F418460

General Info

Members Datasets Scaffolds Average Seq Length
350 232 700 249

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990063930
Length 282
Sequence ETAQMNAAGAEPAGTEGGARGARGGARGAGVAAVRVRALRRSYGEVVALDGVDLAFGAGTFTAVMGPSGSGKSTLLQCAAGLDRPSGGTVRVDGVELAGLSERRLTLLRRERIGFVFQAFNLLPALTAAQNVALPLRLARRRPSRAAVRESLARVGLAERAGHRPDQLSGGQQQRVALARALITRPAVLFGDEPTGALDTTTIREVLCLLRELVDREGQTTVMVTHDPVAASYADRVVFLVDGRVSGELARPSAEGVAAHMAGLESAAAGAGDDAVVGGVTC

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
92 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
93 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
195 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
204 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
205 2619619003 Frankia sp. CpI1-P Isolate Nodule
206 2643221561 Nocardioides sp. Root151 Isolate Unclassified
207 2643221696 Nocardioides sp. Root140 Isolate Unclassified
208 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
209 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
210 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
211 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
212 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
213 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
214 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
215 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
216 2862574272 Streptomyces sp. AcE210 Isolate Nodule
217 2867369537 Streptomyces sp. Z26 Isolate Unclassified
218 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
219 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
220 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
221 2891562705 Microbispora tritici MT50 Isolate Unclassified
222 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
223 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
224 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
225 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
226 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
227 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
228 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
229 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
230 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
231 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
232 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.86
Metatranscriptomes 0
Isolates 9.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 1.14
Rhizoplane 2.57
Rhizosphere 78.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004408 3300003203 Bacteria 6557
2 Ga0070683_100103783 3300005329 Bacteria 2679
3 Ga0070680_100255839 3300005336 Bacteria 1481
4 Ga0070691_10054155 3300005341 Bacteria 1920
5 Ga0070692_10103199 3300005345 Bacteria 1566
6 Ga0070668_100000543 3300005347 Bacteria 25223
7 Ga0070668_100003083 3300005347 Bacteria 12318
8 Ga0070668_100104114 3300005347 Bacteria 2252
9 Ga0070674_100046950 3300005356 Bacteria 2957
10 Ga0070674_100126279 3300005356 Bacteria 1901
11 Ga0070714_100826097 3300005435 Bacteria 898
12 Ga0070713_100010280 3300005436 Bacteria 6755
13 Ga0070700_100015294 3300005441 Bacteria 4348
14 Ga0070662_100100224 3300005457 Bacteria 2191
15 Ga0070706_100307001 3300005467 Bacteria 1480
16 Ga0070707_100002823 3300005468 Bacteria 16528
17 Ga0070707_100035570 3300005468 Bacteria 4751
18 Ga0070672_100184276 3300005543 Bacteria 1741
19 Ga0070665_100362344 3300005548 Bacteria 1456
20 Ga0070664_100041117 3300005564 Bacteria 3900
21 Ga0070664_100203912 3300005564 Bacteria 1766
22 Ga0068857_100114538 3300005577 Bacteria 2425
23 Ga0068861_100097373 3300005719 Bacteria 2333
24 Ga0068860_100000393 3300005843 Bacteria 57188
25 Ga0068860_100315361 3300005843 Bacteria 1534
26 Ga0081455_10130708 3300005937 Bacteria 1963
27 Ga0081455_10153034 3300005937 Bacteria 1776
28 Ga0081538_10000241 3300005981 Bacteria 61996
29 Ga0081538_10000962 3300005981 Bacteria 30790
30 Ga0081539_10000479 3300005985 Bacteria 84481
31 Ga0081539_10004206 3300005985 Bacteria 16247
32 Ga0070717_10009819 3300006028 Bacteria 7207
33 Ga0075365_10013260 3300006038 Bacteria 4918
34 Ga0075365_10023227 3300006038 Bacteria 3898
35 Ga0075365_10023815 3300006038 Bacteria 3854
36 Ga0075365_10040035 3300006038 Bacteria 3054
37 Ga0075365_10059715 3300006038 Bacteria 2542
38 Ga0075365_10363323 3300006038 Bacteria 1021
39 Ga0075368_10066119 3300006042 Bacteria 1453
40 Ga0075363_100020537 3300006048 Bacteria 3314
41 Ga0075363_100060021 3300006048 Bacteria 2046
42 Ga0075363_100145505 3300006048 Bacteria 1336
43 Ga0075364_10022209 3300006051 Bacteria 4004
44 Ga0075364_10032455 3300006051 Bacteria 3357
45 Ga0075364_10078134 3300006051 Bacteria 2185
46 Ga0075362_10004403 3300006177 Bacteria 5057
47 Ga0075430_100160685 3300006846 Bacteria 1870
48 Ga0075431_100088110 3300006847 Bacteria 3203
49 Ga0068865_100334863 3300006881 Bacteria 1221
50 Ga0105251_10078803 3300009011 Bacteria 1525
51 Ga0105240_10028657 3300009093 Bacteria 7268
52 Ga0114129_10460150 3300009147 Bacteria 1667
53 Ga0105241_10627460 3300009174 Bacteria 974
54 Ga0105238_10324161 3300009551 Bacteria 1527
55 Ga0105249_10223323 3300009553 Bacteria 1855
56 Ga0157372_10000006 3300013307 Bacteria 354669
57 Ga0157372_10928594 3300013307 Bacteria 1009
58 Ga0157380_10150695 3300014326 Bacteria 2010
59 Ga0157380_10273238 3300014326 Bacteria 1542
60 Ga0209758_1001084 3300025297 Bacteria 35344
61 Ga0207426_1022476 3300025302 Bacteria 2164
62 Ga0209051_1029261 3300025303 Bacteria 2159
63 Ga0207695_10032544 3300025913 Bacteria 5704
64 Ga0207660_10286444 3300025917 Bacteria 1309
65 Ga0207652_10622404 3300025921 Bacteria 967
66 Ga0207646_10003708 3300025922 Bacteria 17046
67 Ga0207694_10221676 3300025924 Bacteria 1543
68 Ga0207687_10240767 3300025927 Bacteria 1434
69 Ga0207700_10006590 3300025928 Bacteria 7030
70 Ga0207690_10451814 3300025932 Bacteria 1033
71 Ga0207669_10107946 3300025937 Bacteria 1858
72 Ga0207704_10069464 3300025938 Bacteria 2226
73 Ga0207691_10027488 3300025940 Bacteria 5333
74 Ga0207689_10238199 3300025942 Bacteria 1504
75 Ga0207661_10152433 3300025944 Bacteria 1999
76 Ga0207661_10174381 3300025944 Bacteria 1874
77 Ga0207679_10022570 3300025945 Bacteria 4288
78 Ga0207712_10329849 3300025961 Bacteria 1262
79 Ga0207668_10000408 3300025972 Bacteria 27061
80 Ga0207668_10000669 3300025972 Bacteria 21064
81 Ga0207640_10031837 3300025981 Bacteria 3264
82 Ga0207658_10323675 3300025986 Bacteria 1335
83 Ga0207678_10001638 3300026067 Bacteria 20520
84 Ga0207678_10014747 3300026067 Bacteria 6877
85 Ga0207708_10004380 3300026075 Bacteria 10403
86 Ga0207674_10135025 3300026116 Bacteria 2429
87 Ga0207674_10136925 3300026116 Bacteria 2410
88 Ga0207675_100171708 3300026118 Bacteria 2073
89 Ga0207698_10172813 3300026142 Bacteria 1905
90 Ga0209813_10060613 3300027866 Bacteria 1207
91 Ga0207428_10212749 3300027907 Bacteria 1452
92 Ga0268266_10080298 3300028379 Bacteria 2842
93 Ga0268266_10569374 3300028379 Bacteria 1087
94 Ga0268264_10000468 3300028381 Bacteria 54851
95 Ga0268264_10064223 3300028381 Bacteria 3089
96 Ga0265338_10011809 3300028800 Bacteria 10038
97 Ga0265327_10143552 3300031251 Bacteria 1114
98 Ga0316576_10025176 3300031727 Bacteria 4163
99 Ga0307405_10193022 3300031731 Bacteria 1472
100 Ga0307405_10322947 3300031731 Bacteria 1180
101 Ga0307413_10367561 3300031824 Bacteria 1116
102 Ga0307413_10549784 3300031824 Bacteria 936
103 Ga0307410_10050969 3300031852 Bacteria 2787
104 Ga0307409_100135116 3300031995 Bacteria 2115
105 Ga0307409_100199068 3300031995 Bacteria 1790
106 Ga0307409_100473734 3300031995 Bacteria 1213
107 Ga0307416_100073673 3300032002 Bacteria 2848
108 Ga0307415_100017105 3300032126 Bacteria 4340
109 Ga0307415_100122360 3300032126 Bacteria 1954
110 Ga0307507_10036708 3300033179 Bacteria 5004
111 Ga0307507_10087088 3300033179 Bacteria 2702
112 Ga0307510_10100725 3300033180 Bacteria 2680
113 Ga0373948_0001916 3300034817 Bacteria 2987
114 Ga0395900_0907692 3300037418 Bacteria 804
115 Ga0395898_0009083 3300037466 Bacteria 10469
116 Ga0395898_0167186 3300037466 Bacteria 2103
117 Ga0436364_1531027 3300037853 Bacteria 5637
118 Ga0395901_0116568 3300038443 Bacteria 2806
119 Ga0395901_0262059 3300038443 Bacteria 1799
120 Ga0400483_096313 3300039062 Bacteria 2781
121 Ga0400483_248916 3300039062 Bacteria 3448
122 Ga0451797_0050858 3300041453 Bacteria 2485
123 Ga0451802_0674731 3300041460 Bacteria 1389
124 Ga0451837_1334159 3300041494 Bacteria 1417
125 Ga0451853_1165602 3300041512 Bacteria 10600
126 Ga0450922_007557 3300042124 Bacteria 1021
127 Ga0450899_000343 3300042135 Bacteria 5140
128 Ga0450910_006814 3300042147 Bacteria 1583
129 Ga0466969_0003387 3300044656 Bacteria 8487
130 Ga0466965_0092504 3300044683 Bacteria 1540
131 Ga0466966_0004730 3300044684 Bacteria 8955
132 Ga0466966_0264360 3300044684 Bacteria 1036
133 Ga0466961_0041805 3300044693 Bacteria 2939
134 Ga0466961_0094550 3300044693 Bacteria 1886
135 Ga0466963_0028185 3300044694 Bacteria 3603
136 Ga0466963_0271930 3300044694 Bacteria 1190
137 Ga0466963_0573216 3300044694 Bacteria 797
138 Ga0466971_0025047 3300044719 Bacteria 2665
139 Ga0466968_0268345 3300044735 Bacteria 814
140 Ga0466970_0105419 3300044765 Bacteria 1537
141 Ga0466957_0258618 3300044842 Bacteria 1159
142 Ga0466960_0053705 3300044901 Bacteria 1953
143 Ga0466960_0080045 3300044901 Bacteria 1644
144 Ga0466960_0228580 3300044901 Bacteria 1026
145 Ga0466959_0025464 3300045049 Bacteria 4384
146 Ga0466959_0163551 3300045049 Bacteria 1564
147 Ga0466958_0199726 3300045836 Bacteria 1272
148 Ga0466967_0004427 3300045976 Bacteria 9467
149 Ga0466967_0005544 3300045976 Bacteria 8762
150 Ga0466967_0021959 3300045976 Bacteria 5197
151 Ga0466967_0150129 3300045976 Bacteria 2177
152 Ga0466967_0286571 3300045976 Bacteria 1581
153 Ga0466967_0477992 3300045976 Bacteria 1220
154 Ga0495592_0011698 3300046454 Bacteria 6647
155 Ga0495592_0015206 3300046454 Bacteria 5844
156 Ga0495638_0000247 3300046460 Bacteria 73629
157 Ga0495651_0009449 3300046462 Bacteria 7489
158 Ga0495653_0014031 3300046463 Bacteria 6532
159 Ga0495580_0017272 3300046472 Bacteria 5401
160 Ga0495662_0000200 3300046476 Bacteria 24779
161 Ga0495662_0003419 3300046476 Bacteria 8045
162 Ga0495664_0003316 3300046477 Bacteria 8751
163 Ga0495585_0074583 3300046492 Bacteria 1846
164 Ga0495594_0014491 3300046499 Bacteria 4133
165 Ga0495583_0046336 3300046506 Bacteria 2005
166 Ga0495606_0000715 3300046507 Bacteria 51355
167 Ga0495608_0004230 3300046511 Bacteria 10290
168 Ga0495618_0015862 3300046514 Bacteria 4599
169 Ga0495628_0111249 3300046516 Bacteria 2106
170 Ga0495666_0001368 3300046526 Bacteria 11822
171 Ga0495666_0138319 3300046526 Bacteria 1136
172 Ga0495652_0028983 3300046529 Bacteria 4863
173 Ga0495665_0003140 3300046531 Bacteria 8943
174 Ga0495640_0020210 3300046533 Bacteria 4904
175 Ga0495586_0005753 3300046535 Bacteria 6629
176 Ga0495645_0006169 3300046543 Bacteria 8300
177 Ga0495667_0019132 3300046559 Bacteria 4621
178 Ga0495668_0000197 3300046616 Bacteria 88776
179 Ga0495634_0023213 3300046642 Bacteria 4362
180 Ga0495625_0001354 3300046660 Bacteria 30220
181 Ga0495625_0094223 3300046660 Bacteria 2066
182 Ga0495625_0100700 3300046660 Bacteria 1986
183 Ga0495635_0063773 3300046663 Bacteria 2530
184 Ga0495657_0009209 3300046675 Bacteria 7493
185 Ga0495657_0019776 3300046675 Bacteria 4854
186 Ga0495657_0025269 3300046675 Bacteria 4221
187 Ga0495657_0032158 3300046675 Bacteria 3664
188 Ga0495623_0005116 3300046679 Bacteria 8605
189 Ga0495613_0002237 3300046689 Bacteria 14644
190 Ga0495613_0024819 3300046689 Bacteria 4467
191 Ga0495613_0061025 3300046689 Bacteria 2761
192 Ga0495613_0118908 3300046689 Bacteria 1898
193 Ga0495589_0059145 3300046794 Bacteria 1884
194 Ga0495600_0021298 3300046809 Bacteria 4149
195 Ga0495600_0094811 3300046809 Bacteria 1946
196 Ga0495604_0002194 3300047317 Bacteria 15634
197 Ga0495636_0031678 3300047318 Bacteria 2168
198 Ga0495674_0185608 3300047319 Bacteria 1730
199 Ga0495674_0238790 3300047319 Bacteria 1498
200 Ga0495676_0035247 3300047321 Bacteria 4187
201 Ga0495687_014697 3300047443 Bacteria 4014
202 Ga0495675_0002347 3300047444 Bacteria 11295
203 Ga0495675_0026129 3300047444 Bacteria 3722
204 Ga0495675_0139400 3300047444 Bacteria 1504
205 Ga0495675_0198735 3300047444 Bacteria 1221
206 Ga0495685_000961 3300047447 Bacteria 8708
207 Ga0495681_0018260 3300047470 Bacteria 3867
208 Ga0495593_0031336 3300047673 Bacteria 2905
209 Ga0495626_0000025 3300048091 Bacteria 209356
210 Ga0496102_0662321 3300048905 Bacteria 967
211 Ga0496104_0125161 3300048907 Bacteria 2468
212 Ga0496106_0494334 3300048909 Bacteria 983
213 Ga0496109_0091812 3300048912 Bacteria 2808
214 Ga0496109_0390489 3300048912 Bacteria 1315
215 Ga0496112_0464732 3300048915 Bacteria 1203
216 Ga0501031_0000154 3300049568 Bacteria 38960
217 Ga0501031_0155301 3300049568 Bacteria 1495
218 Ga0501031_0271309 3300049568 Bacteria 1101
219 Ga0501032_0001420 3300049569 Bacteria 19022
220 Ga0501033_0000278 3300049570 Bacteria 49428
221 Ga0501033_0075386 3300049570 Bacteria 2476
222 Ga0501034_0032968 3300049571 Bacteria 5259
223 Ga0501034_0100710 3300049571 Bacteria 2883
224 Ga0501034_0218131 3300049571 Bacteria 1861
225 Ga0501036_0000264 3300049572 Bacteria 35768
226 Ga0501036_0016401 3300049572 Bacteria 6188
227 Ga0501037_0000231 3300049573 Bacteria 48188
228 Ga0501037_0167824 3300049573 Bacteria 1562
229 Ga0501038_0000901 3300049574 Bacteria 26334
230 Ga0501038_0069555 3300049574 Bacteria 2990
231 Ga0501039_0002992 3300049575 Bacteria 12645
232 Ga0501039_0038861 3300049575 Bacteria 3675
233 Ga0501039_0138406 3300049575 Bacteria 1912
234 Ga0501040_0148397 3300049576 Bacteria 1653
235 Ga0501041_0026969 3300049577 Bacteria 3460
236 Ga0501041_0111369 3300049577 Bacteria 1698
237 Ga0501042_0047000 3300049578 Bacteria 3077
238 Ga0501042_0108438 3300049578 Bacteria 1999
239 Ga0501042_0354171 3300049578 Bacteria 1062
240 Ga0501042_0409604 3300049578 Bacteria 982
241 Ga0501043_0000263 3300049579 Bacteria 47686
242 Ga0501046_0037260 3300049580 Bacteria 3908
243 Ga0501046_0105512 3300049580 Bacteria 2158
244 Ga0501047_0004451 3300049581 Bacteria 13192
245 Ga0501048_0000103 3300049582 Bacteria 46821
246 Ga0501048_0110881 3300049582 Bacteria 1937
247 Ga0501067_0017047 3300049583 Bacteria 4014
248 Ga0501067_0114806 3300049583 Bacteria 1498
249 Ga0501068_0111656 3300049584 Bacteria 1700
250 Ga0501069_0002141 3300049585 Bacteria 9945
251 Ga0501070_0002144 3300049586 Bacteria 17333
252 Ga0501070_0096721 3300049586 Bacteria 2443
253 Ga0501070_0802540 3300049586 Bacteria 739
254 Ga0501071_0005048 3300049587 Bacteria 8443
255 Ga0501071_0207338 3300049587 Bacteria 1473
256 Ga0501071_0523889 3300049587 Bacteria 909
257 Ga0501072_0015498 3300049588 Bacteria 5842
258 Ga0501072_0054692 3300049588 Bacteria 3145
259 Ga0501072_0192295 3300049588 Bacteria 1627
260 Ga0501072_0356492 3300049588 Bacteria 1161
261 Ga0501073_0003921 3300049589 Bacteria 11172
262 Ga0501074_0000185 3300049590 Bacteria 33746
263 Ga0501074_0091377 3300049590 Bacteria 2180
264 Ga0501074_0260036 3300049590 Bacteria 1234
265 Ga0501075_0044307 3300049591 Bacteria 3338
266 Ga0501075_0212697 3300049591 Bacteria 1475
267 Ga0501075_0426518 3300049591 Bacteria 1011
268 Ga0501079_0027000 3300049741 Bacteria 4401
269 Ga0501079_0142615 3300049741 Bacteria 1866
270 Ga0501080_0000349 3300049742 Bacteria 35411
271 Ga0501080_0095088 3300049742 Bacteria 2767
272 Ga0501081_0106635 3300049743 Bacteria 1986
273 Ga0501081_0324303 3300049743 Bacteria 1132
274 Ga0501083_0043172 3300049744 Bacteria 3055
275 Ga0501083_0203314 3300049744 Bacteria 1292
276 Ga0501035_0116738 3300049822 Bacteria 2335
277 Ga0501035_0220688 3300049822 Bacteria 1619
278 Ga0501035_0385455 3300049822 Bacteria 1168
279 Ga0501044_0000922 3300049823 Bacteria 35394
280 Ga0501044_0048561 3300049823 Bacteria 4383
281 Ga0501044_0092453 3300049823 Bacteria 3051
282 nmdc:mga03n38_140798_c1 3300050490 Bacteria 1204
283 nmdc:mga03n38_215359_c1 3300050490 Bacteria 1000
284 nmdc:mga03n38_31566_c1 3300050490 Bacteria 2236
285 nmdc:mga00v17_12922_c1 3300050491 Bacteria 4622
286 nmdc:mga00v17_182094_c1 3300050491 Bacteria 1356
287 nmdc:mga00v17_58571_c1 3300050491 Bacteria 2360
288 nmdc:mga0yw44_133300_c1 3300050492 Bacteria 1610
289 nmdc:mga0yw44_275140_c1 3300050492 Bacteria 1124
290 nmdc:mga0yw44_4499_c1 3300050492 Bacteria 6406
291 nmdc:mga0yw44_492109_c1 3300050492 Bacteria 832
292 nmdc:mga0yw44_6321_c2 3300050492 Bacteria 4028
293 nmdc:mga0yw44_77011_c1 3300050492 Bacteria 2083
294 nmdc:mga06z11_287869_c1 3300050494 Bacteria 974
295 nmdc:mga04h51_51040_c1 3300050495 Bacteria 1388
296 nmdc:mga07m45_142428_c1 3300050496 Bacteria 1388
297 nmdc:mga09592_236822_c1 3300050508 Bacteria 1581
298 nmdc:mga09592_290215_c1 3300050508 Bacteria 1418
299 nmdc:mga0qj67_259219_c1 3300050509 Bacteria 1410
300 nmdc:mga06r32_73364_c1 3300050510 Bacteria 3315
301 nmdc:mga06r32_73542_c1 3300050510 Bacteria 3311
302 nmdc:mga08y16_138991_c1 3300050511 Bacteria 2525
303 Ga0495601_0012197 3300053077 Bacteria 5153
304 Ga0495619_0027999 3300053085 Bacteria 3633
305 Ga0500560_004303 3300053107 Bacteria 3013
306 Ga0500569_000008 3300053109 Bacteria 73629
307 Ga0500573_0084976 3300053140 Bacteria 1795
308 Ga0500573_0088308 3300053140 Bacteria 1754
309 Ga0500573_0167092 3300053140 Bacteria 1193
310 Ga0500588_0000115 3300053146 Bacteria 10600
311 Ga0500616_0000506 3300053153 Bacteria 49867
312 Ga0501084_0000908 3300054114 Bacteria 22886
313 Ga0501084_0134379 3300054114 Bacteria 2082
314 Ga0501082_0066304 3300060353 Bacteria 3109
315 Ga0501082_0176764 3300060353 Bacteria 1856
316 Ga0501082_0820840 3300060353 Bacteria 813
317 Ga0466962_0123284 3300061719 Bacteria 1251
318 Ga0530510_0200049 3300061734 Bacteria 1483
319 2990063930 2990059506 Bacteria 9321252
320 2585315877 2582581314 Bacteria 11452267
321 2620352765 2619619003 Bacteria 7619552
322 2643826729 2643221561 Bacteria 4984412
323 2644534085 2643221696 Bacteria 5431823
324 2739240247 2738543011 Bacteria 5731169
325 2768642095 2767802112 Bacteria 6465194
326 2785342204 2784746763 Bacteria 9783172
327 2791910097 2791354901 Bacteria 8322202
328 2791916152 2791354901 Bacteria 8322202
329 2793981543 2791355406 Bacteria 11364898
330 2795786796 2795385470 Bacteria 8317180
331 2819698236 2818991463 Bacteria 7948711
332 2862389616 2862382967 Bacteria 10317375
333 2862580504 2862574272 Bacteria 10567477
334 2867372902 2867369537 Bacteria 6501581
335 2868091037 2868088558 Bacteria 7609351
336 2883822181 2883821847 Bacteria 5121194
337 2891402368 2891395885 Bacteria 9251614
338 2891570001 2891562705 Bacteria 8039471
339 2910812244 2910809715 Bacteria 4982797
340 2939749081 2939743619 Bacteria 5762299
341 3003001207 3002998708 Bacteria 11715108
342 3003002055 3002998708 Bacteria 11715108
343 8003322898 8003314358 Bacteria 10575343
344 8008566201 8008558824 Bacteria 10610750
345 8008581653 8008574985 Bacteria 7815457
346 8023629413 8023623736 Bacteria 8593882
347 8047900981 8047893842 Bacteria 11723082
348 8048357920 8048356638 Bacteria 11044339
349 8048377923 8048369669 Bacteria 11666822
350 8048387021 8048379754 Bacteria 11877923
351 JGI25406J46586_10004408
352 Ga0070683_100103783
353 Ga0070680_100255839
354 Ga0070691_10054155
355 Ga0070692_10103199
356 Ga0070668_100000543
357 Ga0070668_100003083
358 Ga0070668_100104114
359 Ga0070674_100046950
360 Ga0070674_100126279
361 Ga0070714_100826097
362 Ga0070713_100010280
363 Ga0070700_100015294
364 Ga0070662_100100224
365 Ga0070706_100307001
366 Ga0070707_100002823
367 Ga0070707_100035570
368 Ga0070672_100184276
369 Ga0070665_100362344
370 Ga0070664_100041117
371 Ga0070664_100203912
372 Ga0068857_100114538
373 Ga0068861_100097373
374 Ga0068860_100000393
375 Ga0068860_100315361
376 Ga0081455_10130708
377 Ga0081455_10153034
378 Ga0081538_10000241
379 Ga0081538_10000962
380 Ga0081539_10000479
381 Ga0081539_10004206
382 Ga0070717_10009819
383 Ga0075365_10013260
384 Ga0075365_10023227
385 Ga0075365_10023815
386 Ga0075365_10040035
387 Ga0075365_10059715
388 Ga0075365_10363323
389 Ga0075368_10066119
390 Ga0075363_100020537
391 Ga0075363_100060021
392 Ga0075363_100145505
393 Ga0075364_10022209
394 Ga0075364_10032455
395 Ga0075364_10078134
396 Ga0075362_10004403
397 Ga0075430_100160685
398 Ga0075431_100088110
399 Ga0068865_100334863
400 Ga0105251_10078803
401 Ga0105240_10028657
402 Ga0114129_10460150
403 Ga0105241_10627460
404 Ga0105238_10324161
405 Ga0105249_10223323
406 Ga0157372_10000006
407 Ga0157372_10928594
408 Ga0157380_10150695
409 Ga0157380_10273238
410 Ga0209758_1001084
411 Ga0207426_1022476
412 Ga0209051_1029261
413 Ga0207695_10032544
414 Ga0207660_10286444
415 Ga0207652_10622404
416 Ga0207646_10003708
417 Ga0207694_10221676
418 Ga0207687_10240767
419 Ga0207700_10006590
420 Ga0207690_10451814
421 Ga0207669_10107946
422 Ga0207704_10069464
423 Ga0207691_10027488
424 Ga0207689_10238199
425 Ga0207661_10152433
426 Ga0207661_10174381
427 Ga0207679_10022570
428 Ga0207712_10329849
429 Ga0207668_10000408
430 Ga0207668_10000669
431 Ga0207640_10031837
432 Ga0207658_10323675
433 Ga0207678_10001638
434 Ga0207678_10014747
435 Ga0207708_10004380
436 Ga0207674_10135025
437 Ga0207674_10136925
438 Ga0207675_100171708
439 Ga0207698_10172813
440 Ga0209813_10060613
441 Ga0207428_10212749
442 Ga0268266_10080298
443 Ga0268266_10569374
444 Ga0268264_10000468
445 Ga0268264_10064223
446 Ga0265338_10011809
447 Ga0265327_10143552
448 Ga0316576_10025176
449 Ga0307405_10193022
450 Ga0307405_10322947
451 Ga0307413_10367561
452 Ga0307413_10549784
453 Ga0307410_10050969
454 Ga0307409_100135116
455 Ga0307409_100199068
456 Ga0307409_100473734
457 Ga0307416_100073673
458 Ga0307415_100017105
459 Ga0307415_100122360
460 Ga0307507_10036708
461 Ga0307507_10087088
462 Ga0307510_10100725
463 Ga0373948_0001916
464 Ga0395900_0907692
465 Ga0395898_0009083
466 Ga0395898_0167186
467 Ga0436364_1531027
468 Ga0395901_0116568
469 Ga0395901_0262059
470 Ga0400483_096313
471 Ga0400483_248916
472 Ga0451797_0050858
473 Ga0451802_0674731
474 Ga0451837_1334159
475 Ga0451853_1165602
476 Ga0450922_007557
477 Ga0450899_000343
478 Ga0450910_006814
479 Ga0466969_0003387
480 Ga0466965_0092504
481 Ga0466966_0004730
482 Ga0466966_0264360
483 Ga0466961_0041805
484 Ga0466961_0094550
485 Ga0466963_0028185
486 Ga0466963_0271930
487 Ga0466963_0573216
488 Ga0466971_0025047
489 Ga0466968_0268345
490 Ga0466970_0105419
491 Ga0466957_0258618
492 Ga0466960_0053705
493 Ga0466960_0080045
494 Ga0466960_0228580
495 Ga0466959_0025464
496 Ga0466959_0163551
497 Ga0466958_0199726
498 Ga0466967_0004427
499 Ga0466967_0005544
500 Ga0466967_0021959
501 Ga0466967_0150129
502 Ga0466967_0286571
503 Ga0466967_0477992
504 Ga0495592_0011698
505 Ga0495592_0015206
506 Ga0495638_0000247
507 Ga0495651_0009449
508 Ga0495653_0014031
509 Ga0495580_0017272
510 Ga0495662_0000200
511 Ga0495662_0003419
512 Ga0495664_0003316
513 Ga0495585_0074583
514 Ga0495594_0014491
515 Ga0495583_0046336
516 Ga0495606_0000715
517 Ga0495608_0004230
518 Ga0495618_0015862
519 Ga0495628_0111249
520 Ga0495666_0001368
521 Ga0495666_0138319
522 Ga0495652_0028983
523 Ga0495665_0003140
524 Ga0495640_0020210
525 Ga0495586_0005753
526 Ga0495645_0006169
527 Ga0495667_0019132
528 Ga0495668_0000197
529 Ga0495634_0023213
530 Ga0495625_0001354
531 Ga0495625_0094223
532 Ga0495625_0100700
533 Ga0495635_0063773
534 Ga0495657_0009209
535 Ga0495657_0019776
536 Ga0495657_0025269
537 Ga0495657_0032158
538 Ga0495623_0005116
539 Ga0495613_0002237
540 Ga0495613_0024819
541 Ga0495613_0061025
542 Ga0495613_0118908
543 Ga0495589_0059145
544 Ga0495600_0021298
545 Ga0495600_0094811
546 Ga0495604_0002194
547 Ga0495636_0031678
548 Ga0495674_0185608
549 Ga0495674_0238790
550 Ga0495676_0035247
551 Ga0495687_014697
552 Ga0495675_0002347
553 Ga0495675_0026129
554 Ga0495675_0139400
555 Ga0495675_0198735
556 Ga0495685_000961
557 Ga0495681_0018260
558 Ga0495593_0031336
559 Ga0495626_0000025
560 Ga0496102_0662321
561 Ga0496104_0125161
562 Ga0496106_0494334
563 Ga0496109_0091812
564 Ga0496109_0390489
565 Ga0496112_0464732
566 Ga0501031_0000154
567 Ga0501031_0155301
568 Ga0501031_0271309
569 Ga0501032_0001420
570 Ga0501033_0000278
571 Ga0501033_0075386
572 Ga0501034_0032968
573 Ga0501034_0100710
574 Ga0501034_0218131
575 Ga0501036_0000264
576 Ga0501036_0016401
577 Ga0501037_0000231
578 Ga0501037_0167824
579 Ga0501038_0000901
580 Ga0501038_0069555
581 Ga0501039_0002992
582 Ga0501039_0038861
583 Ga0501039_0138406
584 Ga0501040_0148397
585 Ga0501041_0026969
586 Ga0501041_0111369
587 Ga0501042_0047000
588 Ga0501042_0108438
589 Ga0501042_0354171
590 Ga0501042_0409604
591 Ga0501043_0000263
592 Ga0501046_0037260
593 Ga0501046_0105512
594 Ga0501047_0004451
595 Ga0501048_0000103
596 Ga0501048_0110881
597 Ga0501067_0017047
598 Ga0501067_0114806
599 Ga0501068_0111656
600 Ga0501069_0002141
601 Ga0501070_0002144
602 Ga0501070_0096721
603 Ga0501070_0802540
604 Ga0501071_0005048
605 Ga0501071_0207338
606 Ga0501071_0523889
607 Ga0501072_0015498
608 Ga0501072_0054692
609 Ga0501072_0192295
610 Ga0501072_0356492
611 Ga0501073_0003921
612 Ga0501074_0000185
613 Ga0501074_0091377
614 Ga0501074_0260036
615 Ga0501075_0044307
616 Ga0501075_0212697
617 Ga0501075_0426518
618 Ga0501079_0027000
619 Ga0501079_0142615
620 Ga0501080_0000349
621 Ga0501080_0095088
622 Ga0501081_0106635
623 Ga0501081_0324303
624 Ga0501083_0043172
625 Ga0501083_0203314
626 Ga0501035_0116738
627 Ga0501035_0220688
628 Ga0501035_0385455
629 Ga0501044_0000922
630 Ga0501044_0048561
631 Ga0501044_0092453
632 nmdc:mga03n38_140798_c1
633 nmdc:mga03n38_215359_c1
634 nmdc:mga03n38_31566_c1
635 nmdc:mga00v17_12922_c1
636 nmdc:mga00v17_182094_c1
637 nmdc:mga00v17_58571_c1
638 nmdc:mga0yw44_133300_c1
639 nmdc:mga0yw44_275140_c1
640 nmdc:mga0yw44_4499_c1
641 nmdc:mga0yw44_492109_c1
642 nmdc:mga0yw44_6321_c2
643 nmdc:mga0yw44_77011_c1
644 nmdc:mga06z11_287869_c1
645 nmdc:mga04h51_51040_c1
646 nmdc:mga07m45_142428_c1
647 nmdc:mga09592_236822_c1
648 nmdc:mga09592_290215_c1
649 nmdc:mga0qj67_259219_c1
650 nmdc:mga06r32_73364_c1
651 nmdc:mga06r32_73542_c1
652 nmdc:mga08y16_138991_c1
653 Ga0495601_0012197
654 Ga0495619_0027999
655 Ga0500560_004303
656 Ga0500569_000008
657 Ga0500573_0084976
658 Ga0500573_0088308
659 Ga0500573_0167092
660 Ga0500588_0000115
661 Ga0500616_0000506
662 Ga0501084_0000908
663 Ga0501084_0134379
664 Ga0501082_0066304
665 Ga0501082_0176764
666 Ga0501082_0820840
667 Ga0466962_0123284
668 Ga0530510_0200049
669 2990063930
670 2585315877
671 2620352765
672 2643826729
673 2644534085
674 2739240247
675 2768642095
676 2785342204
677 2791910097
678 2791916152
679 2793981543
680 2795786796
681 2819698236
682 2862389616
683 2862580504
684 2867372902
685 2868091037
686 2883822181
687 2891402368
688 2891570001
689 2910812244
690 2939749081
691 3003001207
692 3003002055
693 8003322898
694 8008566201
695 8008581653
696 8023629413
697 8047900981
698 8048357920
699 8048377923
700 8048387021

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

196

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.944 14 237
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9435 13 234
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9434 12 228
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9406 13 233
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9387 13 234
ID Description Score Start End Superfamily
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 12 234 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9501 13 246 3.40.50.300
af_Q2G167_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9495 14 237 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 10 234 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9416 12 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3P1WHQ0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9928 11 248 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-C0GFN8-F1-model_v4 ABC transporter related protein 0.978 49 231 GO:0005524
GO:0016887
AF-A0A4P8II76-F1-model_v4 ABC transporter ATP-binding protein 0.9751 9 231 GO:0005524
GO:0016887
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9684 32 235 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2S9BY69-F1-model_v4 deleted 0.9669 5 248

Map