 Ga0207428_100039963 199
119 3300028380 Ga0268265_10002628 Ga0268265_100026288 199
120 3300028381 Ga0268264_10169950 Ga0268264_101699501 199
121 3300050511 nmdc:mga08y16_11257_c1 nmdc:mga08y16_11257_c1_7163_7762 199
122 3300009147 Ga0114129_10138077 Ga0114129_101380774 200
123 3300031548 Ga0307408_100286107 Ga0307408_1002861071 200
124 3300032002 Ga0307416_100782170 Ga0307416_1007821702 200
125 3300046522 Ga0495643_0003779 Ga0495643_0003779_2980_3582 200
126 3300046684 Ga0495669_0002447 Ga0495669_0002447_5463_6065 200
127 3300046691 Ga0495670_0065545 Ga0495670_0065545_1094_1696 200
128 3300050507 nmdc:mga05p37_59589_c1 nmdc:mga05p37_59589_c1_1376_2011 200
129 3300005331 Ga0070670_100016121 Ga0070670_1000161214 201
130 3300005337 Ga0070682_100597411 Ga0070682_1005974112 201
131 3300005340 Ga0070689_100012827 Ga0070689_1000128277 201
132 3300005340 Ga0070689_100046390 Ga0070689_1000463902 201
133 3300005343 Ga0070687_100030225 Ga0070687_1000302253 201
134 3300005345 Ga0070692_10034644 Ga0070692_100346442 201
135 3300005354 Ga0070675_100000288 Ga0070675_1000002889 201
136 3300005364 Ga0070673_100231236 Ga0070673_1002312361 201
137 3300005365 Ga0070688_100004179 Ga0070688_1000041796 201
138 3300005438 Ga0070701_10268713 Ga0070701_102687131 201
139 3300005441 Ga0070700_100085898 Ga0070700_1000858982 201
140 3300005471 Ga0070698_100000065 Ga0070698_10000006555 201
141 3300005518 Ga0070699_100001259 Ga0070699_10000125913 201
142 3300005544 Ga0070686_100089170 Ga0070686_1000891702 201
143 3300005545 Ga0070695_100464664 Ga0070695_1004646642 201
144 3300005546 Ga0070696_100006031 Ga0070696_1000060314 201
145 3300005549 Ga0070704_100034176 Ga0070704_1000341763 201
146 3300005564 Ga0070664_100004597 Ga0070664_1000045973 201
147 3300005564 Ga0070664_100317155 Ga0070664_1003171551 201
148 3300005615 Ga0070702_100414312 Ga0070702_1004143122 201
149 3300005618 Ga0068864_100068397 Ga0068864_1000683973 201
150 3300005719 Ga0068861_100853048 Ga0068861_1008530482 201
151 3300005842 Ga0068858_100026364 Ga0068858_1000263643 201
152 3300005843 Ga0068860_100001111 Ga0068860_10000111120 201
153 3300006237 Ga0097621_100522559 Ga0097621_1005225592 201
154 3300006844 Ga0075428_100000677 Ga0075428_10000067720 201
155 3300006844 Ga0075428_100417958 Ga0075428_1004179582 201
156 3300006880 Ga0075429_100055872 Ga0075429_1000558723 201
157 3300006880 Ga0075429_100342372 Ga0075429_1003423722 201
158 3300007076 Ga0075435_100105425 Ga0075435_1001054251 201
159 3300009094 Ga0111539_10572996 Ga0111539_105729962 201
160 3300009147 Ga0114129_10003565 Ga0114129_1000356512 201
161 3300009147 Ga0114129_10059815 Ga0114129_100598154 201
162 3300009177 Ga0105248_10155278 Ga0105248_101552782 201
163 3300009553 Ga0105249_10084132 Ga0105249_100841321 201
164 3300011119 Ga0105246_11248772 Ga0105246_112487721 201
165 3300013296 Ga0157374_10292638 Ga0157374_102926382 201
166 3300013297 Ga0157378_10071699 Ga0157378_100716993 201
167 3300014326 Ga0157380_10621967 Ga0157380_106219671 201
168 3300014326 Ga0157380_11021309 Ga0157380_110213092 201
169 3300014745 Ga0157377_10024689 Ga0157377_100246892 201
170 3300014968 Ga0157379_10114996 Ga0157379_101149962 201
171 3300014969 Ga0157376_10193802 Ga0157376_101938022 201
172 3300014969 Ga0157376_11176053 Ga0157376_111760531 201
173 3300025893 Ga0207682_10200599 Ga0207682_102005992 201
174 3300025908 Ga0207643_10033283 Ga0207643_100332832 201
175 3300025918 Ga0207662_10220934 Ga0207662_102209342 201
176 3300025925 Ga0207650_10004466 Ga0207650_100044666 201
177 3300025926 Ga0207659_10000069 Ga0207659_1000006931 201
178 3300025936 Ga0207670_10033926 Ga0207670_100339262 201
179 3300025938 Ga0207704_10164481 Ga0207704_101644811 201
180 3300025945 Ga0207679_10850225 Ga0207679_108502252 201
181 3300026035 Ga0207703_10032013 Ga0207703_100320133 201
182 3300026089 Ga0207648_10546633 Ga0207648_105466332 201
183 3300026116 Ga0207674_10135128 Ga0207674_101351282 201
184 3300026118 Ga0207675_100128772 Ga0207675_1001287721 201
185 3300027907 Ga0207428_10275230 Ga0207428_102752302 201
186 3300028381 Ga0268264_10008424 Ga0268264_100084241 201
187 3300035691 Ga0373931_0100871 Ga0373931_0100871_947_1552 201
188 3300035692 Ga0373935_0374802 Ga0373935_0374802_107_712 201
189 3300035724 Ga0373933_0193437 Ga0373933_0193437_32_637 201
190 3300036401 Ga0373937_0017654 Ga0373937_0017654_4301_4906 201
191 3300037068 Ga0373925_0162971 Ga0373925_0162971_896_1501 201
192 3300045051 Ga0451576_0507811 Ga0451576_0507811_332_937 201
193 3300046535 Ga0495586_0355449 Ga0495586_0355449_61_666 201
194 3300046664 Ga0495659_0046057 Ga0495659_0046057_720_1325 201
195 3300048910 Ga0496107_0554658 Ga0496107_0554658_178_783 201
196 3300050507 nmdc:mga05p37_1253_c1 nmdc:mga05p37_1253_c1_17291_17896 201
197 3300050507 nmdc:mga05p37_316119_c1 nmdc:mga05p37_316119_c1_1021_1626 201
198 3300050508 nmdc:mga09592_556010_c1 nmdc:mga09592_556010_c1_360_965 201
199 3300050508 nmdc:mga09592_61655_c1 nmdc:mga09592_61655_c1_918_1523 201
200 3300050512 nmdc:mga0n895_25330_c1 nmdc:mga0n895_25330_c1_14_619 201
201 3300050512 nmdc:mga0n895_5729_c1 nmdc:mga0n895_5729_c1_5133_5738 201
202 3300050513 nmdc:mga0rr50_17777_c1 nmdc:mga0rr50_17777_c1_1499_2104 201
203 3300050515 nmdc:mga0a205_227298_c1 nmdc:mga0a205_227298_c1_46_651 201
204 2162886007 SwRhRL2b_contig_2041146 SwRhRL2b_0973.00001120 202
205 3300005289 Ga0065704_10077645 Ga0065704_100776454 202
206 3300005290 Ga0065712_10083897 Ga0065712_100838972 202
207 3300005293 Ga0065715_10326034 Ga0065715_103260341 202
208 3300005295 Ga0065707_10091754 Ga0065707_100917542 202
209 3300005327 Ga0070658_10263130 Ga0070658_102631302 202
210 3300005331 Ga0070670_100299681 Ga0070670_1002996811 202
211 3300005331 Ga0070670_100595929 Ga0070670_1005959292 202
212 3300005331 Ga0070670_100878344 Ga0070670_1008783441 202
213 3300005333 Ga0070677_10331208 Ga0070677_103312081 202
214 3300005338 Ga0068868_100630399 Ga0068868_1006303991 202
215 3300005338 Ga0068868_100723899 Ga0068868_1007238992 202
216 3300005340 Ga0070689_100297918 Ga0070689_1002979182 202
217 3300005341 Ga0070691_10030183 Ga0070691_100301832 202
218 3300005344 Ga0070661_100444371 Ga0070661_1004443712 202
219 3300005345 Ga0070692_10040332 Ga0070692_100403322 202
220 3300005354 Ga0070675_100601624 Ga0070675_1006016242 202
221 3300005355 Ga0070671_100001767 Ga0070671_1000017679 202
222 3300005356 Ga0070674_100213789 Ga0070674_1002137892 202
223 3300005356 Ga0070674_100675088 Ga0070674_1006750882 202
224 3300005438 Ga0070701_10004211 Ga0070701_100042112 202
225 3300005440 Ga0070705_100002674 Ga0070705_1000026749 202
226 3300005444 Ga0070694_100002846 Ga0070694_1000028464 202
227 3300005444 Ga0070694_100114637 Ga0070694_1001146372 202
228 3300005444 Ga0070694_100232308 Ga0070694_1002323082 202
229 3300005445 Ga0070708_100148739 Ga0070708_1001487392 202
230 3300005445 Ga0070708_101377253 Ga0070708_1013772531 202
231 3300005467 Ga0070706_100177188 Ga0070706_1001771882 202
232 3300005467 Ga0070706_100334131 Ga0070706_1003341312 202
233 3300005467 Ga0070706_100357751 Ga0070706_1003577512 202
234 3300005468 Ga0070707_100029254 Ga0070707_1000292543 202
235 3300005468 Ga0070707_100534628 Ga0070707_1005346281 202
236 3300005471 Ga0070698_100000742 Ga0070698_10000074213 202
237 3300005471 Ga0070698_100528053 Ga0070698_1005280532 202
238 3300005518 Ga0070699_100003772 Ga0070699_1000037723 202
239 3300005518 Ga0070699_100004083 Ga0070699_1000040833 202
240 3300005535 Ga0070684_100340086 Ga0070684_1003400862 202
241 3300005536 Ga0070697_100064731 Ga0070697_1000647313 202
242 3300005543 Ga0070672_100407733 Ga0070672_1004077331 202
243 3300005545 Ga0070695_100000291 Ga0070695_1000002917 202
244 3300005545 Ga0070695_100207417 Ga0070695_1002074171 202
245 3300005546 Ga0070696_100002518 Ga0070696_1000025188 202
246 3300005549 Ga0070704_100000822 Ga0070704_10000082211 202
247 3300005549 Ga0070704_100070048 Ga0070704_1000700482 202
248 3300005549 Ga0070704_100405839 Ga0070704_1004058392 202
249 3300005549 Ga0070704_101329459 Ga0070704_1013294591 202
250 3300005564 Ga0070664_100145670 Ga0070664_1001456702 202
251 3300005615 Ga0070702_100270310 Ga0070702_1002703102 202
252 3300005616 Ga0068852_100522623 Ga0068852_1005226232 202
253 3300005617 Ga0068859_100277102 Ga0068859_1002771022 202
254 3300005841 Ga0068863_100552807 Ga0068863_1005528072 202
255 3300005843 Ga0068860_100520187 Ga0068860_1005201872 202
256 3300005985 Ga0081539_10000112 Ga0081539_1000011216 202
257 3300006058 Ga0075432_10030870 Ga0075432_100308702 202
258 3300006237 Ga0097621_100084511 Ga0097621_1000845111 202
259 3300006844 Ga0075428_100212081 Ga0075428_1002120812 202
260 3300006846 Ga0075430_100172215 Ga0075430_1001722152 202
261 3300006847 Ga0075431_100139429 Ga0075431_1001394292 202
262 3300006852 Ga0075433_10183938 Ga0075433_101839382 202
263 3300006852 Ga0075433_11203412 Ga0075433_112034121 202
264 3300006871 Ga0075434_100022987 Ga0075434_1000229872 202
265 3300006871 Ga0075434_100035978 Ga0075434_1000359782 202
266 3300006871 Ga0075434_100187650 Ga0075434_1001876502 202
267 3300006881 Ga0068865_100347771 Ga0068865_1003477711 202
268 3300006914 Ga0075436_100288145 Ga0075436_1002881452 202
269 3300006931 Ga0097620_100277108 Ga0097620_1002771082 202
270 3300007076 Ga0075435_100032272 Ga0075435_1000322722 202
271 3300007076 Ga0075435_100037142 Ga0075435_1000371425 202
272 3300007076 Ga0075435_100286414 Ga0075435_1002864142 202
273 3300009094 Ga0111539_10015225 Ga0111539_100152253 202
274 3300009147 Ga0114129_10031356 Ga0114129_100313562 202
275 3300009147 Ga0114129_10091610 Ga0114129_100916103 202
276 3300009148 Ga0105243_10027166 Ga0105243_100271665 202
277 3300009177 Ga0105248_11309270 Ga0105248_113092702 202
278 3300009553 Ga0105249_10839802 Ga0105249_108398021 202
279 3300013297 Ga0157378_10204118 Ga0157378_102041182 202
280 3300014326 Ga0157380_10819026 Ga0157380_108190262 202
281 3300025909 Ga0207705_10188254 Ga0207705_101882541 202
282 3300025910 Ga0207684_10100982 Ga0207684_101009822 202
283 3300025920 Ga0207649_10375452 Ga0207649_103754522 202
284 3300025922 Ga0207646_10077472 Ga0207646_100774723 202
285 3300025925 Ga0207650_10380638 Ga0207650_103806381 202
286 3300025925 Ga0207650_10455058 Ga0207650_104550582 202
287 3300025925 Ga0207650_10832026 Ga0207650_108320262 202
288 3300025926 Ga0207659_10137087 Ga0207659_101370873 202
289 3300025931 Ga0207644_10029764 Ga0207644_100297643 202
290 3300025931 Ga0207644_11117890 Ga0207644_111178901 202
291 3300025935 Ga0207709_10014757 Ga0207709_100147575 202
292 3300025938 Ga0207704_10535711 Ga0207704_105357111 202
293 3300025945 Ga0207679_10061127 Ga0207679_100611272 202
294 3300026075 Ga0207708_10069522 Ga0207708_100695222 202
295 3300026088 Ga0207641_10848143 Ga0207641_108481432 202
296 3300026089 Ga0207648_10520127 Ga0207648_105201272 202
297 3300026121 Ga0207683_10514820 Ga0207683_105148202 202
298 3300027907 Ga0207428_10189808 Ga0207428_101898082 202
299 3300028381 Ga0268264_10775248 Ga0268264_107752481 202
300 3300031548 Ga0307408_100043261 Ga0307408_1000432613 202
301 3300031731 Ga0307405_10198384 Ga0307405_101983841 202
302 3300031824 Ga0307413_10142062 Ga0307413_101420622 202
303 3300031824 Ga0307413_10190170 Ga0307413_101901702 202
304 3300031852 Ga0307410_10014833 Ga0307410_100148335 202
305 3300031852 Ga0307410_10320870 Ga0307410_103208701 202
306 3300031852 Ga0307410_10578665 Ga0307410_105786652 202
307 3300031903 Ga0307407_10039215 Ga0307407_100392152 202
308 3300031911 Ga0307412_10027710 Ga0307412_100277103 202
309 3300031995 Ga0307409_100098762 Ga0307409_1000987622 202
310 3300031995 Ga0307409_100145222 Ga0307409_1001452222 202
311 3300032002 Ga0307416_100074276 Ga0307416_1000742763 202
312 3300032004 Ga0307414_10011527 Ga0307414_100115273 202
313 3300032004 Ga0307414_10526182 Ga0307414_105261822 202
314 3300032005 Ga0307411_10178796 Ga0307411_101787962 202
315 3300032126 Ga0307415_100159312 Ga0307415_1001593122 202
316 3300042876 Ga0451577_0686927 Ga0451577_0686927_247_855 202
317 3300045051 Ga0451576_0016982 Ga0451576_0016982_2123_2731 202
318 3300045051 Ga0451576_0058359 Ga0451576_0058359_2439_3047 202
319 3300045051 Ga0451576_0763433 Ga0451576_0763433_58_666 202
320 3300046473 Ga0495582_0071545 Ga0495582_0071545_918_1526 202
321 3300046499 Ga0495594_0017419 Ga0495594_0017419_1708_2316 202
322 3300046528 Ga0495642_0074102 Ga0495642_0074102_110_718 202
323 3300046538 Ga0495609_0158428 Ga0495609_0158428_314_922 202
324 3300046539 Ga0495621_0001238 Ga0495621_0001238_3694_4302 202
325 3300046539 Ga0495621_0042537 Ga0495621_0042537_608_1216 202
326 3300046664 Ga0495659_0032201 Ga0495659_0032201_626_1234 202
327 3300046664 Ga0495659_0140244 Ga0495659_0140244_20_628 202
328 3300046664 Ga0495659_0160421 Ga0495659_0160421_94_705 202
329 3300046674 Ga0495588_0111883 Ga0495588_0111883_748_1356 202
330 3300047318 Ga0495636_0029697 Ga0495636_0029697_175_783 202
331 3300047318 Ga0495636_0163235 Ga0495636_0163235_205_816 202
332 3300047321 Ga0495676_0466113 Ga0495676_0466113_136_744 202
333 3300047445 Ga0495677_0227665 Ga0495677_0227665_25_633 202
334 3300047447 Ga0495685_053036 Ga0495685_053036_605_1216 202
335 3300050507 nmdc:mga05p37_102878_c1 nmdc:mga05p37_102878_c1_2464_3072 202
336 3300050507 nmdc:mga05p37_235086_c1 nmdc:mga05p37_235086_c1_1239_1850 202
337 3300050510 nmdc:mga06r32_260989_c1 nmdc:mga06r32_260989_c1_219_866 202
338 3300050511 nmdc:mga08y16_69821_c1 nmdc:mga08y16_69821_c1_1492_2103 202
339 3300050512 nmdc:mga0n895_117348_c1 nmdc:mga0n895_117348_c1_1621_2232 202
340 3300050512 nmdc:mga0n895_542013_c1 nmdc:mga0n895_542013_c1_405_1058 202
341 3300050513 nmdc:mga0rr50_258929_c1 nmdc:mga0rr50_258929_c1_610_1218 202
342 3300050513 nmdc:mga0rr50_6784_c1 nmdc:mga0rr50_6784_c1_3334_3942 202
343 3300050514 nmdc:mga08x19_714819_c1 nmdc:mga08x19_714819_c1_59_667 202
344 3300050515 nmdc:mga0a205_117183_c1 nmdc:mga0a205_117183_c1_1630_2238 202
345 3300050515 nmdc:mga0a205_197690_c1 nmdc:mga0a205_197690_c1_1138_1749 202
346 3300050515 nmdc:mga0a205_225305_c1 nmdc:mga0a205_225305_c1_200_811 202
347 3300059421 Ga0590071_000029 Ga0590071_000029_32309_32920 202
348 3300059423 Ga0590074_000376 Ga0590074_000376_1768_2379 202
349 3300059424 Ga0590075_000491 Ga0590075_000491_6698_7309 202
350 3300059426 Ga0590077_001285 Ga0590077_001285_3273_3884 202
351 3300059426 Ga0590077_014418 Ga0590077_014418_897_1508 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

31

153

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2epn-assembly1.cif.gz_B n-acetyl-b-d-glucosaminidase (gcna) from streptococcus gordonii 0.3694 34 163
2epo-assembly1.cif.gz_A n-acetyl-b-d-glucosaminidase (gcna) from streptococcus gordonii 0.3347 34 163
2epo-assembly1.cif.gz_B n-acetyl-b-d-glucosaminidase (gcna) from streptococcus gordonii 0.3332 34 163
2epm-assembly1.cif.gz_X n-acetyl-b-d-glucoasminidase (gcna) from stretococcus gordonii 0.3092 19 163
3h2v-assembly2.cif.gz_B human raver1 rrm1 domain in complex with human vinculin tail domain vt 0.2966 11 159
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.584 36 151 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5601 36 151 1.10.1760.20
af_Q86VW0_463_605_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3325 42 162 1.20.58.60
af_P60778_197_387_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3166 13 164 1.20.1250.20
af_Q19199_1_192_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3164 14 160 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2W0BS23-F1-model_v4 TVP38/TMEM64 family protein 0.8733 5 151 GO:0005886
AF-A0A833A2U3-F1-model_v4 DedA family protein 0.8587 5 154 GO:0016020
AF-A0A7W1P960-F1-model_v4 VTT domain-containing protein 0.85 4 195 GO:0005886
AF-A0A832UHP4-F1-model_v4 deleted 0.8469 11 154
AF-A0A1F5YV32-F1-model_v4 VTT domain-containing protein 0.8462 5 156 GO:0005886

Feature Viewer

pLDDT pTM Quality
71.23 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map