F418460
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 232 | 700 | 249 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2990059506|2990063930 |
| Length | 282 |
| Sequence | ETAQMNAAGAEPAGTEGGARGARGGARGAGVAAVRVRALRRSYGEVVALDGVDLAFGAGTFTAVMGPSGSGKSTLLQCAAGLDRPSGGTVRVDGVELAGLSERRLTLLRRERIGFVFQAFNLLPALTAAQNVALPLRLARRRPSRAAVRESLARVGLAERAGHRPDQLSGGQQQRVALARALITRPAVLFGDEPTGALDTTTIREVLCLLRELVDREGQTTVMVTHDPVAASYADRVVFLVDGRVSGELARPSAEGVAAHMAGLESAAAGAGDDAVVGGVTC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 25 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 26 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 68 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 72 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 73 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 74 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 75 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 76 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 77 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 78 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 79 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 80 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 81 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 82 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 83 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 84 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 85 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 86 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 87 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 88 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 89 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 90 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 91 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 92 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 93 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 94 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 95 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 96 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 97 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 98 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 99 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 100 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 101 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 102 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 105 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 183 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 185 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 186 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 187 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 195 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 196 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 197 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 198 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 199 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 202 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 203 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 204 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 205 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 206 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 207 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 208 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 209 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 210 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 211 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 212 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 213 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 214 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 215 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 216 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 217 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 218 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 219 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 220 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 221 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 222 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 223 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 224 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 225 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 226 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 227 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 228 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 229 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 230 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 231 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 232 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.86 |
| Metatranscriptomes | 0 |
| Isolates | 9.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.43 |
| Nodule | 1.14 |
| Rhizoplane | 2.57 |
| Rhizosphere | 78.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10004408 | 3300003203 | Bacteria | 6557 |
| 2 | Ga0070683_100103783 | 3300005329 | Bacteria | 2679 |
| 3 | Ga0070680_100255839 | 3300005336 | Bacteria | 1481 |
| 4 | Ga0070691_10054155 | 3300005341 | Bacteria | 1920 |
| 5 | Ga0070692_10103199 | 3300005345 | Bacteria | 1566 |
| 6 | Ga0070668_100000543 | 3300005347 | Bacteria | 25223 |
| 7 | Ga0070668_100003083 | 3300005347 | Bacteria | 12318 |
| 8 | Ga0070668_100104114 | 3300005347 | Bacteria | 2252 |
| 9 | Ga0070674_100046950 | 3300005356 | Bacteria | 2957 |
| 10 | Ga0070674_100126279 | 3300005356 | Bacteria | 1901 |
| 11 | Ga0070714_100826097 | 3300005435 | Bacteria | 898 |
| 12 | Ga0070713_100010280 | 3300005436 | Bacteria | 6755 |
| 13 | Ga0070700_100015294 | 3300005441 | Bacteria | 4348 |
| 14 | Ga0070662_100100224 | 3300005457 | Bacteria | 2191 |
| 15 | Ga0070706_100307001 | 3300005467 | Bacteria | 1480 |
| 16 | Ga0070707_100002823 | 3300005468 | Bacteria | 16528 |
| 17 | Ga0070707_100035570 | 3300005468 | Bacteria | 4751 |
| 18 | Ga0070672_100184276 | 3300005543 | Bacteria | 1741 |
| 19 | Ga0070665_100362344 | 3300005548 | Bacteria | 1456 |
| 20 | Ga0070664_100041117 | 3300005564 | Bacteria | 3900 |
| 21 | Ga0070664_100203912 | 3300005564 | Bacteria | 1766 |
| 22 | Ga0068857_100114538 | 3300005577 | Bacteria | 2425 |
| 23 | Ga0068861_100097373 | 3300005719 | Bacteria | 2333 |
| 24 | Ga0068860_100000393 | 3300005843 | Bacteria | 57188 |
| 25 | Ga0068860_100315361 | 3300005843 | Bacteria | 1534 |
| 26 | Ga0081455_10130708 | 3300005937 | Bacteria | 1963 |
| 27 | Ga0081455_10153034 | 3300005937 | Bacteria | 1776 |
| 28 | Ga0081538_10000241 | 3300005981 | Bacteria | 61996 |
| 29 | Ga0081538_10000962 | 3300005981 | Bacteria | 30790 |
| 30 | Ga0081539_10000479 | 3300005985 | Bacteria | 84481 |
| 31 | Ga0081539_10004206 | 3300005985 | Bacteria | 16247 |
| 32 | Ga0070717_10009819 | 3300006028 | Bacteria | 7207 |
| 33 | Ga0075365_10013260 | 3300006038 | Bacteria | 4918 |
| 34 | Ga0075365_10023227 | 3300006038 | Bacteria | 3898 |
| 35 | Ga0075365_10023815 | 3300006038 | Bacteria | 3854 |
| 36 | Ga0075365_10040035 | 3300006038 | Bacteria | 3054 |
| 37 | Ga0075365_10059715 | 3300006038 | Bacteria | 2542 |
| 38 | Ga0075365_10363323 | 3300006038 | Bacteria | 1021 |
| 39 | Ga0075368_10066119 | 3300006042 | Bacteria | 1453 |
| 40 | Ga0075363_100020537 | 3300006048 | Bacteria | 3314 |
| 41 | Ga0075363_100060021 | 3300006048 | Bacteria | 2046 |
| 42 | Ga0075363_100145505 | 3300006048 | Bacteria | 1336 |
| 43 | Ga0075364_10022209 | 3300006051 | Bacteria | 4004 |
| 44 | Ga0075364_10032455 | 3300006051 | Bacteria | 3357 |
| 45 | Ga0075364_10078134 | 3300006051 | Bacteria | 2185 |
| 46 | Ga0075362_10004403 | 3300006177 | Bacteria | 5057 |
| 47 | Ga0075430_100160685 | 3300006846 | Bacteria | 1870 |
| 48 | Ga0075431_100088110 | 3300006847 | Bacteria | 3203 |
| 49 | Ga0068865_100334863 | 3300006881 | Bacteria | 1221 |
| 50 | Ga0105251_10078803 | 3300009011 | Bacteria | 1525 |
| 51 | Ga0105240_10028657 | 3300009093 | Bacteria | 7268 |
| 52 | Ga0114129_10460150 | 3300009147 | Bacteria | 1667 |
| 53 | Ga0105241_10627460 | 3300009174 | Bacteria | 974 |
| 54 | Ga0105238_10324161 | 3300009551 | Bacteria | 1527 |
| 55 | Ga0105249_10223323 | 3300009553 | Bacteria | 1855 |
| 56 | Ga0157372_10000006 | 3300013307 | Bacteria | 354669 |
| 57 | Ga0157372_10928594 | 3300013307 | Bacteria | 1009 |
| 58 | Ga0157380_10150695 | 3300014326 | Bacteria | 2010 |
| 59 | Ga0157380_10273238 | 3300014326 | Bacteria | 1542 |
| 60 | Ga0209758_1001084 | 3300025297 | Bacteria | 35344 |
| 61 | Ga0207426_1022476 | 3300025302 | Bacteria | 2164 |
| 62 | Ga0209051_1029261 | 3300025303 | Bacteria | 2159 |
| 63 | Ga0207695_10032544 | 3300025913 | Bacteria | 5704 |
| 64 | Ga0207660_10286444 | 3300025917 | Bacteria | 1309 |
| 65 | Ga0207652_10622404 | 3300025921 | Bacteria | 967 |
| 66 | Ga0207646_10003708 | 3300025922 | Bacteria | 17046 |
| 67 | Ga0207694_10221676 | 3300025924 | Bacteria | 1543 |
| 68 | Ga0207687_10240767 | 3300025927 | Bacteria | 1434 |
| 69 | Ga0207700_10006590 | 3300025928 | Bacteria | 7030 |
| 70 | Ga0207690_10451814 | 3300025932 | Bacteria | 1033 |
| 71 | Ga0207669_10107946 | 3300025937 | Bacteria | 1858 |
| 72 | Ga0207704_10069464 | 3300025938 | Bacteria | 2226 |
| 73 | Ga0207691_10027488 | 3300025940 | Bacteria | 5333 |
| 74 | Ga0207689_10238199 | 3300025942 | Bacteria | 1504 |
| 75 | Ga0207661_10152433 | 3300025944 | Bacteria | 1999 |
| 76 | Ga0207661_10174381 | 3300025944 | Bacteria | 1874 |
| 77 | Ga0207679_10022570 | 3300025945 | Bacteria | 4288 |
| 78 | Ga0207712_10329849 | 3300025961 | Bacteria | 1262 |
| 79 | Ga0207668_10000408 | 3300025972 | Bacteria | 27061 |
| 80 | Ga0207668_10000669 | 3300025972 | Bacteria | 21064 |
| 81 | Ga0207640_10031837 | 3300025981 | Bacteria | 3264 |
| 82 | Ga0207658_10323675 | 3300025986 | Bacteria | 1335 |
| 83 | Ga0207678_10001638 | 3300026067 | Bacteria | 20520 |
| 84 | Ga0207678_10014747 | 3300026067 | Bacteria | 6877 |
| 85 | Ga0207708_10004380 | 3300026075 | Bacteria | 10403 |
| 86 | Ga0207674_10135025 | 3300026116 | Bacteria | 2429 |
| 87 | Ga0207674_10136925 | 3300026116 | Bacteria | 2410 |
| 88 | Ga0207675_100171708 | 3300026118 | Bacteria | 2073 |
| 89 | Ga0207698_10172813 | 3300026142 | Bacteria | 1905 |
| 90 | Ga0209813_10060613 | 3300027866 | Bacteria | 1207 |
| 91 | Ga0207428_10212749 | 3300027907 | Bacteria | 1452 |
| 92 | Ga0268266_10080298 | 3300028379 | Bacteria | 2842 |
| 93 | Ga0268266_10569374 | 3300028379 | Bacteria | 1087 |
| 94 | Ga0268264_10000468 | 3300028381 | Bacteria | 54851 |
| 95 | Ga0268264_10064223 | 3300028381 | Bacteria | 3089 |
| 96 | Ga0265338_10011809 | 3300028800 | Bacteria | 10038 |
| 97 | Ga0265327_10143552 | 3300031251 | Bacteria | 1114 |
| 98 | Ga0316576_10025176 | 3300031727 | Bacteria | 4163 |
| 99 | Ga0307405_10193022 | 3300031731 | Bacteria | 1472 |
| 100 | Ga0307405_10322947 | 3300031731 | Bacteria | 1180 |
| 101 | Ga0307413_10367561 | 3300031824 | Bacteria | 1116 |
| 102 | Ga0307413_10549784 | 3300031824 | Bacteria | 936 |
| 103 | Ga0307410_10050969 | 3300031852 | Bacteria | 2787 |
| 104 | Ga0307409_100135116 | 3300031995 | Bacteria | 2115 |
| 105 | Ga0307409_100199068 | 3300031995 | Bacteria | 1790 |
| 106 | Ga0307409_100473734 | 3300031995 | Bacteria | 1213 |
| 107 | Ga0307416_100073673 | 3300032002 | Bacteria | 2848 |
| 108 | Ga0307415_100017105 | 3300032126 | Bacteria | 4340 |
| 109 | Ga0307415_100122360 | 3300032126 | Bacteria | 1954 |
| 110 | Ga0307507_10036708 | 3300033179 | Bacteria | 5004 |
| 111 | Ga0307507_10087088 | 3300033179 | Bacteria | 2702 |
| 112 | Ga0307510_10100725 | 3300033180 | Bacteria | 2680 |
| 113 | Ga0373948_0001916 | 3300034817 | Bacteria | 2987 |
| 114 | Ga0395900_0907692 | 3300037418 | Bacteria | 804 |
| 115 | Ga0395898_0009083 | 3300037466 | Bacteria | 10469 |
| 116 | Ga0395898_0167186 | 3300037466 | Bacteria | 2103 |
| 117 | Ga0436364_1531027 | 3300037853 | Bacteria | 5637 |
| 118 | Ga0395901_0116568 | 3300038443 | Bacteria | 2806 |
| 119 | Ga0395901_0262059 | 3300038443 | Bacteria | 1799 |
| 120 | Ga0400483_096313 | 3300039062 | Bacteria | 2781 |
| 121 | Ga0400483_248916 | 3300039062 | Bacteria | 3448 |
| 122 | Ga0451797_0050858 | 3300041453 | Bacteria | 2485 |
| 123 | Ga0451802_0674731 | 3300041460 | Bacteria | 1389 |
| 124 | Ga0451837_1334159 | 3300041494 | Bacteria | 1417 |
| 125 | Ga0451853_1165602 | 3300041512 | Bacteria | 10600 |
| 126 | Ga0450922_007557 | 3300042124 | Bacteria | 1021 |
| 127 | Ga0450899_000343 | 3300042135 | Bacteria | 5140 |
| 128 | Ga0450910_006814 | 3300042147 | Bacteria | 1583 |
| 129 | Ga0466969_0003387 | 3300044656 | Bacteria | 8487 |
| 130 | Ga0466965_0092504 | 3300044683 | Bacteria | 1540 |
| 131 | Ga0466966_0004730 | 3300044684 | Bacteria | 8955 |
| 132 | Ga0466966_0264360 | 3300044684 | Bacteria | 1036 |
| 133 | Ga0466961_0041805 | 3300044693 | Bacteria | 2939 |
| 134 | Ga0466961_0094550 | 3300044693 | Bacteria | 1886 |
| 135 | Ga0466963_0028185 | 3300044694 | Bacteria | 3603 |
| 136 | Ga0466963_0271930 | 3300044694 | Bacteria | 1190 |
| 137 | Ga0466963_0573216 | 3300044694 | Bacteria | 797 |
| 138 | Ga0466971_0025047 | 3300044719 | Bacteria | 2665 |
| 139 | Ga0466968_0268345 | 3300044735 | Bacteria | 814 |
| 140 | Ga0466970_0105419 | 3300044765 | Bacteria | 1537 |
| 141 | Ga0466957_0258618 | 3300044842 | Bacteria | 1159 |
| 142 | Ga0466960_0053705 | 3300044901 | Bacteria | 1953 |
| 143 | Ga0466960_0080045 | 3300044901 | Bacteria | 1644 |
| 144 | Ga0466960_0228580 | 3300044901 | Bacteria | 1026 |
| 145 | Ga0466959_0025464 | 3300045049 | Bacteria | 4384 |
| 146 | Ga0466959_0163551 | 3300045049 | Bacteria | 1564 |
| 147 | Ga0466958_0199726 | 3300045836 | Bacteria | 1272 |
| 148 | Ga0466967_0004427 | 3300045976 | Bacteria | 9467 |
| 149 | Ga0466967_0005544 | 3300045976 | Bacteria | 8762 |
| 150 | Ga0466967_0021959 | 3300045976 | Bacteria | 5197 |
| 151 | Ga0466967_0150129 | 3300045976 | Bacteria | 2177 |
| 152 | Ga0466967_0286571 | 3300045976 | Bacteria | 1581 |
| 153 | Ga0466967_0477992 | 3300045976 | Bacteria | 1220 |
| 154 | Ga0495592_0011698 | 3300046454 | Bacteria | 6647 |
| 155 | Ga0495592_0015206 | 3300046454 | Bacteria | 5844 |
| 156 | Ga0495638_0000247 | 3300046460 | Bacteria | 73629 |
| 157 | Ga0495651_0009449 | 3300046462 | Bacteria | 7489 |
| 158 | Ga0495653_0014031 | 3300046463 | Bacteria | 6532 |
| 159 | Ga0495580_0017272 | 3300046472 | Bacteria | 5401 |
| 160 | Ga0495662_0000200 | 3300046476 | Bacteria | 24779 |
| 161 | Ga0495662_0003419 | 3300046476 | Bacteria | 8045 |
| 162 | Ga0495664_0003316 | 3300046477 | Bacteria | 8751 |
| 163 | Ga0495585_0074583 | 3300046492 | Bacteria | 1846 |
| 164 | Ga0495594_0014491 | 3300046499 | Bacteria | 4133 |
| 165 | Ga0495583_0046336 | 3300046506 | Bacteria | 2005 |
| 166 | Ga0495606_0000715 | 3300046507 | Bacteria | 51355 |
| 167 | Ga0495608_0004230 | 3300046511 | Bacteria | 10290 |
| 168 | Ga0495618_0015862 | 3300046514 | Bacteria | 4599 |
| 169 | Ga0495628_0111249 | 3300046516 | Bacteria | 2106 |
| 170 | Ga0495666_0001368 | 3300046526 | Bacteria | 11822 |
| 171 | Ga0495666_0138319 | 3300046526 | Bacteria | 1136 |
| 172 | Ga0495652_0028983 | 3300046529 | Bacteria | 4863 |
| 173 | Ga0495665_0003140 | 3300046531 | Bacteria | 8943 |
| 174 | Ga0495640_0020210 | 3300046533 | Bacteria | 4904 |
| 175 | Ga0495586_0005753 | 3300046535 | Bacteria | 6629 |
| 176 | Ga0495645_0006169 | 3300046543 | Bacteria | 8300 |
| 177 | Ga0495667_0019132 | 3300046559 | Bacteria | 4621 |
| 178 | Ga0495668_0000197 | 3300046616 | Bacteria | 88776 |
| 179 | Ga0495634_0023213 | 3300046642 | Bacteria | 4362 |
| 180 | Ga0495625_0001354 | 3300046660 | Bacteria | 30220 |
| 181 | Ga0495625_0094223 | 3300046660 | Bacteria | 2066 |
| 182 | Ga0495625_0100700 | 3300046660 | Bacteria | 1986 |
| 183 | Ga0495635_0063773 | 3300046663 | Bacteria | 2530 |
| 184 | Ga0495657_0009209 | 3300046675 | Bacteria | 7493 |
| 185 | Ga0495657_0019776 | 3300046675 | Bacteria | 4854 |
| 186 | Ga0495657_0025269 | 3300046675 | Bacteria | 4221 |
| 187 | Ga0495657_0032158 | 3300046675 | Bacteria | 3664 |
| 188 | Ga0495623_0005116 | 3300046679 | Bacteria | 8605 |
| 189 | Ga0495613_0002237 | 3300046689 | Bacteria | 14644 |
| 190 | Ga0495613_0024819 | 3300046689 | Bacteria | 4467 |
| 191 | Ga0495613_0061025 | 3300046689 | Bacteria | 2761 |
| 192 | Ga0495613_0118908 | 3300046689 | Bacteria | 1898 |
| 193 | Ga0495589_0059145 | 3300046794 | Bacteria | 1884 |
| 194 | Ga0495600_0021298 | 3300046809 | Bacteria | 4149 |
| 195 | Ga0495600_0094811 | 3300046809 | Bacteria | 1946 |
| 196 | Ga0495604_0002194 | 3300047317 | Bacteria | 15634 |
| 197 | Ga0495636_0031678 | 3300047318 | Bacteria | 2168 |
| 198 | Ga0495674_0185608 | 3300047319 | Bacteria | 1730 |
| 199 | Ga0495674_0238790 | 3300047319 | Bacteria | 1498 |
| 200 | Ga0495676_0035247 | 3300047321 | Bacteria | 4187 |
| 201 | Ga0495687_014697 | 3300047443 | Bacteria | 4014 |
| 202 | Ga0495675_0002347 | 3300047444 | Bacteria | 11295 |
| 203 | Ga0495675_0026129 | 3300047444 | Bacteria | 3722 |
| 204 | Ga0495675_0139400 | 3300047444 | Bacteria | 1504 |
| 205 | Ga0495675_0198735 | 3300047444 | Bacteria | 1221 |
| 206 | Ga0495685_000961 | 3300047447 | Bacteria | 8708 |
| 207 | Ga0495681_0018260 | 3300047470 | Bacteria | 3867 |
| 208 | Ga0495593_0031336 | 3300047673 | Bacteria | 2905 |
| 209 | Ga0495626_0000025 | 3300048091 | Bacteria | 209356 |
| 210 | Ga0496102_0662321 | 3300048905 | Bacteria | 967 |
| 211 | Ga0496104_0125161 | 3300048907 | Bacteria | 2468 |
| 212 | Ga0496106_0494334 | 3300048909 | Bacteria | 983 |
| 213 | Ga0496109_0091812 | 3300048912 | Bacteria | 2808 |
| 214 | Ga0496109_0390489 | 3300048912 | Bacteria | 1315 |
| 215 | Ga0496112_0464732 | 3300048915 | Bacteria | 1203 |
| 216 | Ga0501031_0000154 | 3300049568 | Bacteria | 38960 |
| 217 | Ga0501031_0155301 | 3300049568 | Bacteria | 1495 |
| 218 | Ga0501031_0271309 | 3300049568 | Bacteria | 1101 |
| 219 | Ga0501032_0001420 | 3300049569 | Bacteria | 19022 |
| 220 | Ga0501033_0000278 | 3300049570 | Bacteria | 49428 |
| 221 | Ga0501033_0075386 | 3300049570 | Bacteria | 2476 |
| 222 | Ga0501034_0032968 | 3300049571 | Bacteria | 5259 |
| 223 | Ga0501034_0100710 | 3300049571 | Bacteria | 2883 |
| 224 | Ga0501034_0218131 | 3300049571 | Bacteria | 1861 |
| 225 | Ga0501036_0000264 | 3300049572 | Bacteria | 35768 |
| 226 | Ga0501036_0016401 | 3300049572 | Bacteria | 6188 |
| 227 | Ga0501037_0000231 | 3300049573 | Bacteria | 48188 |
| 228 | Ga0501037_0167824 | 3300049573 | Bacteria | 1562 |
| 229 | Ga0501038_0000901 | 3300049574 | Bacteria | 26334 |
| 230 | Ga0501038_0069555 | 3300049574 | Bacteria | 2990 |
| 231 | Ga0501039_0002992 | 3300049575 | Bacteria | 12645 |
| 232 | Ga0501039_0038861 | 3300049575 | Bacteria | 3675 |
| 233 | Ga0501039_0138406 | 3300049575 | Bacteria | 1912 |
| 234 | Ga0501040_0148397 | 3300049576 | Bacteria | 1653 |
| 235 | Ga0501041_0026969 | 3300049577 | Bacteria | 3460 |
| 236 | Ga0501041_0111369 | 3300049577 | Bacteria | 1698 |
| 237 | Ga0501042_0047000 | 3300049578 | Bacteria | 3077 |
| 238 | Ga0501042_0108438 | 3300049578 | Bacteria | 1999 |
| 239 | Ga0501042_0354171 | 3300049578 | Bacteria | 1062 |
| 240 | Ga0501042_0409604 | 3300049578 | Bacteria | 982 |
| 241 | Ga0501043_0000263 | 3300049579 | Bacteria | 47686 |
| 242 | Ga0501046_0037260 | 3300049580 | Bacteria | 3908 |
| 243 | Ga0501046_0105512 | 3300049580 | Bacteria | 2158 |
| 244 | Ga0501047_0004451 | 3300049581 | Bacteria | 13192 |
| 245 | Ga0501048_0000103 | 3300049582 | Bacteria | 46821 |
| 246 | Ga0501048_0110881 | 3300049582 | Bacteria | 1937 |
| 247 | Ga0501067_0017047 | 3300049583 | Bacteria | 4014 |
| 248 | Ga0501067_0114806 | 3300049583 | Bacteria | 1498 |
| 249 | Ga0501068_0111656 | 3300049584 | Bacteria | 1700 |
| 250 | Ga0501069_0002141 | 3300049585 | Bacteria | 9945 |
| 251 | Ga0501070_0002144 | 3300049586 | Bacteria | 17333 |
| 252 | Ga0501070_0096721 | 3300049586 | Bacteria | 2443 |
| 253 | Ga0501070_0802540 | 3300049586 | Bacteria | 739 |
| 254 | Ga0501071_0005048 | 3300049587 | Bacteria | 8443 |
| 255 | Ga0501071_0207338 | 3300049587 | Bacteria | 1473 |
| 256 | Ga0501071_0523889 | 3300049587 | Bacteria | 909 |
| 257 | Ga0501072_0015498 | 3300049588 | Bacteria | 5842 |
| 258 | Ga0501072_0054692 | 3300049588 | Bacteria | 3145 |
| 259 | Ga0501072_0192295 | 3300049588 | Bacteria | 1627 |
| 260 | Ga0501072_0356492 | 3300049588 | Bacteria | 1161 |
| 261 | Ga0501073_0003921 | 3300049589 | Bacteria | 11172 |
| 262 | Ga0501074_0000185 | 3300049590 | Bacteria | 33746 |
| 263 | Ga0501074_0091377 | 3300049590 | Bacteria | 2180 |
| 264 | Ga0501074_0260036 | 3300049590 | Bacteria | 1234 |
| 265 | Ga0501075_0044307 | 3300049591 | Bacteria | 3338 |
| 266 | Ga0501075_0212697 | 3300049591 | Bacteria | 1475 |
| 267 | Ga0501075_0426518 | 3300049591 | Bacteria | 1011 |
| 268 | Ga0501079_0027000 | 3300049741 | Bacteria | 4401 |
| 269 | Ga0501079_0142615 | 3300049741 | Bacteria | 1866 |
| 270 | Ga0501080_0000349 | 3300049742 | Bacteria | 35411 |
| 271 | Ga0501080_0095088 | 3300049742 | Bacteria | 2767 |
| 272 | Ga0501081_0106635 | 3300049743 | Bacteria | 1986 |
| 273 | Ga0501081_0324303 | 3300049743 | Bacteria | 1132 |
| 274 | Ga0501083_0043172 | 3300049744 | Bacteria | 3055 |
| 275 | Ga0501083_0203314 | 3300049744 | Bacteria | 1292 |
| 276 | Ga0501035_0116738 | 3300049822 | Bacteria | 2335 |
| 277 | Ga0501035_0220688 | 3300049822 | Bacteria | 1619 |
| 278 | Ga0501035_0385455 | 3300049822 | Bacteria | 1168 |
| 279 | Ga0501044_0000922 | 3300049823 | Bacteria | 35394 |
| 280 | Ga0501044_0048561 | 3300049823 | Bacteria | 4383 |
| 281 | Ga0501044_0092453 | 3300049823 | Bacteria | 3051 |
| 282 | nmdc:mga03n38_140798_c1 | 3300050490 | Bacteria | 1204 |
| 283 | nmdc:mga03n38_215359_c1 | 3300050490 | Bacteria | 1000 |
| 284 | nmdc:mga03n38_31566_c1 | 3300050490 | Bacteria | 2236 |
| 285 | nmdc:mga00v17_12922_c1 | 3300050491 | Bacteria | 4622 |
| 286 | nmdc:mga00v17_182094_c1 | 3300050491 | Bacteria | 1356 |
| 287 | nmdc:mga00v17_58571_c1 | 3300050491 | Bacteria | 2360 |
| 288 | nmdc:mga0yw44_133300_c1 | 3300050492 | Bacteria | 1610 |
| 289 | nmdc:mga0yw44_275140_c1 | 3300050492 | Bacteria | 1124 |
| 290 | nmdc:mga0yw44_4499_c1 | 3300050492 | Bacteria | 6406 |
| 291 | nmdc:mga0yw44_492109_c1 | 3300050492 | Bacteria | 832 |
| 292 | nmdc:mga0yw44_6321_c2 | 3300050492 | Bacteria | 4028 |
| 293 | nmdc:mga0yw44_77011_c1 | 3300050492 | Bacteria | 2083 |
| 294 | nmdc:mga06z11_287869_c1 | 3300050494 | Bacteria | 974 |
| 295 | nmdc:mga04h51_51040_c1 | 3300050495 | Bacteria | 1388 |
| 296 | nmdc:mga07m45_142428_c1 | 3300050496 | Bacteria | 1388 |
| 297 | nmdc:mga09592_236822_c1 | 3300050508 | Bacteria | 1581 |
| 298 | nmdc:mga09592_290215_c1 | 3300050508 | Bacteria | 1418 |
| 299 | nmdc:mga0qj67_259219_c1 | 3300050509 | Bacteria | 1410 |
| 300 | nmdc:mga06r32_73364_c1 | 3300050510 | Bacteria | 3315 |
| 301 | nmdc:mga06r32_73542_c1 | 3300050510 | Bacteria | 3311 |
| 302 | nmdc:mga08y16_138991_c1 | 3300050511 | Bacteria | 2525 |
| 303 | Ga0495601_0012197 | 3300053077 | Bacteria | 5153 |
| 304 | Ga0495619_0027999 | 3300053085 | Bacteria | 3633 |
| 305 | Ga0500560_004303 | 3300053107 | Bacteria | 3013 |
| 306 | Ga0500569_000008 | 3300053109 | Bacteria | 73629 |
| 307 | Ga0500573_0084976 | 3300053140 | Bacteria | 1795 |
| 308 | Ga0500573_0088308 | 3300053140 | Bacteria | 1754 |
| 309 | Ga0500573_0167092 | 3300053140 | Bacteria | 1193 |
| 310 | Ga0500588_0000115 | 3300053146 | Bacteria | 10600 |
| 311 | Ga0500616_0000506 | 3300053153 | Bacteria | 49867 |
| 312 | Ga0501084_0000908 | 3300054114 | Bacteria | 22886 |
| 313 | Ga0501084_0134379 | 3300054114 | Bacteria | 2082 |
| 314 | Ga0501082_0066304 | 3300060353 | Bacteria | 3109 |
| 315 | Ga0501082_0176764 | 3300060353 | Bacteria | 1856 |
| 316 | Ga0501082_0820840 | 3300060353 | Bacteria | 813 |
| 317 | Ga0466962_0123284 | 3300061719 | Bacteria | 1251 |
| 318 | Ga0530510_0200049 | 3300061734 | Bacteria | 1483 |
| 319 | 2990063930 | 2990059506 | Bacteria | 9321252 |
| 320 | 2585315877 | 2582581314 | Bacteria | 11452267 |
| 321 | 2620352765 | 2619619003 | Bacteria | 7619552 |
| 322 | 2643826729 | 2643221561 | Bacteria | 4984412 |
| 323 | 2644534085 | 2643221696 | Bacteria | 5431823 |
| 324 | 2739240247 | 2738543011 | Bacteria | 5731169 |
| 325 | 2768642095 | 2767802112 | Bacteria | 6465194 |
| 326 | 2785342204 | 2784746763 | Bacteria | 9783172 |
| 327 | 2791910097 | 2791354901 | Bacteria | 8322202 |
| 328 | 2791916152 | 2791354901 | Bacteria | 8322202 |
| 329 | 2793981543 | 2791355406 | Bacteria | 11364898 |
| 330 | 2795786796 | 2795385470 | Bacteria | 8317180 |
| 331 | 2819698236 | 2818991463 | Bacteria | 7948711 |
| 332 | 2862389616 | 2862382967 | Bacteria | 10317375 |
| 333 | 2862580504 | 2862574272 | Bacteria | 10567477 |
| 334 | 2867372902 | 2867369537 | Bacteria | 6501581 |
| 335 | 2868091037 | 2868088558 | Bacteria | 7609351 |
| 336 | 2883822181 | 2883821847 | Bacteria | 5121194 |
| 337 | 2891402368 | 2891395885 | Bacteria | 9251614 |
| 338 | 2891570001 | 2891562705 | Bacteria | 8039471 |
| 339 | 2910812244 | 2910809715 | Bacteria | 4982797 |
| 340 | 2939749081 | 2939743619 | Bacteria | 5762299 |
| 341 | 3003001207 | 3002998708 | Bacteria | 11715108 |
| 342 | 3003002055 | 3002998708 | Bacteria | 11715108 |
| 343 | 8003322898 | 8003314358 | Bacteria | 10575343 |
| 344 | 8008566201 | 8008558824 | Bacteria | 10610750 |
| 345 | 8008581653 | 8008574985 | Bacteria | 7815457 |
| 346 | 8023629413 | 8023623736 | Bacteria | 8593882 |
| 347 | 8047900981 | 8047893842 | Bacteria | 11723082 |
| 348 | 8048357920 | 8048356638 | Bacteria | 11044339 |
| 349 | 8048377923 | 8048369669 | Bacteria | 11666822 |
| 350 | 8048387021 | 8048379754 | Bacteria | 11877923 |
| 351 | JGI25406J46586_10004408 | |||
| 352 | Ga0070683_100103783 | |||
| 353 | Ga0070680_100255839 | |||
| 354 | Ga0070691_10054155 | |||
| 355 | Ga0070692_10103199 | |||
| 356 | Ga0070668_100000543 | |||
| 357 | Ga0070668_100003083 | |||
| 358 | Ga0070668_100104114 | |||
| 359 | Ga0070674_100046950 | |||
| 360 | Ga0070674_100126279 | |||
| 361 | Ga0070714_100826097 | |||
| 362 | Ga0070713_100010280 | |||
| 363 | Ga0070700_100015294 | |||
| 364 | Ga0070662_100100224 | |||
| 365 | Ga0070706_100307001 | |||
| 366 | Ga0070707_100002823 | |||
| 367 | Ga0070707_100035570 | |||
| 368 | Ga0070672_100184276 | |||
| 369 | Ga0070665_100362344 | |||
| 370 | Ga0070664_100041117 | |||
| 371 | Ga0070664_100203912 | |||
| 372 | Ga0068857_100114538 | |||
| 373 | Ga0068861_100097373 | |||
| 374 | Ga0068860_100000393 | |||
| 375 | Ga0068860_100315361 | |||
| 376 | Ga0081455_10130708 | |||
| 377 | Ga0081455_10153034 | |||
| 378 | Ga0081538_10000241 | |||
| 379 | Ga0081538_10000962 | |||
| 380 | Ga0081539_10000479 | |||
| 381 | Ga0081539_10004206 | |||
| 382 | Ga0070717_10009819 | |||
| 383 | Ga0075365_10013260 | |||
| 384 | Ga0075365_10023227 | |||
| 385 | Ga0075365_10023815 | |||
| 386 | Ga0075365_10040035 | |||
| 387 | Ga0075365_10059715 | |||
| 388 | Ga0075365_10363323 | |||
| 389 | Ga0075368_10066119 | |||
| 390 | Ga0075363_100020537 | |||
| 391 | Ga0075363_100060021 | |||
| 392 | Ga0075363_100145505 | |||
| 393 | Ga0075364_10022209 | |||
| 394 | Ga0075364_10032455 | |||
| 395 | Ga0075364_10078134 | |||
| 396 | Ga0075362_10004403 | |||
| 397 | Ga0075430_100160685 | |||
| 398 | Ga0075431_100088110 | |||
| 399 | Ga0068865_100334863 | |||
| 400 | Ga0105251_10078803 | |||
| 401 | Ga0105240_10028657 | |||
| 402 | Ga0114129_10460150 | |||
| 403 | Ga0105241_10627460 | |||
| 404 | Ga0105238_10324161 | |||
| 405 | Ga0105249_10223323 | |||
| 406 | Ga0157372_10000006 | |||
| 407 | Ga0157372_10928594 | |||
| 408 | Ga0157380_10150695 | |||
| 409 | Ga0157380_10273238 | |||
| 410 | Ga0209758_1001084 | |||
| 411 | Ga0207426_1022476 | |||
| 412 | Ga0209051_1029261 | |||
| 413 | Ga0207695_10032544 | |||
| 414 | Ga0207660_10286444 | |||
| 415 | Ga0207652_10622404 | |||
| 416 | Ga0207646_10003708 | |||
| 417 | Ga0207694_10221676 | |||
| 418 | Ga0207687_10240767 | |||
| 419 | Ga0207700_10006590 | |||
| 420 | Ga0207690_10451814 | |||
| 421 | Ga0207669_10107946 | |||
| 422 | Ga0207704_10069464 | |||
| 423 | Ga0207691_10027488 | |||
| 424 | Ga0207689_10238199 | |||
| 425 | Ga0207661_10152433 | |||
| 426 | Ga0207661_10174381 | |||
| 427 | Ga0207679_10022570 | |||
| 428 | Ga0207712_10329849 | |||
| 429 | Ga0207668_10000408 | |||
| 430 | Ga0207668_10000669 | |||
| 431 | Ga0207640_10031837 | |||
| 432 | Ga0207658_10323675 | |||
| 433 | Ga0207678_10001638 | |||
| 434 | Ga0207678_10014747 | |||
| 435 | Ga0207708_10004380 | |||
| 436 | Ga0207674_10135025 | |||
| 437 | Ga0207674_10136925 | |||
| 438 | Ga0207675_100171708 | |||
| 439 | Ga0207698_10172813 | |||
| 440 | Ga0209813_10060613 | |||
| 441 | Ga0207428_10212749 | |||
| 442 | Ga0268266_10080298 | |||
| 443 | Ga0268266_10569374 | |||
| 444 | Ga0268264_10000468 | |||
| 445 | Ga0268264_10064223 | |||
| 446 | Ga0265338_10011809 | |||
| 447 | Ga0265327_10143552 | |||
| 448 | Ga0316576_10025176 | |||
| 449 | Ga0307405_10193022 | |||
| 450 | Ga0307405_10322947 | |||
| 451 | Ga0307413_10367561 | |||
| 452 | Ga0307413_10549784 | |||
| 453 | Ga0307410_10050969 | |||
| 454 | Ga0307409_100135116 | |||
| 455 | Ga0307409_100199068 | |||
| 456 | Ga0307409_100473734 | |||
| 457 | Ga0307416_100073673 | |||
| 458 | Ga0307415_100017105 | |||
| 459 | Ga0307415_100122360 | |||
| 460 | Ga0307507_10036708 | |||
| 461 | Ga0307507_10087088 | |||
| 462 | Ga0307510_10100725 | |||
| 463 | Ga0373948_0001916 | |||
| 464 | Ga0395900_0907692 | |||
| 465 | Ga0395898_0009083 | |||
| 466 | Ga0395898_0167186 | |||
| 467 | Ga0436364_1531027 | |||
| 468 | Ga0395901_0116568 | |||
| 469 | Ga0395901_0262059 | |||
| 470 | Ga0400483_096313 | |||
| 471 | Ga0400483_248916 | |||
| 472 | Ga0451797_0050858 | |||
| 473 | Ga0451802_0674731 | |||
| 474 | Ga0451837_1334159 | |||
| 475 | Ga0451853_1165602 | |||
| 476 | Ga0450922_007557 | |||
| 477 | Ga0450899_000343 | |||
| 478 | Ga0450910_006814 | |||
| 479 | Ga0466969_0003387 | |||
| 480 | Ga0466965_0092504 | |||
| 481 | Ga0466966_0004730 | |||
| 482 | Ga0466966_0264360 | |||
| 483 | Ga0466961_0041805 | |||
| 484 | Ga0466961_0094550 | |||
| 485 | Ga0466963_0028185 | |||
| 486 | Ga0466963_0271930 | |||
| 487 | Ga0466963_0573216 | |||
| 488 | Ga0466971_0025047 | |||
| 489 | Ga0466968_0268345 | |||
| 490 | Ga0466970_0105419 | |||
| 491 | Ga0466957_0258618 | |||
| 492 | Ga0466960_0053705 | |||
| 493 | Ga0466960_0080045 | |||
| 494 | Ga0466960_0228580 | |||
| 495 | Ga0466959_0025464 | |||
| 496 | Ga0466959_0163551 | |||
| 497 | Ga0466958_0199726 | |||
| 498 | Ga0466967_0004427 | |||
| 499 | Ga0466967_0005544 | |||
| 500 | Ga0466967_0021959 | |||
| 501 | Ga0466967_0150129 | |||
| 502 | Ga0466967_0286571 | |||
| 503 | Ga0466967_0477992 | |||
| 504 | Ga0495592_0011698 | |||
| 505 | Ga0495592_0015206 | |||
| 506 | Ga0495638_0000247 | |||
| 507 | Ga0495651_0009449 | |||
| 508 | Ga0495653_0014031 | |||
| 509 | Ga0495580_0017272 | |||
| 510 | Ga0495662_0000200 | |||
| 511 | Ga0495662_0003419 | |||
| 512 | Ga0495664_0003316 | |||
| 513 | Ga0495585_0074583 | |||
| 514 | Ga0495594_0014491 | |||
| 515 | Ga0495583_0046336 | |||
| 516 | Ga0495606_0000715 | |||
| 517 | Ga0495608_0004230 | |||
| 518 | Ga0495618_0015862 | |||
| 519 | Ga0495628_0111249 | |||
| 520 | Ga0495666_0001368 | |||
| 521 | Ga0495666_0138319 | |||
| 522 | Ga0495652_0028983 | |||
| 523 | Ga0495665_0003140 | |||
| 524 | Ga0495640_0020210 | |||
| 525 | Ga0495586_0005753 | |||
| 526 | Ga0495645_0006169 | |||
| 527 | Ga0495667_0019132 | |||
| 528 | Ga0495668_0000197 | |||
| 529 | Ga0495634_0023213 | |||
| 530 | Ga0495625_0001354 | |||
| 531 | Ga0495625_0094223 | |||
| 532 | Ga0495625_0100700 | |||
| 533 | Ga0495635_0063773 | |||
| 534 | Ga0495657_0009209 | |||
| 535 | Ga0495657_0019776 | |||
| 536 | Ga0495657_0025269 | |||
| 537 | Ga0495657_0032158 | |||
| 538 | Ga0495623_0005116 | |||
| 539 | Ga0495613_0002237 | |||
| 540 | Ga0495613_0024819 | |||
| 541 | Ga0495613_0061025 | |||
| 542 | Ga0495613_0118908 | |||
| 543 | Ga0495589_0059145 | |||
| 544 | Ga0495600_0021298 | |||
| 545 | Ga0495600_0094811 | |||
| 546 | Ga0495604_0002194 | |||
| 547 | Ga0495636_0031678 | |||
| 548 | Ga0495674_0185608 | |||
| 549 | Ga0495674_0238790 | |||
| 550 | Ga0495676_0035247 | |||
| 551 | Ga0495687_014697 | |||
| 552 | Ga0495675_0002347 | |||
| 553 | Ga0495675_0026129 | |||
| 554 | Ga0495675_0139400 | |||
| 555 | Ga0495675_0198735 | |||
| 556 | Ga0495685_000961 | |||
| 557 | Ga0495681_0018260 | |||
| 558 | Ga0495593_0031336 | |||
| 559 | Ga0495626_0000025 | |||
| 560 | Ga0496102_0662321 | |||
| 561 | Ga0496104_0125161 | |||
| 562 | Ga0496106_0494334 | |||
| 563 | Ga0496109_0091812 | |||
| 564 | Ga0496109_0390489 | |||
| 565 | Ga0496112_0464732 | |||
| 566 | Ga0501031_0000154 | |||
| 567 | Ga0501031_0155301 | |||
| 568 | Ga0501031_0271309 | |||
| 569 | Ga0501032_0001420 | |||
| 570 | Ga0501033_0000278 | |||
| 571 | Ga0501033_0075386 | |||
| 572 | Ga0501034_0032968 | |||
| 573 | Ga0501034_0100710 | |||
| 574 | Ga0501034_0218131 | |||
| 575 | Ga0501036_0000264 | |||
| 576 | Ga0501036_0016401 | |||
| 577 | Ga0501037_0000231 | |||
| 578 | Ga0501037_0167824 | |||
| 579 | Ga0501038_0000901 | |||
| 580 | Ga0501038_0069555 | |||
| 581 | Ga0501039_0002992 | |||
| 582 | Ga0501039_0038861 | |||
| 583 | Ga0501039_0138406 | |||
| 584 | Ga0501040_0148397 | |||
| 585 | Ga0501041_0026969 | |||
| 586 | Ga0501041_0111369 | |||
| 587 | Ga0501042_0047000 | |||
| 588 | Ga0501042_0108438 | |||
| 589 | Ga0501042_0354171 | |||
| 590 | Ga0501042_0409604 | |||
| 591 | Ga0501043_0000263 | |||
| 592 | Ga0501046_0037260 | |||
| 593 | Ga0501046_0105512 | |||
| 594 | Ga0501047_0004451 | |||
| 595 | Ga0501048_0000103 | |||
| 596 | Ga0501048_0110881 | |||
| 597 | Ga0501067_0017047 | |||
| 598 | Ga0501067_0114806 | |||
| 599 | Ga0501068_0111656 | |||
| 600 | Ga0501069_0002141 | |||
| 601 | Ga0501070_0002144 | |||
| 602 | Ga0501070_0096721 | |||
| 603 | Ga0501070_0802540 | |||
| 604 | Ga0501071_0005048 | |||
| 605 | Ga0501071_0207338 | |||
| 606 | Ga0501071_0523889 | |||
| 607 | Ga0501072_0015498 | |||
| 608 | Ga0501072_0054692 | |||
| 609 | Ga0501072_0192295 | |||
| 610 | Ga0501072_0356492 | |||
| 611 | Ga0501073_0003921 | |||
| 612 | Ga0501074_0000185 | |||
| 613 | Ga0501074_0091377 | |||
| 614 | Ga0501074_0260036 | |||
| 615 | Ga0501075_0044307 | |||
| 616 | Ga0501075_0212697 | |||
| 617 | Ga0501075_0426518 | |||
| 618 | Ga0501079_0027000 | |||
| 619 | Ga0501079_0142615 | |||
| 620 | Ga0501080_0000349 | |||
| 621 | Ga0501080_0095088 | |||
| 622 | Ga0501081_0106635 | |||
| 623 | Ga0501081_0324303 | |||
| 624 | Ga0501083_0043172 | |||
| 625 | Ga0501083_0203314 | |||
| 626 | Ga0501035_0116738 | |||
| 627 | Ga0501035_0220688 | |||
| 628 | Ga0501035_0385455 | |||
| 629 | Ga0501044_0000922 | |||
| 630 | Ga0501044_0048561 | |||
| 631 | Ga0501044_0092453 | |||
| 632 | nmdc:mga03n38_140798_c1 | |||
| 633 | nmdc:mga03n38_215359_c1 | |||
| 634 | nmdc:mga03n38_31566_c1 | |||
| 635 | nmdc:mga00v17_12922_c1 | |||
| 636 | nmdc:mga00v17_182094_c1 | |||
| 637 | nmdc:mga00v17_58571_c1 | |||
| 638 | nmdc:mga0yw44_133300_c1 | |||
| 639 | nmdc:mga0yw44_275140_c1 | |||
| 640 | nmdc:mga0yw44_4499_c1 | |||
| 641 | nmdc:mga0yw44_492109_c1 | |||
| 642 | nmdc:mga0yw44_6321_c2 | |||
| 643 | nmdc:mga0yw44_77011_c1 | |||
| 644 | nmdc:mga06z11_287869_c1 | |||
| 645 | nmdc:mga04h51_51040_c1 | |||
| 646 | nmdc:mga07m45_142428_c1 | |||
| 647 | nmdc:mga09592_236822_c1 | |||
| 648 | nmdc:mga09592_290215_c1 | |||
| 649 | nmdc:mga0qj67_259219_c1 | |||
| 650 | nmdc:mga06r32_73364_c1 | |||
| 651 | nmdc:mga06r32_73542_c1 | |||
| 652 | nmdc:mga08y16_138991_c1 | |||
| 653 | Ga0495601_0012197 | |||
| 654 | Ga0495619_0027999 | |||
| 655 | Ga0500560_004303 | |||
| 656 | Ga0500569_000008 | |||
| 657 | Ga0500573_0084976 | |||
| 658 | Ga0500573_0088308 | |||
| 659 | Ga0500573_0167092 | |||
| 660 | Ga0500588_0000115 | |||
| 661 | Ga0500616_0000506 | |||
| 662 | Ga0501084_0000908 | |||
| 663 | Ga0501084_0134379 | |||
| 664 | Ga0501082_0066304 | |||
| 665 | Ga0501082_0176764 | |||
| 666 | Ga0501082_0820840 | |||
| 667 | Ga0466962_0123284 | |||
| 668 | Ga0530510_0200049 | |||
| 669 | 2990063930 | |||
| 670 | 2585315877 | |||
| 671 | 2620352765 | |||
| 672 | 2643826729 | |||
| 673 | 2644534085 | |||
| 674 | 2739240247 | |||
| 675 | 2768642095 | |||
| 676 | 2785342204 | |||
| 677 | 2791910097 | |||
| 678 | 2791916152 | |||
| 679 | 2793981543 | |||
| 680 | 2795786796 | |||
| 681 | 2819698236 | |||
| 682 | 2862389616 | |||
| 683 | 2862580504 | |||
| 684 | 2867372902 | |||
| 685 | 2868091037 | |||
| 686 | 2883822181 | |||
| 687 | 2891402368 | |||
| 688 | 2891570001 | |||
| 689 | 2910812244 | |||
| 690 | 2939749081 | |||
| 691 | 3003001207 | |||
| 692 | 3003002055 | |||
| 693 | 8003322898 | |||
| 694 | 8008566201 | |||
| 695 | 8008581653 | |||
| 696 | 8023629413 | |||
| 697 | 8047900981 | |||
| 698 | 8048357920 | |||
| 699 | 8048377923 | |||
| 700 | 8048387021 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.944 | 14 | 237 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9435 | 13 | 234 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9434 | 12 | 228 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9406 | 13 | 233 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9387 | 13 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9624 | 12 | 234 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9501 | 13 | 246 | 3.40.50.300 |
| af_Q2G167_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9495 | 14 | 237 | 3.40.50.300 |
| af_P0A9T8_2_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9423 | 10 | 234 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9416 | 12 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3P1WHQ0-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9928 | 11 | 248 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-C0GFN8-F1-model_v4 | ABC transporter related protein | 0.978 | 49 | 231 |
GO:0005524
GO:0016887 |
| AF-A0A4P8II76-F1-model_v4 | ABC transporter ATP-binding protein | 0.9751 | 9 | 231 |
GO:0005524
GO:0016887 |
| AF-A0A7V9TM51-F1-model_v4 | ABC transporter ATP-binding protein | 0.9684 | 32 | 235 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A2S9BY69-F1-model_v4 | deleted | 0.9669 | 5 | 248 |
|