F418481

General Info

Members Datasets Scaffolds Average Seq Length
351 206 346 139

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10079691|JGI25153J46596_100796912
Length 148
Sequence MRPGFGDAYMPTPSPEIQAFAAGFPVFLAHAGVTVVILFAAAALYVLLTPHKEITLIREGNTAAAVSLGGVLLGLAIPLSASLRASTNVIEIGLWGAVTVVVQLLVFRLVDMLLRGLPKRIQDGEVSAAALLVGAKIATALIIAAARS

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
178 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
190 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
197 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
200 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
201 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
202 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.95
Nodule 0
Rhizoplane 1.99
Rhizosphere 76.35
Stem 0
Stem Tuber 0
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10079691 3300003215 Bacteria 820
2 Ga0055530_10002430 3300003791 Bacteria 12047
3 Ga0055531_10001198 3300003794 Bacteria 19883
4 Ga0055531_10040547 3300003794 Bacteria 1363
5 Ga0055543_1014823 3300004625 Bacteria 1511
6 Ga0065165_1000856 3300005262 Bacteria 39851
7 Ga0070658_10705720 3300005327 Bacteria 876
8 Ga0070670_100054256 3300005331 Bacteria 3441
9 Ga0070670_100114061 3300005331 Bacteria 2330
10 Ga0068869_100099950 3300005334 Bacteria 2193
11 Ga0070666_10151264 3300005335 Bacteria 1619
12 Ga0070666_10372774 3300005335 Bacteria 1024
13 Ga0070682_100371226 3300005337 Bacteria 1073
14 Ga0070660_100039024 3300005339 Bacteria 3608
15 Ga0070660_100049247 3300005339 Bacteria 3239
16 Ga0070660_100159572 3300005339 Bacteria 1816
17 Ga0070668_100153024 3300005347 Bacteria 1867
18 Ga0070669_100022476 3300005353 Bacteria 4509
19 Ga0070671_100023099 3300005355 Bacteria 5084
20 Ga0070674_100974131 3300005356 Bacteria 743
21 Ga0070659_100000194 3300005366 Bacteria 46646
22 Ga0070659_100017125 3300005366 Bacteria 5448
23 Ga0070659_101104102 3300005366 Bacteria 699
24 Ga0070667_100018561 3300005367 Bacteria 5770
25 Ga0070667_101379085 3300005367 Unclassified 661
26 Ga0070663_100824401 3300005455 Bacteria 797
27 Ga0070681_10002130 3300005458 Bacteria 17987
28 Ga0070681_10400167 3300005458 Bacteria 1284
29 Ga0070681_10817948 3300005458 Bacteria 849
30 Ga0068867_100721223 3300005459 Bacteria 882
31 Ga0070679_100059780 3300005530 Bacteria 3798
32 Ga0070679_100101199 3300005530 Bacteria 2868
33 Ga0068853_100009968 3300005539 Bacteria 7672
34 Ga0068853_100084127 3300005539 Bacteria 2788
35 Ga0068853_100729110 3300005539 Bacteria 947
36 Ga0068853_101979119 3300005539 Bacteria 565
37 Ga0070686_100660561 3300005544 Bacteria 830
38 Ga0070693_100110262 3300005547 Bacteria 1692
39 Ga0070665_100000198 3300005548 Bacteria 105999
40 Ga0070665_100000945 3300005548 Bacteria 37054
41 Ga0070665_100085592 3300005548 Bacteria 3158
42 Ga0070665_100187871 3300005548 Bacteria 2067
43 Ga0068855_100024641 3300005563 Bacteria 7197
44 Ga0068855_100025093 3300005563 Bacteria 7136
45 Ga0068856_100901390 3300005614 Bacteria 903
46 Ga0068852_100179402 3300005616 Bacteria 1990
47 Ga0068852_100200230 3300005616 Bacteria 1890
48 Ga0068852_101658581 3300005616 Bacteria 662
49 Ga0068859_100200192 3300005617 Bacteria 2082
50 Ga0068864_100000106 3300005618 Bacteria 81202
51 Ga0068864_100186364 3300005618 Bacteria 1900
52 Ga0068864_100223392 3300005618 Bacteria 1738
53 Ga0068864_101401920 3300005618 Bacteria 700
54 Ga0068864_101782925 3300005618 Bacteria 621
55 Ga0068861_100111011 3300005719 Bacteria 2197
56 Ga0068863_100000175 3300005841 Bacteria 67772
57 Ga0068863_100109823 3300005841 Bacteria 2626
58 Ga0068863_100175295 3300005841 Bacteria 2058
59 Ga0068863_100222777 3300005841 Bacteria 1818
60 Ga0068858_100000006 3300005842 Bacteria 256011
61 Ga0068858_102117805 3300005842 Bacteria 556
62 Ga0068860_100000066 3300005843 Bacteria 182836
63 Ga0068860_100030995 3300005843 Bacteria 5141
64 Ga0068862_100001593 3300005844 Bacteria 20666
65 Ga0068862_100079772 3300005844 Bacteria 2838
66 Ga0068862_100523622 3300005844 Bacteria 1128
67 Ga0068862_100823344 3300005844 Bacteria 908
68 Ga0070717_10700803 3300006028 Bacteria 920
69 Ga0075363_100369578 3300006048 Bacteria 839
70 Ga0075362_10231285 3300006177 Bacteria 905
71 Ga0075369_10101879 3300006186 Bacteria 1289
72 Ga0075370_10110264 3300006353 Bacteria 1598
73 Ga0068865_100000753 3300006881 Bacteria 18176
74 Ga0068865_100438226 3300006881 Bacteria 1078
75 Ga0097620_100200184 3300006931 Bacteria 2082
76 Ga0105250_10323479 3300009092 Bacteria 671
77 Ga0105240_10000428 3300009093 Bacteria 77995
78 Ga0105240_10076028 3300009093 Bacteria 4141
79 Ga0105240_10098539 3300009093 Bacteria 3559
80 Ga0105240_10127389 3300009093 Bacteria 3057
81 Ga0105245_10625277 3300009098 Bacteria 1105
82 Ga0105242_10369369 3300009176 Bacteria 1330
83 Ga0105248_10000789 3300009177 Bacteria 35531
84 Ga0105248_10585487 3300009177 Bacteria 1259
85 Ga0105248_10599849 3300009177 Bacteria 1243
86 Ga0105237_10166826 3300009545 Bacteria 2201
87 Ga0105238_10042172 3300009551 Bacteria 4621
88 Ga0105238_10065063 3300009551 Bacteria 3647
89 Ga0105238_10101151 3300009551 Bacteria 2865
90 Ga0105238_11415964 3300009551 Bacteria 722
91 Ga0105249_10245795 3300009553 Bacteria 1771
92 Ga0105249_11320779 3300009553 Bacteria 793
93 Ga0105239_10568335 3300010375 Bacteria 1292
94 Ga0105239_11022415 3300010375 Bacteria 950
95 Ga0105239_11531277 3300010375 Bacteria 771
96 Ga0157370_10584427 3300013104 Bacteria 1023
97 Ga0157369_10668018 3300013105 Bacteria 1071
98 Ga0157369_10711195 3300013105 Bacteria 1034
99 Ga0157374_10614048 3300013296 Bacteria 1098
100 Ga0163162_11229873 3300013306 Bacteria 850
101 Ga0157372_11247865 3300013307 Bacteria 858
102 Ga0163163_10004944 3300014325 Bacteria 11468
103 Ga0163163_11476920 3300014325 Bacteria 741
104 Ga0163163_11607750 3300014325 Bacteria 711
105 Ga0157380_10909348 3300014326 Bacteria 907
106 Ga0157379_10066468 3300014968 Bacteria 3223
107 Ga0209026_1002163 3300025250 Bacteria 7650
108 Ga0209148_1026077 3300025254 Bacteria 910
109 Ga0209676_1004570 3300025292 Bacteria 7658
110 Ga0209758_1001260 3300025297 Bacteria 31379
111 Ga0209050_1000073 3300025298 Bacteria 292046
112 Ga0209257_1000099 3300025304 Bacteria 255304
113 Ga0209257_1002773 3300025304 Bacteria 16545
114 Ga0207680_10388785 3300025903 Bacteria 984
115 Ga0207705_10005135 3300025909 Bacteria 9815
116 Ga0207705_10157118 3300025909 Bacteria 1706
117 Ga0207707_10062816 3300025912 Bacteria 3232
118 Ga0207707_10115183 3300025912 Bacteria 2349
119 Ga0207695_10003931 3300025913 Bacteria 20558
120 Ga0207695_10008102 3300025913 Bacteria 13210
121 Ga0207695_10070931 3300025913 Bacteria 3559
122 Ga0207695_10072122 3300025913 Bacteria 3525
123 Ga0207695_10243926 3300025913 Bacteria 1697
124 Ga0207671_10099373 3300025914 Bacteria 2202
125 Ga0207660_10001963 3300025917 Bacteria 13715
126 Ga0207660_10100831 3300025917 Bacteria 2156
127 Ga0207660_11203629 3300025917 Bacteria 616
128 Ga0207662_10354896 3300025918 Bacteria 986
129 Ga0207657_10001390 3300025919 Bacteria 25814
130 Ga0207657_10018271 3300025919 Bacteria 6703
131 Ga0207657_10053064 3300025919 Bacteria 3514
132 Ga0207649_10490662 3300025920 Bacteria 933
133 Ga0207652_10001537 3300025921 Bacteria 20342
134 Ga0207652_10463143 3300025921 Bacteria 1142
135 Ga0207681_10116265 3300025923 Bacteria 1954
136 Ga0207694_10070682 3300025924 Bacteria 2727
137 Ga0207694_10095176 3300025924 Bacteria 2354
138 Ga0207694_10183552 3300025924 Bacteria 1697
139 Ga0207694_11010823 3300025924 Bacteria 704
140 Ga0207650_10041242 3300025925 Bacteria 3381
141 Ga0207650_10048914 3300025925 Bacteria 3120
142 Ga0207687_10130292 3300025927 Bacteria 1894
143 Ga0207644_10005489 3300025931 Bacteria 8258
144 Ga0207690_10000031 3300025932 Bacteria 154724
145 Ga0207690_10007448 3300025932 Bacteria 6495
146 Ga0207690_10794142 3300025932 Bacteria 782
147 Ga0207686_10295087 3300025934 Bacteria 1202
148 Ga0207704_10005105 3300025938 Bacteria 6043
149 Ga0207691_10335198 3300025940 Bacteria 1295
150 Ga0207711_10002318 3300025941 Bacteria 17056
151 Ga0207711_10007627 3300025941 Bacteria 9048
152 Ga0207711_10297220 3300025941 Bacteria 1489
153 Ga0207711_10733128 3300025941 Bacteria 921
154 Ga0207689_10035952 3300025942 Bacteria 4112
155 Ga0207679_10651526 3300025945 Bacteria 953
156 Ga0207667_10002879 3300025949 Bacteria 21366
157 Ga0207667_10478525 3300025949 Bacteria 1264
158 Ga0207712_10212907 3300025961 Bacteria 1540
159 Ga0207668_10000004 3300025972 Bacteria 201204
160 Ga0207668_10028039 3300025972 Bacteria 3676
161 Ga0207668_10040863 3300025972 Bacteria 3132
162 Ga0207668_10052956 3300025972 Bacteria 2810
163 Ga0207658_10002238 3300025986 Bacteria 14351
164 Ga0207658_10319945 3300025986 Bacteria 1342
165 Ga0207703_10000027 3300026035 Bacteria 209608
166 Ga0207703_12102155 3300026035 Bacteria 541
167 Ga0207639_10004762 3300026041 Bacteria 9143
168 Ga0207639_11133941 3300026041 Bacteria 734
169 Ga0207639_11981125 3300026041 Bacteria 543
170 Ga0207641_10000003 3300026088 Bacteria 496984
171 Ga0207641_10154777 3300026088 Bacteria 2079
172 Ga0207641_10295908 3300026088 Bacteria 1527
173 Ga0207641_11102399 3300026088 Bacteria 792
174 Ga0207641_11127079 3300026088 Bacteria 783
175 Ga0207648_10759696 3300026089 Bacteria 901
176 Ga0207676_10001496 3300026095 Bacteria 17256
177 Ga0207676_10107292 3300026095 Bacteria 2329
178 Ga0207676_10321022 3300026095 Bacteria 1422
179 Ga0207676_11136822 3300026095 Bacteria 773
180 Ga0207676_11488041 3300026095 Bacteria 674
181 Ga0207675_100252504 3300026118 Bacteria 1707
182 Ga0207675_100403649 3300026118 Bacteria 1347
183 Ga0207698_10269135 3300026142 Bacteria 1570
184 Ga0207698_10272184 3300026142 Bacteria 1562
185 Ga0207698_10485645 3300026142 Bacteria 1199
186 Ga0209981_1002113 3300027378 Bacteria 2529
187 Ga0210000_1057144 3300027462 Bacteria 630
188 Ga0209999_1009898 3300027543 Bacteria 1722
189 Ga0268266_10000003 3300028379 Bacteria 1701703
190 Ga0268266_10001373 3300028379 Bacteria 29333
191 Ga0268266_10074278 3300028379 Bacteria 2952
192 Ga0268265_10001213 3300028380 Bacteria 22410
193 Ga0268265_10001214 3300028380 Bacteria 22398
194 Ga0268265_10035560 3300028380 Bacteria 3641
195 Ga0268265_10766730 3300028380 Bacteria 937
196 Ga0268265_11197726 3300028380 Bacteria 757
197 Ga0268264_10000113 3300028381 Bacteria 203262
198 Ga0268264_10064625 3300028381 Bacteria 3080
199 Ga0307517_10040779 3300028786 Bacteria 5041
200 Ga0307517_10107922 3300028786 Bacteria 2141
201 Ga0307511_10035205 3300030521 Bacteria 4376
202 Ga0265327_10004912 3300031251 Bacteria 11536
203 Ga0307513_10004806 3300031456 Bacteria 17949
204 Ga0307513_10014423 3300031456 Bacteria 9643
205 Ga0307513_10313387 3300031456 Bacteria 1330
206 Ga0307513_10460814 3300031456 Bacteria 994
207 Ga0307408_100329175 3300031548 Bacteria 1289
208 Ga0307516_10000006 3300031730 Bacteria 298586
209 Ga0307413_10335588 3300031824 Bacteria 1160
210 Ga0307413_12149162 3300031824 Bacteria 505
211 Ga0307410_12005067 3300031852 Bacteria 516
212 Ga0307406_11168399 3300031901 Bacteria 667
213 Ga0307406_11375029 3300031901 Bacteria 618
214 Ga0307409_101239471 3300031995 Bacteria 770
215 Ga0307414_10031743 3300032004 Bacteria 3469
216 Ga0307414_10036326 3300032004 Bacteria 3288
217 Ga0307414_10080779 3300032004 Bacteria 2378
218 Ga0307414_10484481 3300032004 Bacteria 1091
219 Ga0307414_10535475 3300032004 Bacteria 1041
220 Ga0307414_10843662 3300032004 Bacteria 837
221 Ga0307414_11128782 3300032004 Bacteria 724
222 Ga0307414_11256091 3300032004 Bacteria 686
223 Ga0307415_101606337 3300032126 Bacteria 625
224 Ga0373944_0007745 3300035089 Bacteria 2885
225 Ga0373946_0172411 3300035171 Bacteria 1022
226 Ga0373931_0364710 3300035691 Bacteria 907
227 Ga0373925_0000199 3300037068 Bacteria 65400
228 Ga0373925_0095227 3300037068 Bacteria 2280
229 Ga0395899_0000991 3300037312 Bacteria 26130
230 Ga0395899_0129356 3300037312 Bacteria 1804
231 Ga0395899_0286824 3300037312 Bacteria 1118
232 Ga0395900_0000002 3300037418 Bacteria 671103
233 Ga0395900_0096205 3300037418 Bacteria 3042
234 Ga0395898_0006370 3300037466 Bacteria 12608
235 Ga0395898_0037641 3300037466 Bacteria 4798
236 Ga0395905_0009959 3300037471 Bacteria 9261
237 Ga0395905_0014734 3300037471 Bacteria 7455
238 Ga0395905_0073940 3300037471 Bacteria 3194
239 Ga0395905_0159260 3300037471 Bacteria 2122
240 Ga0395905_0282615 3300037471 Bacteria 1546
241 Ga0395905_0367249 3300037471 Bacteria 1332
242 Ga0395905_0396798 3300037471 Bacteria 1274
243 Ga0395905_1001133 3300037471 Bacteria 739
244 Ga0395905_1159542 3300037471 Bacteria 676
245 Ga0395901_0000021 3300038443 Bacteria 307734
246 Ga0395901_0053158 3300038443 Bacteria 4209
247 Ga0395901_0078804 3300038443 Bacteria 3440
248 Ga0436365_0984804 3300039437 Bacteria 7989
249 Ga0451802_0832561 3300041460 Bacteria 584
250 Ga0439462_0031431 3300042015 Bacteria 1406
251 Ga0450890_027934 3300042127 Bacteria 792
252 Ga0466965_0165520 3300044683 Bacteria 1161
253 Ga0466957_0791182 3300044842 Bacteria 673
254 Ga0495629_0003470 3300046459 Bacteria 11921
255 Ga0495650_0146799 3300046471 Bacteria 850
256 Ga0495585_0623210 3300046492 Bacteria 506
257 Ga0495583_0004258 3300046506 Bacteria 10376
258 Ga0495583_0194047 3300046506 Bacteria 827
259 Ga0495606_0076565 3300046507 Bacteria 2091
260 Ga0495606_0139987 3300046507 Bacteria 1430
261 Ga0495610_0100539 3300046512 Bacteria 1296
262 Ga0495620_0025766 3300046515 Bacteria 2777
263 Ga0495620_0346485 3300046515 Bacteria 563
264 Ga0495643_0010268 3300046522 Bacteria 5767
265 Ga0495643_0304009 3300046522 Bacteria 726
266 Ga0495642_0022236 3300046528 Bacteria 2498
267 Ga0495609_0047171 3300046538 Bacteria 1928
268 Ga0495645_0186314 3300046543 Bacteria 1418
269 Ga0495622_0003481 3300046557 Bacteria 7415
270 Ga0495668_0042004 3300046616 Bacteria 2546
271 Ga0495668_0095815 3300046616 Bacteria 1624
272 Ga0495611_0002863 3300046648 Bacteria 7700
273 Ga0495625_0027125 3300046660 Bacteria 4318
274 Ga0495625_0104913 3300046660 Bacteria 1937
275 Ga0495625_0133483 3300046660 Bacteria 1680
276 Ga0495625_0195158 3300046660 Bacteria 1339
277 Ga0495669_0000006 3300046684 Bacteria 190838
278 Ga0495669_0000222 3300046684 Bacteria 34149
279 Ga0495669_0334168 3300046684 Bacteria 732
280 Ga0495674_0802235 3300047319 Bacteria 732
281 Ga0495672_0215258 3300047320 Bacteria 952
282 Ga0495687_141708 3300047443 Bacteria 835
283 Ga0495677_0009881 3300047445 Bacteria 3514
284 Ga0495677_0320071 3300047445 Unclassified 611
285 Ga0495685_019778 3300047447 Bacteria 2314
286 Ga0495602_0699963 3300048088 Bacteria 688
287 Ga0495602_0748772 3300048088 Bacteria 659
288 Ga0496100_0735329 3300048903 Bacteria 771
289 Ga0496102_0204502 3300048905 Bacteria 1861
290 Ga0496112_0082983 3300048915 Bacteria 3169
291 Ga0496112_0354390 3300048915 Bacteria 1410
292 Ga0496115_0022476 3300048918 Bacteria 4887
293 Ga0496115_0070820 3300048918 Bacteria 2827
294 Ga0496117_0016777 3300048920 Bacteria 6155
295 Ga0496118_0008171 3300048921 Bacteria 10889
296 Ga0496121_0000042 3300048924 Bacteria 342304
297 Ga0496125_0144387 3300048928 Bacteria 1648
298 Ga0496126_0516276 3300048929 Bacteria 953
299 Ga0501032_0038976 3300049569 Bacteria 3234
300 Ga0501036_0736333 3300049572 Bacteria 814
301 Ga0501043_0132064 3300049579 Bacteria 1956
302 Ga0501047_0001866 3300049581 Bacteria 20290
303 Ga0501047_0043514 3300049581 Bacteria 4338
304 Ga0501047_0256513 3300049581 Bacteria 1597
305 Ga0501047_0821756 3300049581 Bacteria 744
306 Ga0501044_0876520 3300049823 Bacteria 773
307 nmdc:mga03683_179746_c1 3300050489 Bacteria 965
308 nmdc:mga03n38_447893_c1 3300050490 Bacteria 718
309 nmdc:mga0k408_443646_c1 3300050493 Bacteria 771
310 nmdc:mga0sz30_424206_c1 3300050516 Bacteria 596
311 Ga0500635_0000051 3300053080 Bacteria 76510
312 Ga0500578_0502246 3300053086 Bacteria 682
313 Ga0500643_014040 3300053087 Bacteria 2800
314 Ga0500643_111800 3300053087 Bacteria 737
315 Ga0500583_0196249 3300053092 Bacteria 1004
316 Ga0500651_0007877 3300053093 Bacteria 6233
317 Ga0500566_0066641 3300053094 Bacteria 2028
318 Ga0500641_0045693 3300053096 Bacteria 1784
319 Ga0500555_125795 3300053103 Bacteria 638
320 Ga0500556_0019477 3300053104 Bacteria 2157
321 Ga0500562_001541 3300053108 Bacteria 5705
322 Ga0500562_006934 3300053108 Bacteria 2859
323 Ga0500562_024747 3300053108 Bacteria 1569
324 Ga0500572_052896 3300053111 Bacteria 1215
325 Ga0500595_000938 3300053119 Bacteria 16518
326 Ga0500607_219707 3300053121 Bacteria 793
327 Ga0500608_009136 3300053122 Bacteria 4197
328 Ga0500614_007873 3300053123 Bacteria 2252
329 Ga0500658_0006734 3300053134 Bacteria 4252
330 Ga0500559_0129237 3300053136 Bacteria 1179
331 Ga0500564_192533 3300053138 Bacteria 843
332 Ga0500568_0233563 3300053139 Bacteria 671
333 Ga0500590_028436 3300053148 Bacteria 2900
334 Ga0500603_002296 3300053150 Bacteria 4203
335 Ga0500616_0037673 3300053153 Bacteria 2617
336 Ga0500619_019939 3300053154 Bacteria 1908
337 Ga0500620_155586 3300053155 Bacteria 795
338 Ga0500638_045103 3300053162 Bacteria 2139
339 Ga0500639_221843 3300053163 Bacteria 788
340 Ga0500636_0003210 3300053177 Bacteria 9158
341 Ga0500636_0086820 3300053177 Bacteria 1796
342 Ga0500637_0001261 3300053178 Bacteria 10594
343 Ga0500637_0005413 3300053178 Bacteria 6174
344 Ga0500645_001609 3300053730 Bacteria 11202
345 Ga0500645_006055 3300053730 Bacteria 4365
346 Ga0500596_002649 3300053735 Bacteria 3509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100200230 Ga0068852_1002002303 119
2 3300009551 Ga0105238_10101151 Ga0105238_101011512 119
3 3300010375 Ga0105239_11531277 Ga0105239_115312772 119
4 3300025924 Ga0207694_10095176 Ga0207694_100951762 119
5 3300026142 Ga0207698_10272184 Ga0207698_102721842 119
6 3300005337 Ga0070682_100371226 Ga0070682_1003712262 122
7 3300005547 Ga0070693_100110262 Ga0070693_1001102623 122
8 3300025292 Ga0209676_1004570 Ga0209676_10045701 122
9 3300025918 Ga0207662_10354896 Ga0207662_103548962 122
10 3300031995 Ga0307409_101239471 Ga0307409_1012394712 122
11 3300032004 Ga0307414_10031743 Ga0307414_100317433 122
12 3300032004 Ga0307414_10484481 Ga0307414_104844812 122
13 3300032004 Ga0307414_10535475 Ga0307414_105354751 122
14 3300032004 Ga0307414_10843662 Ga0307414_108436622 122
15 3300006028 Ga0070717_10700803 Ga0070717_107008032 123
16 3300037471 Ga0395905_1001133 Ga0395905_1001133_138_551 123
17 3300049569 Ga0501032_0038976 Ga0501032_0038976_1067_1495 123
18 3300053086 Ga0500578_0502246 Ga0500578_0502246_13_387 123
19 3300031824 Ga0307413_12149162 Ga0307413_121491621 124
20 3300031901 Ga0307406_11168399 Ga0307406_111683992 124
21 3300032004 Ga0307414_10036326 Ga0307414_100363262 124
22 3300049581 Ga0501047_0821756 Ga0501047_0821756_65_484 124
23 3300025941 Ga0207711_10007627 Ga0207711_100076271 125
24 3300031456 Ga0307513_10313387 Ga0307513_103133872 125
25 3300032004 Ga0307414_11256091 Ga0307414_112560912 125
26 3300046522 Ga0495643_0304009 Ga0495643_0304009_116_535 125
27 iso_pu_bacteria 2524023250 2524609835 125
28 3300005544 Ga0070686_100660561 Ga0070686_1006605612 126
29 3300025940 Ga0207691_10335198 Ga0207691_103351981 126
30 3300037471 Ga0395905_0282615 Ga0395905_0282615_821_1240 126
31 3300009093 Ga0105240_10000428 Ga0105240_1000042819 127
32 3300025913 Ga0207695_10003931 Ga0207695_100039314 127
33 3300048928 Ga0496125_0144387 Ga0496125_0144387_924_1349 127
34 3300048915 Ga0496112_0082983 Ga0496112_0082983_581_1015 128
35 3300031548 Ga0307408_100329175 Ga0307408_1003291752 131
36 3300031824 Ga0307413_10335588 Ga0307413_103355882 131
37 3300031852 Ga0307410_12005067 Ga0307410_120050671 131
38 3300032004 Ga0307414_10080779 Ga0307414_100807792 131
39 3300005356 Ga0070674_100974131 Ga0070674_1009741312 132
40 3300005459 Ga0068867_100721223 Ga0068867_1007212232 132
41 3300005618 Ga0068864_101401920 Ga0068864_1014019202 132
42 3300006881 Ga0068865_100438226 Ga0068865_1004382262 132
43 3300009176 Ga0105242_10369369 Ga0105242_103693692 132
44 3300013296 Ga0157374_10614048 Ga0157374_106140482 132
45 3300025934 Ga0207686_10295087 Ga0207686_102950872 132
46 3300026095 Ga0207676_11136822 Ga0207676_111368221 132
47 3300046492 Ga0495585_0623210 Ga0495585_0623210_24_425 132
48 3300005539 Ga0068853_101979119 Ga0068853_1019791191 133
49 3300009551 Ga0105238_11415964 Ga0105238_114159642 133
50 3300025924 Ga0207694_11010823 Ga0207694_110108232 133
51 3300026041 Ga0207639_11981125 Ga0207639_119811251 133
52 3300037312 Ga0395899_0286824 Ga0395899_0286824_598_1023 133
53 3300050493 nmdc:mga0k408_443646_c1 nmdc:mga0k408_443646_c1_12_440 133
54 3300026142 Ga0207698_10485645 Ga0207698_104856452 135
55 iso_pu_bacteria 2643221614 2644087529 136
56 iso_pu_bacteria 2643221661 2644344427 136
57 iso_pu_bacteria 2643221666 2644366889 136
58 3300039437 Ga0436365_0984804 Ga0436365_0984804_5072_5488 137
59 3300044842 Ga0466957_0791182 Ga0466957_0791182_103_519 137
60 iso_pu_bacteria 2643221598 2643999713 137
61 3300005548 Ga0070665_100000198 Ga0070665_10000019851 138
62 3300005618 Ga0068864_100000106 Ga0068864_10000010669 138
63 3300005841 Ga0068863_100000175 Ga0068863_10000017552 138
64 3300005842 Ga0068858_100000006 Ga0068858_100000006122 138
65 3300005844 Ga0068862_100079772 Ga0068862_1000797722 138
66 3300009092 Ga0105250_10323479 Ga0105250_103234792 138
67 3300009177 Ga0105248_10000789 Ga0105248_1000078930 138
68 3300009177 Ga0105248_10599849 Ga0105248_105998492 138
69 3300014325 Ga0163163_11476920 Ga0163163_114769202 138
70 3300014968 Ga0157379_10066468 Ga0157379_100664684 138
71 3300025925 Ga0207650_10041242 Ga0207650_100412422 138
72 3300025941 Ga0207711_10002318 Ga0207711_100023184 138
73 3300025941 Ga0207711_10733128 Ga0207711_107331282 138
74 3300025972 Ga0207668_10000004 Ga0207668_1000000474 138
75 3300025986 Ga0207658_10002238 Ga0207658_100022389 138
76 3300026035 Ga0207703_10000027 Ga0207703_1000002749 138
77 3300026088 Ga0207641_10000003 Ga0207641_10000003324 138
78 3300026088 Ga0207641_11102399 Ga0207641_111023992 138
79 3300026088 Ga0207641_11127079 Ga0207641_111270792 138
80 3300026095 Ga0207676_10001496 Ga0207676_1000149617 138
81 3300026118 Ga0207675_100403649 Ga0207675_1004036492 138
82 3300028379 Ga0268266_10001373 Ga0268266_1000137325 138
83 3300028380 Ga0268265_10035560 Ga0268265_100355604 138
84 3300028786 Ga0307517_10107922 Ga0307517_101079222 138
85 3300038443 Ga0395901_0053158 Ga0395901_0053158_2148_2567 138
86 3300046459 Ga0495629_0003470 Ga0495629_0003470_9194_9613 138
87 3300046506 Ga0495583_0194047 Ga0495583_0194047_352_771 138
88 3300046507 Ga0495606_0139987 Ga0495606_0139987_48_467 138
89 3300046512 Ga0495610_0100539 Ga0495610_0100539_674_1093 138
90 3300046515 Ga0495620_0025766 Ga0495620_0025766_1818_2237 138
91 3300046522 Ga0495643_0010268 Ga0495643_0010268_2730_3149 138
92 3300046538 Ga0495609_0047171 Ga0495609_0047171_372_791 138
93 3300046557 Ga0495622_0003481 Ga0495622_0003481_4265_4684 138
94 3300046616 Ga0495668_0042004 Ga0495668_0042004_126_545 138
95 3300047319 Ga0495674_0802235 Ga0495674_0802235_85_519 138
96 3300047445 Ga0495677_0320071 Ga0495677_0320071_33_452 138
97 3300048088 Ga0495602_0699963 Ga0495602_0699963_52_471 138
98 3300048088 Ga0495602_0748772 Ga0495602_0748772_127_546 138
99 3300048905 Ga0496102_0204502 Ga0496102_0204502_424_843 138
100 3300048920 Ga0496117_0016777 Ga0496117_0016777_2022_2441 138
101 3300048921 Ga0496118_0008171 Ga0496118_0008171_679_1098 138
102 3300048924 Ga0496121_0000042 Ga0496121_0000042_138475_138894 138
103 3300049581 Ga0501047_0256513 Ga0501047_0256513_202_621 138
104 3300053080 Ga0500635_0000051 Ga0500635_0000051_67933_68352 138
105 3300053087 Ga0500643_014040 Ga0500643_014040_731_1150 138
106 3300053092 Ga0500583_0196249 Ga0500583_0196249_324_743 138
107 3300053093 Ga0500651_0007877 Ga0500651_0007877_3425_3844 138
108 3300053094 Ga0500566_0066641 Ga0500566_0066641_458_877 138
109 3300053111 Ga0500572_052896 Ga0500572_052896_601_1020 138
110 3300053119 Ga0500595_000938 Ga0500595_000938_3044_3463 138
111 3300053121 Ga0500607_219707 Ga0500607_219707_213_632 138
112 3300053122 Ga0500608_009136 Ga0500608_009136_167_586 138
113 3300053123 Ga0500614_007873 Ga0500614_007873_1482_1901 138
114 3300053134 Ga0500658_0006734 Ga0500658_0006734_3488_3907 138
115 3300053136 Ga0500559_0129237 Ga0500559_0129237_736_1155 138
116 3300053138 Ga0500564_192533 Ga0500564_192533_245_664 138
117 3300053148 Ga0500590_028436 Ga0500590_028436_637_1056 138
118 3300053150 Ga0500603_002296 Ga0500603_002296_1173_1592 138
119 3300053154 Ga0500619_019939 Ga0500619_019939_742_1161 138
120 3300053155 Ga0500620_155586 Ga0500620_155586_66_485 138
121 3300053162 Ga0500638_045103 Ga0500638_045103_1131_1550 138
122 3300053163 Ga0500639_221843 Ga0500639_221843_70_489 138
123 3300053177 Ga0500636_0003210 Ga0500636_0003210_8184_8603 138
124 3300053177 Ga0500636_0086820 Ga0500636_0086820_642_1061 138
125 3300053178 Ga0500637_0001261 Ga0500637_0001261_450_869 138
126 3300053178 Ga0500637_0005413 Ga0500637_0005413_535_954 138
127 3300053735 Ga0500596_002649 Ga0500596_002649_740_1159 138
128 3300003794 Ga0055531_10040547 Ga0055531_100405472 139
129 3300005331 Ga0070670_100054256 Ga0070670_1000542562 139
130 3300005335 Ga0070666_10372774 Ga0070666_103727741 139
131 3300005347 Ga0070668_100153024 Ga0070668_1001530242 139
132 3300005353 Ga0070669_100022476 Ga0070669_1000224764 139
133 3300005367 Ga0070667_100018561 Ga0070667_1000185614 139
134 3300005458 Ga0070681_10817948 Ga0070681_108179481 139
135 3300005548 Ga0070665_100085592 Ga0070665_1000855922 139
136 3300005617 Ga0068859_100200192 Ga0068859_1002001922 139
137 3300005618 Ga0068864_101782925 Ga0068864_1017829252 139
138 3300005719 Ga0068861_100111011 Ga0068861_1001110112 139
139 3300005841 Ga0068863_100109823 Ga0068863_1001098233 139
140 3300005841 Ga0068863_100222777 Ga0068863_1002227772 139
141 3300005842 Ga0068858_102117805 Ga0068858_1021178051 139
142 3300005843 Ga0068860_100030995 Ga0068860_1000309954 139
143 3300005844 Ga0068862_100001593 Ga0068862_10000159310 139
144 3300006048 Ga0075363_100369578 Ga0075363_1003695781 139
145 3300006177 Ga0075362_10231285 Ga0075362_102312852 139
146 3300006186 Ga0075369_10101879 Ga0075369_101018792 139
147 3300006353 Ga0075370_10110264 Ga0075370_101102642 139
148 3300006931 Ga0097620_100200184 Ga0097620_1002001842 139
149 3300009093 Ga0105240_10076028 Ga0105240_100760282 139
150 3300009553 Ga0105249_10245795 Ga0105249_102457952 139
151 3300013105 Ga0157369_10668018 Ga0157369_106680182 139
152 3300014325 Ga0163163_11607750 Ga0163163_116077502 139
153 3300014326 Ga0157380_10909348 Ga0157380_109093482 139
154 3300025250 Ga0209026_1002163 Ga0209026_10021637 139
155 3300025254 Ga0209148_1026077 Ga0209148_10260772 139
156 3300025304 Ga0209257_1002773 Ga0209257_100277316 139
157 3300025903 Ga0207680_10388785 Ga0207680_103887852 139
158 3300025913 Ga0207695_10072122 Ga0207695_100721223 139
159 3300025923 Ga0207681_10116265 Ga0207681_101162652 139
160 3300025925 Ga0207650_10048914 Ga0207650_100489142 139
161 3300025961 Ga0207712_10212907 Ga0207712_102129072 139
162 3300025972 Ga0207668_10052956 Ga0207668_100529562 139
163 3300025986 Ga0207658_10319945 Ga0207658_103199452 139
164 3300026035 Ga0207703_12102155 Ga0207703_121021551 139
165 3300026088 Ga0207641_10154777 Ga0207641_101547773 139
166 3300026088 Ga0207641_10295908 Ga0207641_102959082 139
167 3300026089 Ga0207648_10759696 Ga0207648_107596962 139
168 3300026095 Ga0207676_10107292 Ga0207676_101072922 139
169 3300026095 Ga0207676_11488041 Ga0207676_114880412 139
170 3300026118 Ga0207675_100252504 Ga0207675_1002525042 139
171 3300028379 Ga0268266_10074278 Ga0268266_100742782 139
172 3300028380 Ga0268265_10001213 Ga0268265_1000121310 139
173 3300028381 Ga0268264_10064625 Ga0268264_100646252 139
174 3300030521 Ga0307511_10035205 Ga0307511_100352053 139
175 3300031456 Ga0307513_10460814 Ga0307513_104608141 139
176 3300031730 Ga0307516_10000006 Ga0307516_100000065 139
177 3300032004 Ga0307414_11128782 Ga0307414_111287822 139
178 3300032126 Ga0307415_101606337 Ga0307415_1016063372 139
179 3300035691 Ga0373931_0364710 Ga0373931_0364710_256_678 139
180 3300037068 Ga0373925_0095227 Ga0373925_0095227_1318_1740 139
181 3300037312 Ga0395899_0000991 Ga0395899_0000991_10725_11147 139
182 3300037312 Ga0395899_0129356 Ga0395899_0129356_65_487 139
183 3300037418 Ga0395900_0000002 Ga0395900_0000002_267979_268401 139
184 3300037418 Ga0395900_0096205 Ga0395900_0096205_1085_1507 139
185 3300037466 Ga0395898_0006370 Ga0395898_0006370_3799_4221 139
186 3300037466 Ga0395898_0037641 Ga0395898_0037641_3021_3443 139
187 3300037471 Ga0395905_0009959 Ga0395905_0009959_6269_6691 139
188 3300037471 Ga0395905_0014734 Ga0395905_0014734_6914_7336 139
189 3300037471 Ga0395905_0073940 Ga0395905_0073940_719_1141 139
190 3300037471 Ga0395905_0159260 Ga0395905_0159260_1603_2025 139
191 3300037471 Ga0395905_0367249 Ga0395905_0367249_717_1136 139
192 3300037471 Ga0395905_0396798 Ga0395905_0396798_571_990 139
193 3300037471 Ga0395905_1159542 Ga0395905_1159542_186_605 139
194 3300038443 Ga0395901_0000021 Ga0395901_0000021_26493_26915 139
195 3300038443 Ga0395901_0078804 Ga0395901_0078804_1343_1765 139
196 3300041460 Ga0451802_0832561 Ga0451802_0832561_80_499 139
197 3300042015 Ga0439462_0031431 Ga0439462_0031431_127_546 139
198 3300042127 Ga0450890_027934 Ga0450890_027934_132_551 139
199 3300044683 Ga0466965_0165520 Ga0466965_0165520_135_557 139
200 3300046616 Ga0495668_0095815 Ga0495668_0095815_464_883 139
201 3300046660 Ga0495625_0104913 Ga0495625_0104913_295_714 139
202 3300047320 Ga0495672_0215258 Ga0495672_0215258_482_901 139
203 3300048915 Ga0496112_0354390 Ga0496112_0354390_545_967 139
204 3300050489 nmdc:mga03683_179746_c1 nmdc:mga03683_179746_c1_328_747 139
205 3300050490 nmdc:mga03n38_447893_c1 nmdc:mga03n38_447893_c1_263_682 139
206 3300050516 nmdc:mga0sz30_424206_c1 nmdc:mga0sz30_424206_c1_37_456 139
207 3300053087 Ga0500643_111800 Ga0500643_111800_80_502 139
208 3300053104 Ga0500556_0019477 Ga0500556_0019477_145_567 139
209 3300053108 Ga0500562_001541 Ga0500562_001541_3927_4349 139
210 3300053108 Ga0500562_006934 Ga0500562_006934_2195_2617 139
211 3300053139 Ga0500568_0233563 Ga0500568_0233563_112_531 139
212 3300053153 Ga0500616_0037673 Ga0500616_0037673_605_1027 139
213 3300053730 Ga0500645_001609 Ga0500645_001609_6588_7007 139
214 3300053730 Ga0500645_006055 Ga0500645_006055_1212_1634 139
215 3300005367 Ga0070667_101379085 Ga0070667_1013790851 140
216 3300005843 Ga0068860_100000066 Ga0068860_10000006693 140
217 3300005844 Ga0068862_100523622 Ga0068862_1005236222 140
218 3300014325 Ga0163163_10004944 Ga0163163_100049442 140
219 3300025972 Ga0207668_10028039 Ga0207668_100280393 140
220 3300025972 Ga0207668_10040863 Ga0207668_100408633 140
221 3300028380 Ga0268265_10001214 Ga0268265_1000121419 140
222 3300028380 Ga0268265_10766730 Ga0268265_107667302 140
223 3300028381 Ga0268264_10000113 Ga0268264_10000113100 140
224 3300046471 Ga0495650_0146799 Ga0495650_0146799_341_766 140
225 3300046515 Ga0495620_0346485 Ga0495620_0346485_109_534 140
226 3300048929 Ga0496126_0516276 Ga0496126_0516276_259_684 140
227 3300049572 Ga0501036_0736333 Ga0501036_0736333_130_555 140
228 3300049579 Ga0501043_0132064 Ga0501043_0132064_439_864 140
229 3300049581 Ga0501047_0043514 Ga0501047_0043514_3153_3578 140
230 3300049823 Ga0501044_0876520 Ga0501044_0876520_253_678 140
231 3300005327 Ga0070658_10705720 Ga0070658_107057201 141
232 3300005331 Ga0070670_100114061 Ga0070670_1001140614 141
233 3300005334 Ga0068869_100099950 Ga0068869_1000999502 141
234 3300005335 Ga0070666_10151264 Ga0070666_101512642 141
235 3300005339 Ga0070660_100039024 Ga0070660_1000390242 141
236 3300005339 Ga0070660_100049247 Ga0070660_1000492472 141
237 3300005339 Ga0070660_100159572 Ga0070660_1001595722 141
238 3300005355 Ga0070671_100023099 Ga0070671_1000230991 141
239 3300005366 Ga0070659_100000194 Ga0070659_10000019426 141
240 3300005366 Ga0070659_100017125 Ga0070659_1000171253 141
241 3300005366 Ga0070659_101104102 Ga0070659_1011041021 141
242 3300005455 Ga0070663_100824401 Ga0070663_1008244012 141
243 3300005458 Ga0070681_10002130 Ga0070681_100021302 141
244 3300005458 Ga0070681_10400167 Ga0070681_104001672 141
245 3300005530 Ga0070679_100059780 Ga0070679_1000597803 141
246 3300005530 Ga0070679_100101199 Ga0070679_1001011993 141
247 3300005539 Ga0068853_100009968 Ga0068853_1000099682 141
248 3300005539 Ga0068853_100084127 Ga0068853_1000841273 141
249 3300005539 Ga0068853_100729110 Ga0068853_1007291102 141
250 3300005548 Ga0070665_100000945 Ga0070665_10000094521 141
251 3300005548 Ga0070665_100187871 Ga0070665_1001878713 141
252 3300005563 Ga0068855_100024641 Ga0068855_1000246415 141
253 3300005563 Ga0068855_100025093 Ga0068855_1000250936 141
254 3300005614 Ga0068856_100901390 Ga0068856_1009013902 141
255 3300005616 Ga0068852_100179402 Ga0068852_1001794023 141
256 3300005616 Ga0068852_101658581 Ga0068852_1016585811 141
257 3300005618 Ga0068864_100186364 Ga0068864_1001863643 141
258 3300005841 Ga0068863_100175295 Ga0068863_1001752952 141
259 3300009093 Ga0105240_10098539 Ga0105240_100985393 141
260 3300009093 Ga0105240_10127389 Ga0105240_101273892 141
261 3300009098 Ga0105245_10625277 Ga0105245_106252772 141
262 3300009545 Ga0105237_10166826 Ga0105237_101668263 141
263 3300009551 Ga0105238_10042172 Ga0105238_100421724 141
264 3300009551 Ga0105238_10065063 Ga0105238_100650633 141
265 3300010375 Ga0105239_10568335 Ga0105239_105683352 141
266 3300010375 Ga0105239_11022415 Ga0105239_110224152 141
267 3300013104 Ga0157370_10584427 Ga0157370_105844271 141
268 3300013105 Ga0157369_10711195 Ga0157369_107111952 141
269 3300013307 Ga0157372_11247865 Ga0157372_112478652 141
270 3300025909 Ga0207705_10005135 Ga0207705_1000513511 141
271 3300025909 Ga0207705_10157118 Ga0207705_101571182 141
272 3300025912 Ga0207707_10062816 Ga0207707_100628162 141
273 3300025912 Ga0207707_10115183 Ga0207707_101151833 141
274 3300025913 Ga0207695_10008102 Ga0207695_100081024 141
275 3300025913 Ga0207695_10070931 Ga0207695_100709313 141
276 3300025913 Ga0207695_10243926 Ga0207695_102439262 141
277 3300025914 Ga0207671_10099373 Ga0207671_100993733 141
278 3300025917 Ga0207660_10001963 Ga0207660_100019639 141
279 3300025917 Ga0207660_10100831 Ga0207660_101008312 141
280 3300025917 Ga0207660_11203629 Ga0207660_112036292 141
281 3300025919 Ga0207657_10001390 Ga0207657_1000139010 141
282 3300025919 Ga0207657_10018271 Ga0207657_100182712 141
283 3300025919 Ga0207657_10053064 Ga0207657_100530644 141
284 3300025920 Ga0207649_10490662 Ga0207649_104906622 141
285 3300025921 Ga0207652_10001537 Ga0207652_1000153710 141
286 3300025921 Ga0207652_10463143 Ga0207652_104631432 141
287 3300025924 Ga0207694_10070682 Ga0207694_100706822 141
288 3300025924 Ga0207694_10183552 Ga0207694_101835522 141
289 3300025927 Ga0207687_10130292 Ga0207687_101302923 141
290 3300025931 Ga0207644_10005489 Ga0207644_100054892 141
291 3300025932 Ga0207690_10000031 Ga0207690_10000031163 141
292 3300025932 Ga0207690_10007448 Ga0207690_100074482 141
293 3300025932 Ga0207690_10794142 Ga0207690_107941422 141
294 3300025942 Ga0207689_10035952 Ga0207689_100359522 141
295 3300025949 Ga0207667_10002879 Ga0207667_100028799 141
296 3300025949 Ga0207667_10478525 Ga0207667_104785252 141
297 3300026041 Ga0207639_10004762 Ga0207639_100047623 141
298 3300026041 Ga0207639_11133941 Ga0207639_111339412 141
299 3300026142 Ga0207698_10269135 Ga0207698_102691353 141
300 3300027378 Ga0209981_1002113 Ga0209981_10021131 141
301 3300027462 Ga0210000_1057144 Ga0210000_10571441 141
302 3300027543 Ga0209999_1009898 Ga0209999_10098982 141
303 3300028379 Ga0268266_10000003 Ga0268266_100000031378 141
304 3300028786 Ga0307517_10040779 Ga0307517_100407795 141
305 3300031251 Ga0265327_10004912 Ga0265327_100049124 141
306 3300031456 Ga0307513_10004806 Ga0307513_100048067 141
307 3300031456 Ga0307513_10014423 Ga0307513_100144233 141
308 3300031901 Ga0307406_11375029 Ga0307406_113750292 141
309 3300035089 Ga0373944_0007745 Ga0373944_0007745_402_830 141
310 3300035171 Ga0373946_0172411 Ga0373946_0172411_131_559 141
311 3300037068 Ga0373925_0000199 Ga0373925_0000199_58426_58854 141
312 3300046506 Ga0495583_0004258 Ga0495583_0004258_2691_3119 141
313 3300046507 Ga0495606_0076565 Ga0495606_0076565_1403_1831 141
314 3300046528 Ga0495642_0022236 Ga0495642_0022236_663_1091 141
315 3300046648 Ga0495611_0002863 Ga0495611_0002863_6237_6665 141
316 3300046660 Ga0495625_0027125 Ga0495625_0027125_1932_2360 141
317 3300046660 Ga0495625_0133483 Ga0495625_0133483_435_863 141
318 3300046660 Ga0495625_0195158 Ga0495625_0195158_392_820 141
319 3300046684 Ga0495669_0000006 Ga0495669_0000006_37397_37825 141
320 3300046684 Ga0495669_0000222 Ga0495669_0000222_26031_26459 141
321 3300046684 Ga0495669_0334168 Ga0495669_0334168_199_627 141
322 3300047443 Ga0495687_141708 Ga0495687_141708_146_574 141
323 3300047445 Ga0495677_0009881 Ga0495677_0009881_2329_2757 141
324 3300047447 Ga0495685_019778 Ga0495685_019778_271_699 141
325 3300048903 Ga0496100_0735329 Ga0496100_0735329_98_526 141
326 3300048918 Ga0496115_0022476 Ga0496115_0022476_2375_2803 141
327 3300048918 Ga0496115_0070820 Ga0496115_0070820_903_1331 141
328 3300049581 Ga0501047_0001866 Ga0501047_0001866_16269_16697 141
329 3300053096 Ga0500641_0045693 Ga0500641_0045693_1295_1720 141
330 3300053103 Ga0500555_125795 Ga0500555_125795_163_591 141
331 3300053108 Ga0500562_024747 Ga0500562_024747_427_852 141
332 3300005618 Ga0068864_100223392 Ga0068864_1002233922 143
333 3300005844 Ga0068862_100823344 Ga0068862_1008233442 143
334 3300006881 Ga0068865_100000753 Ga0068865_10000075313 143
335 3300009177 Ga0105248_10585487 Ga0105248_105854872 143
336 3300009553 Ga0105249_11320779 Ga0105249_113207792 143
337 3300013306 Ga0163162_11229873 Ga0163162_112298732 143
338 3300025938 Ga0207704_10005105 Ga0207704_100051052 143
339 3300025941 Ga0207711_10297220 Ga0207711_102972202 143
340 3300025945 Ga0207679_10651526 Ga0207679_106515262 143
341 3300026095 Ga0207676_10321022 Ga0207676_103210222 143
342 3300028380 Ga0268265_11197726 Ga0268265_111977262 143
343 3300046543 Ga0495645_0186314 Ga0495645_0186314_470_904 143
344 3300003215 JGI25153J46596_10079691 JGI25153J46596_100796912 148
345 3300003791 Ga0055530_10002430 Ga0055530_1000243011 148
346 3300003794 Ga0055531_10001198 Ga0055531_1000119810 148
347 3300004625 Ga0055543_1014823 Ga0055543_10148232 148
348 3300005262 Ga0065165_1000856 Ga0065165_100085637 148
349 3300025297 Ga0209758_1001260 Ga0209758_100126033 148
350 3300025298 Ga0209050_1000073 Ga0209050_100007346 148
351 3300025304 Ga0209257_1000099 Ga0209257_1000099251 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03994

DUF350

Domain of Unknown Function (DUF350)

95

146

0.99

PF03994

DUF350

Domain of Unknown Function (DUF350)

30

83

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8btk-assembly1.cif.gz_TC structure of the trap complex with the sec translocon and a translating ribosome 0.4593 29 140
3fbz-assembly3.cif.gz_C crystal structure of orf140 of the archaeal virus acidianus filamentous virus 1 (afv1) 0.4342 13 142
8b5l-assembly1.cif.gz_t cryo-em structure of ribosome-sec61-trap (translocon associated protein) translocon complex 0.4155 16 146
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.3995 63 147
8b5l-assembly1.cif.gz_t cryo-em structure of ribosome-sec61-trap (translocon associated protein) translocon complex 0.3879 16 146
ID Description Score Start End Superfamily
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5911 68 139 1.10.3470.10
af_A0A0G2K4B0_59_286_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4163 23 147 1.20.1070.10
af_Q7TM99_296_483_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4127 30 144 1.20.1250.20
af_O17927_126_336_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.4028 66 146 1.10.565.10
af_Q02328_671_873_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4 29 144 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A258BAI5-F1-model_v4 DUF350 domain-containing protein 0.9993 14 147 GO:0005886
AF-A0A258FAE5-F1-model_v4 DUF350 domain-containing protein 0.9986 13 147 GO:0005886
AF-A0A328AYV0-F1-model_v4 DUF350 domain-containing protein 0.9926 10 147 GO:0005886
AF-A0A2E0YHZ2-F1-model_v4 deleted 0.9837 16 148
AF-A0A519KIS9-F1-model_v4 DUF350 domain-containing protein 0.9827 14 95 GO:0005886

Feature Viewer

pLDDT pTM Quality
92.69 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map