F418427

General Info

Members Datasets Scaffolds Average Seq Length
350 203 700 190

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0006951|Ga0500556_0006951_2110_2772
Length 220
Sequence LNHGDGSWAVIVARESADLSLPVVAVVPIRIVGDPVLHTATSPVPVGPDGSLPPELANLITDLYETMDAANGVGLAANQIGVSQRVFVFDCADERGRTTRRRGVVVNPVLETSEVPETMPDPDDDDEGCLSVPGESFPRGRASWARVTGLDAEGNPVVLEGTGLFARMLQHETGHLDGFLYVDGLIGRHARAAKRTVKANGWGVPGLSWTPGEDPDPFGH

Samples

Sample ID Description Type Environment
1 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
93 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
124 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
174 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
177 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
178 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
179 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
180 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
181 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
182 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
183 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
184 2867475112 Streptomyces sp. TM32 Isolate Unclassified
185 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
186 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
187 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
188 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
189 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
190 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
191 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
192 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
193 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
194 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
195 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
196 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
197 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
198 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
199 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
200 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
201 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
202 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
203 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.43
Metatranscriptomes 0.57
Isolates 8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.86
Nodule 0.29
Rhizoplane 12.29
Rhizosphere 71.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500556_0006951 3300053104 Bacteria 3225
2 JGI24735J21928_10031034 3300002067 Bacteria 1585
3 JGI25160J50197_1021063 3300003354 Bacteria 1948
4 Ga0055540_1030761 3300003792 Bacteria 1241
5 Ga0055540_1052934 3300003792 Bacteria 832
6 Ga0070658_10561543 3300005327 Bacteria 988
7 Ga0070689_100074111 3300005340 Bacteria 2663
8 Ga0070668_100041543 3300005347 Bacteria 3524
9 Ga0070669_100066757 3300005353 Bacteria 2652
10 Ga0070671_100000823 3300005355 Bacteria 22482
11 Ga0070671_100398781 3300005355 Bacteria 1177
12 Ga0070674_100016544 3300005356 Bacteria 4623
13 Ga0070659_101474625 3300005366 Bacteria 606
14 Ga0070667_100000029 3300005367 Bacteria 178990
15 Ga0070703_10001212 3300005406 Bacteria 7881
16 Ga0070703_10046426 3300005406 Bacteria 1373
17 Ga0070700_100678107 3300005441 Bacteria 817
18 Ga0070663_100520877 3300005455 Bacteria 990
19 Ga0070681_10624935 3300005458 Bacteria 992
20 Ga0070679_100162191 3300005530 Bacteria 2210
21 Ga0070679_101056055 3300005530 Bacteria 757
22 Ga0070697_100014116 3300005536 Bacteria 6274
23 Ga0068853_100009145 3300005539 Bacteria 7978
24 Ga0070665_100200275 3300005548 Bacteria 1997
25 Ga0068855_100201359 3300005563 Bacteria 2241
26 Ga0068856_100547873 3300005614 Bacteria 1178
27 Ga0068856_100555263 3300005614 Bacteria 1169
28 Ga0070702_100390752 3300005615 Bacteria 992
29 Ga0068852_100825834 3300005616 Bacteria 942
30 Ga0068852_100833980 3300005616 Bacteria 937
31 Ga0068863_100201668 3300005841 Bacteria 1914
32 Ga0081455_10031179 3300005937 Bacteria 4828
33 Ga0075365_10052534 3300006038 Bacteria 2696
34 Ga0075363_100003191 3300006048 Bacteria 6914
35 Ga0075364_10010703 3300006051 Bacteria 5547
36 Ga0075364_10021161 3300006051 Bacteria 4097
37 Ga0075364_10041780 3300006051 Bacteria 2978
38 Ga0075369_10000833 3300006186 Bacteria 10168
39 Ga0075369_10055655 3300006186 Bacteria 1719
40 Ga0075369_10085237 3300006186 Bacteria 1405
41 Ga0075369_10151002 3300006186 Bacteria 1062
42 Ga0075370_10000413 3300006353 Bacteria 15789
43 Ga0105250_10010056 3300009092 Bacteria 3956
44 Ga0105247_10345408 3300009101 Bacteria 1045
45 Ga0105243_10588793 3300009148 Bacteria 1069
46 Ga0105242_10015196 3300009176 Bacteria 5978
47 Ga0105242_11029988 3300009176 Bacteria 833
48 Ga0105248_10453004 3300009177 Bacteria 1446
49 Ga0105237_10004175 3300009545 Bacteria 16820
50 Ga0105249_10015587 3300009553 Bacteria 6728
51 Ga0105249_10019968 3300009553 Bacteria 5983
52 Ga0105249_10214384 3300009553 Bacteria 1891
53 Ga0105033_102094 3300009986 Bacteria 1649
54 Ga0105239_10010498 3300010375 Bacteria 10352
55 Ga0105239_10024236 3300010375 Bacteria 6683
56 Ga0105239_10078927 3300010375 Bacteria 3622
57 Ga0157371_10857236 3300013102 Bacteria 687
58 Ga0157374_10216177 3300013296 Bacteria 1880
59 Ga0157378_10001354 3300013297 Bacteria 22032
60 Ga0157378_10508158 3300013297 Bacteria 1205
61 Ga0157375_10441128 3300013308 Bacteria 1468
62 Ga0163163_10055928 3300014325 Bacteria 3900
63 Ga0157380_10009720 3300014326 Bacteria 6902
64 Ga0157379_10189663 3300014968 Bacteria 1858
65 Ga0206354_10237930 3300020081 Bacteria 1949
66 Ga0206354_10351425 3300020081 Bacteria 1235
67 Ga0207426_1002444 3300025302 Bacteria 11859
68 Ga0207426_1004005 3300025302 Bacteria 7468
69 Ga0209051_1001623 3300025303 Bacteria 18335
70 Ga0209051_1002967 3300025303 Bacteria 11553
71 Ga0209051_1003847 3300025303 Bacteria 9607
72 Ga0207707_10442509 3300025912 Bacteria 1113
73 Ga0207671_10019654 3300025914 Bacteria 5161
74 Ga0207660_10709611 3300025917 Bacteria 820
75 Ga0207652_10043020 3300025921 Bacteria 3846
76 Ga0207694_10191702 3300025924 Bacteria 1660
77 Ga0207700_10616736 3300025928 Bacteria 966
78 Ga0207644_10000213 3300025931 Bacteria 40008
79 Ga0207644_10114672 3300025931 Bacteria 2042
80 Ga0207709_10415585 3300025935 Bacteria 1032
81 Ga0207669_10002586 3300025937 Bacteria 7733
82 Ga0207704_10926421 3300025938 Bacteria 734
83 Ga0207711_10471987 3300025941 Bacteria 1169
84 Ga0207661_10814918 3300025944 Bacteria 859
85 Ga0207667_10166052 3300025949 Bacteria 2269
86 Ga0207712_10029723 3300025961 Bacteria 3669
87 Ga0207668_10000470 3300025972 Bacteria 25320
88 Ga0207668_10062940 3300025972 Bacteria 2615
89 Ga0207639_10043555 3300026041 Bacteria 3370
90 Ga0207702_10592746 3300026078 Bacteria 1087
91 Ga0268264_10108590 3300028381 Bacteria 2426
92 Ga0265327_10000004 3300031251 Bacteria 803973
93 Ga0265327_10000264 3300031251 Bacteria 103984
94 Ga0307408_100172941 3300031548 Bacteria 1726
95 Ga0307405_10045787 3300031731 Bacteria 2683
96 Ga0307405_10415277 3300031731 Bacteria 1057
97 Ga0307410_10021556 3300031852 Bacteria 3966
98 Ga0307410_10023563 3300031852 Bacteria 3830
99 Ga0307410_10070228 3300031852 Bacteria 2425
100 Ga0307410_10166823 3300031852 Bacteria 1655
101 Ga0307410_10273603 3300031852 Bacteria 1322
102 Ga0307406_10130449 3300031901 Bacteria 1764
103 Ga0307406_10170732 3300031901 Bacteria 1573
104 Ga0307406_10257638 3300031901 Bacteria 1318
105 Ga0307407_10037429 3300031903 Bacteria 2681
106 Ga0307407_10042922 3300031903 Bacteria 2539
107 Ga0307407_10236404 3300031903 Bacteria 1244
108 Ga0307407_10291343 3300031903 Bacteria 1134
109 Ga0307407_10733280 3300031903 Bacteria 747
110 Ga0307407_10984753 3300031903 Bacteria 651
111 Ga0307412_10024063 3300031911 Bacteria 3756
112 Ga0307412_10221999 3300031911 Bacteria 1449
113 Ga0307412_10313284 3300031911 Bacteria 1245
114 Ga0307412_10739993 3300031911 Bacteria 848
115 Ga0307409_100101954 3300031995 Bacteria 2383
116 Ga0307409_100116191 3300031995 Bacteria 2254
117 Ga0307409_100123992 3300031995 Bacteria 2194
118 Ga0307409_100185918 3300031995 Bacteria 1844
119 Ga0307409_100468096 3300031995 Bacteria 1220
120 Ga0307409_100500284 3300031995 Bacteria 1183
121 Ga0307409_100510194 3300031995 Bacteria 1173
122 Ga0307409_100710771 3300031995 Bacteria 1005
123 Ga0307409_100891156 3300031995 Bacteria 903
124 Ga0307409_101034503 3300031995 Bacteria 840
125 Ga0307416_100094224 3300032002 Bacteria 2581
126 Ga0307416_100208076 3300032002 Bacteria 1863
127 Ga0307416_100386855 3300032002 Bacteria 1431
128 Ga0307416_100446640 3300032002 Bacteria 1344
129 Ga0307416_100659421 3300032002 Bacteria 1132
130 Ga0307416_100757164 3300032002 Bacteria 1064
131 Ga0307416_100769963 3300032002 Bacteria 1056
132 Ga0307414_10435495 3300032004 Bacteria 1146
133 Ga0307414_10716871 3300032004 Bacteria 907
134 Ga0307414_10820558 3300032004 Bacteria 849
135 Ga0307414_11156292 3300032004 Bacteria 716
136 Ga0307411_10532798 3300032005 Bacteria 999
137 Ga0307411_10654543 3300032005 Bacteria 910
138 Ga0307415_100011974 3300032126 Bacteria 4994
139 Ga0307415_100046188 3300032126 Bacteria 2924
140 Ga0307415_100155979 3300032126 Bacteria 1763
141 Ga0307415_100188090 3300032126 Bacteria 1627
142 Ga0307415_100475509 3300032126 Bacteria 1086
143 Ga0307415_100578486 3300032126 Bacteria 996
144 Ga0307415_101464548 3300032126 Bacteria 652
145 Ga0395899_0338544 3300037312 Bacteria 1009
146 Ga0395900_0062066 3300037418 Bacteria 3842
147 Ga0395900_0168217 3300037418 Bacteria 2233
148 Ga0395898_0039345 3300037466 Bacteria 4681
149 Ga0395898_0433341 3300037466 Bacteria 1253
150 Ga0395898_0559105 3300037466 Bacteria 1086
151 Ga0395901_0003288 3300038443 Bacteria 16272
152 Ga0395901_0116464 3300038443 Bacteria 2807
153 Ga0395901_0435946 3300038443 Bacteria 1342
154 Ga0439436_0034352 3300041404 Bacteria 1466
155 Ga0439461_0001884 3300041410 Bacteria 3300
156 Ga0439466_0006549 3300041411 Bacteria 4424
157 Ga0439466_0009954 3300041411 Bacteria 3537
158 Ga0439465_0000991 3300041413 Bacteria 9038
159 Ga0439465_0043607 3300041413 Bacteria 1456
160 Ga0451789_0576654 3300041443 Bacteria 1424
161 Ga0451793_1067402 3300041452 Bacteria 4105
162 Ga0451797_0210984 3300041453 Bacteria 1254
163 Ga0451795_0602195 3300041456 Bacteria 2701
164 Ga0451802_1655579 3300041460 Bacteria 1228
165 Ga0451807_0016676 3300041486 Bacteria 1375
166 Ga0451807_2718678 3300041486 Bacteria 828
167 Ga0439431_0000812 3300041997 Bacteria 6735
168 Ga0439442_023248 3300042002 Bacteria 1288
169 Ga0439445_0000485 3300042004 Bacteria 8076
170 Ga0439445_0032252 3300042004 Bacteria 1365
171 Ga0450906_023312 3300042145 Bacteria 1103
172 Ga0439434_0001691 3300042435 Bacteria 6395
173 Ga0439434_0063936 3300042435 Bacteria 1153
174 Ga0466972_0013932 3300044658 Bacteria 4033
175 Ga0466972_0017075 3300044658 Bacteria 3629
176 Ga0466965_0002108 3300044683 Bacteria 8351
177 Ga0466965_0026733 3300044683 Bacteria 2797
178 Ga0466965_0096022 3300044683 Bacteria 1512
179 Ga0466965_0182328 3300044683 Bacteria 1108
180 Ga0466965_0253287 3300044683 Bacteria 945
181 Ga0466966_0104239 3300044684 Bacteria 1752
182 Ga0466966_0291883 3300044684 Bacteria 980
183 Ga0466966_0527414 3300044684 Bacteria 710
184 Ga0466961_0111467 3300044693 Bacteria 1721
185 Ga0466961_0367031 3300044693 Bacteria 875
186 Ga0466961_0642460 3300044693 Bacteria 637
187 Ga0466963_0105933 3300044694 Bacteria 1928
188 Ga0466963_0112870 3300044694 Bacteria 1866
189 Ga0466963_0440506 3300044694 Bacteria 919
190 Ga0466963_0649932 3300044694 Bacteria 744
191 Ga0466968_0021062 3300044735 Bacteria 2637
192 Ga0466970_0039099 3300044765 Bacteria 2517
193 Ga0466970_0054124 3300044765 Bacteria 2143
194 Ga0466970_0091302 3300044765 Bacteria 1653
195 Ga0466970_0233466 3300044765 Bacteria 1028
196 Ga0466970_0285368 3300044765 Bacteria 929
197 Ga0466957_0092886 3300044842 Bacteria 1893
198 Ga0466957_0177589 3300044842 Bacteria 1389
199 Ga0466957_0203640 3300044842 Bacteria 1301
200 Ga0466957_0754085 3300044842 Bacteria 689
201 Ga0466960_0000267 3300044901 Bacteria 17993
202 Ga0466960_0058150 3300044901 Bacteria 1888
203 Ga0466960_0064020 3300044901 Bacteria 1812
204 Ga0466960_0076141 3300044901 Bacteria 1680
205 Ga0466960_0078884 3300044901 Bacteria 1654
206 Ga0466960_0117769 3300044901 Bacteria 1388
207 Ga0466960_0133082 3300044901 Bacteria 1314
208 Ga0466960_0142021 3300044901 Bacteria 1276
209 Ga0466960_0488255 3300044901 Bacteria 720
210 Ga0466959_0006438 3300045049 Bacteria 8130
211 Ga0466959_0068284 3300045049 Bacteria 2576
212 Ga0466959_0138300 3300045049 Bacteria 1723
213 Ga0466959_0147346 3300045049 Bacteria 1660
214 Ga0466958_0060046 3300045836 Bacteria 2314
215 Ga0466958_0508750 3300045836 Bacteria 781
216 Ga0466958_0652232 3300045836 Bacteria 685
217 Ga0466967_0010701 3300045976 Bacteria 6896
218 Ga0466967_0029003 3300045976 Bacteria 4627
219 Ga0466967_0043923 3300045976 Bacteria 3872
220 Ga0466967_0073380 3300045976 Bacteria 3070
221 Ga0466967_0107071 3300045976 Bacteria 2564
222 Ga0466967_0141357 3300045976 Bacteria 2242
223 Ga0466967_0215117 3300045976 Bacteria 1824
224 Ga0466967_0610757 3300045976 Bacteria 1077
225 Ga0495583_0095429 3300046506 Bacteria 1276
226 Ga0495644_0225007 3300046523 Bacteria 726
227 Ga0495648_0005940 3300046524 Bacteria 10045
228 Ga0495663_0077537 3300046525 Bacteria 1066
229 Ga0495621_0096424 3300046539 Bacteria 1121
230 Ga0495668_0059713 3300046616 Bacteria 2104
231 Ga0495668_0101985 3300046616 Bacteria 1570
232 Ga0495611_0004558 3300046648 Bacteria 5975
233 Ga0495635_0046168 3300046663 Bacteria 3005
234 Ga0495649_0143704 3300046694 Bacteria 1255
235 Ga0495672_0119810 3300047320 Bacteria 1400
236 Ga0495677_0172895 3300047445 Bacteria 836
237 Ga0495685_066630 3300047447 Bacteria 1210
238 Ga0495673_0004609 3300047469 Bacteria 8586
239 Ga0495686_0004017 3300047472 Bacteria 12306
240 Ga0495686_0069120 3300047472 Bacteria 2178
241 Ga0495615_0149866 3300048090 Bacteria 694
242 Ga0496100_0010640 3300048903 Bacteria 5214
243 Ga0496100_0262876 3300048903 Bacteria 1280
244 Ga0496101_0000650 3300048904 Bacteria 20957
245 Ga0496101_0110610 3300048904 Bacteria 2067
246 Ga0496101_0401386 3300048904 Bacteria 1079
247 Ga0496102_0000041 3300048905 Bacteria 196634
248 Ga0496102_0050851 3300048905 Bacteria 3774
249 Ga0496102_0432117 3300048905 Bacteria 1236
250 Ga0496103_0000150 3300048906 Bacteria 72561
251 Ga0496103_0036470 3300048906 Bacteria 3011
252 Ga0496104_0002069 3300048907 Bacteria 17422
253 Ga0496104_0024624 3300048907 Bacteria 5537
254 Ga0496104_0293686 3300048907 Bacteria 1538
255 Ga0496105_0015015 3300048908 Bacteria 6163
256 Ga0496105_0016739 3300048908 Bacteria 5859
257 Ga0496106_0008947 3300048909 Bacteria 7398
258 Ga0496106_0010199 3300048909 Bacteria 6943
259 Ga0496106_0347795 3300048909 Bacteria 1191
260 Ga0496107_0004758 3300048910 Bacteria 9219
261 Ga0496107_0065075 3300048910 Bacteria 2643
262 Ga0496108_0038118 3300048911 Bacteria 4004
263 Ga0496108_0241015 3300048911 Bacteria 1573
264 Ga0496109_0027813 3300048912 Bacteria 5053
265 Ga0496109_0642588 3300048912 Bacteria 998
266 Ga0496110_0128917 3300048913 Bacteria 2283
267 Ga0496110_0322607 3300048913 Bacteria 1407
268 Ga0496110_0333707 3300048913 Bacteria 1381
269 Ga0496110_0914506 3300048913 Bacteria 784
270 Ga0496112_0022228 3300048915 Bacteria 6043
271 Ga0496112_0175860 3300048915 Bacteria 2106
272 Ga0496112_0430282 3300048915 Bacteria 1258
273 Ga0496113_0529089 3300048916 Bacteria 946
274 Ga0496113_1011951 3300048916 Bacteria 654
275 Ga0496114_0006522 3300048917 Bacteria 9195
276 Ga0496115_0006734 3300048918 Bacteria 8426
277 Ga0496116_0000098 3300048919 Bacteria 196497
278 Ga0496117_0000096 3300048920 Bacteria 196788
279 Ga0496118_0000073 3300048921 Bacteria 196712
280 Ga0496119_0015819 3300048922 Bacteria 5778
281 Ga0496119_0254184 3300048922 Bacteria 885
282 Ga0496120_0018525 3300048923 Bacteria 4482
283 Ga0496121_0001389 3300048924 Bacteria 40961
284 Ga0496126_0000762 3300048929 Bacteria 58311
285 Ga0501032_0002429 3300049569 Bacteria 14535
286 Ga0501034_0002167 3300049571 Bacteria 24348
287 Ga0501036_0041337 3300049572 Bacteria 3901
288 Ga0501037_0001694 3300049573 Bacteria 15996
289 Ga0501039_0004531 3300049575 Bacteria 10494
290 Ga0501039_0385610 3300049575 Bacteria 1101
291 Ga0501042_0174753 3300049578 Bacteria 1550
292 Ga0501043_0000892 3300049579 Bacteria 26475
293 Ga0501047_0029852 3300049581 Bacteria 5255
294 Ga0501070_0000501 3300049586 Bacteria 35639
295 Ga0501070_0213368 3300049586 Bacteria 1584
296 Ga0501072_0693123 3300049588 Bacteria 801
297 Ga0501075_0215444 3300049591 Bacteria 1465
298 Ga0501044_0004306 3300049823 Bacteria 15959
299 Ga0501044_0640469 3300049823 Bacteria 953
300 nmdc:mga03683_144948_c1 3300050489 Bacteria 1069
301 nmdc:mga00v17_48893_c1 3300050491 Bacteria 2564
302 nmdc:mga00v17_49047_c1 3300050491 Bacteria 2560
303 nmdc:mga0yw44_118846_c1 3300050492 Bacteria 1701
304 nmdc:mga04h51_111348_c1 3300050495 Bacteria 1009
305 nmdc:mga0sz30_4098_c1 3300050516 Bacteria 5250
306 nmdc:mga0sz30_45127_c2 3300050516 Bacteria 1453
307 nmdc:mga0sz30_6561_c1 3300050516 Bacteria 4326
308 Ga0500610_0013495 3300053079 Bacteria 3805
309 Ga0500643_016366 3300053087 Bacteria 2513
310 Ga0500643_025803 3300053087 Bacteria 1848
311 Ga0500646_0102988 3300053090 Bacteria 899
312 Ga0500652_140290 3300053131 Bacteria 1006
313 Ga0500652_153914 3300053131 Bacteria 953
314 Ga0500568_0069895 3300053139 Bacteria 1346
315 Ga0500573_0010910 3300053140 Bacteria 5078
316 Ga0500616_0128198 3300053153 Bacteria 1202
317 Ga0500627_0005110 3300053158 Bacteria 4313
318 Ga0500587_017088 3300053739 Bacteria 929
319 Ga0466962_0025924 3300061719 Bacteria 2814
320 Ga0466962_0064002 3300061719 Bacteria 1756
321 Ga0466962_0075212 3300061719 Bacteria 1614
322 Ga0466962_0088711 3300061719 Bacteria 1481
323 2623499343 2622736605 Bacteria 4992138
324 2644487361 2643221687 Bacteria 6500351
325 2644638982 2643221715 Bacteria 6671032
326 2738702607 2738541274 Bacteria 6909446
327 2739329517 2738543028 Bacteria 6917070
328 2753037369 2751185725 Bacteria 5740550
329 2753325238 2751185792 Bacteria 5739090
330 2842135184 2842134933 Bacteria 5847019
331 2867481171 2867475112 Bacteria 6909112
332 2902794409 2902792274 Bacteria 7270173
333 2902803247 2902799365 Bacteria 5419524
334 2904767745 2904765812 Bacteria 5369154
335 2904774479 2904770941 Bacteria 5580202
336 2908813393 2908811453 Bacteria 5478616
337 2919423826 2919420072 Bacteria 5390363
338 2919436434 2919432681 Bacteria 5390474
339 2939587124 2939582691 Bacteria 7088898
340 2956942222 2956939328 Bacteria 3474458
341 2997452792 2997451912 Bacteria 8492419
342 2997600838 2997600082 Bacteria 9896405
343 3001121970 3001119090 Bacteria 3449530
344 8047894441 8047893842 Bacteria 11723082
345 8048134776 8048127548 Bacteria 11053136
346 8048364611 8048356638 Bacteria 11044339
347 8048371458 8048369669 Bacteria 11666822
348 8048380259 8048379754 Bacteria 11877923
349 8054164232 8054160619 Bacteria 7783213
350 8056672305 8056667051 Bacteria 6953971
351 Ga0500556_0006951
352 JGI24735J21928_10031034
353 JGI25160J50197_1021063
354 Ga0055540_1030761
355 Ga0055540_1052934
356 Ga0070658_10561543
357 Ga0070689_100074111
358 Ga0070668_100041543
359 Ga0070669_100066757
360 Ga0070671_100000823
361 Ga0070671_100398781
362 Ga0070674_100016544
363 Ga0070659_101474625
364 Ga0070667_100000029
365 Ga0070703_10001212
366 Ga0070703_10046426
367 Ga0070700_100678107
368 Ga0070663_100520877
369 Ga0070681_10624935
370 Ga0070679_100162191
371 Ga0070679_101056055
372 Ga0070697_100014116
373 Ga0068853_100009145
374 Ga0070665_100200275
375 Ga0068855_100201359
376 Ga0068856_100547873
377 Ga0068856_100555263
378 Ga0070702_100390752
379 Ga0068852_100825834
380 Ga0068852_100833980
381 Ga0068863_100201668
382 Ga0081455_10031179
383 Ga0075365_10052534
384 Ga0075363_100003191
385 Ga0075364_10010703
386 Ga0075364_10021161
387 Ga0075364_10041780
388 Ga0075369_10000833
389 Ga0075369_10055655
390 Ga0075369_10085237
391 Ga0075369_10151002
392 Ga0075370_10000413
393 Ga0105250_10010056
394 Ga0105247_10345408
395 Ga0105243_10588793
396 Ga0105242_10015196
397 Ga0105242_11029988
398 Ga0105248_10453004
399 Ga0105237_10004175
400 Ga0105249_10015587
401 Ga0105249_10019968
402 Ga0105249_10214384
403 Ga0105033_102094
404 Ga0105239_10010498
405 Ga0105239_10024236
406 Ga0105239_10078927
407 Ga0157371_10857236
408 Ga0157374_10216177
409 Ga0157378_10001354
410 Ga0157378_10508158
411 Ga0157375_10441128
412 Ga0163163_10055928
413 Ga0157380_10009720
414 Ga0157379_10189663
415 Ga0206354_10237930
416 Ga0206354_10351425
417 Ga0207426_1002444
418 Ga0207426_1004005
419 Ga0209051_1001623
420 Ga0209051_1002967
421 Ga0209051_1003847
422 Ga0207707_10442509
423 Ga0207671_10019654
424 Ga0207660_10709611
425 Ga0207652_10043020
426 Ga0207694_10191702
427 Ga0207700_10616736
428 Ga0207644_10000213
429 Ga0207644_10114672
430 Ga0207709_10415585
431 Ga0207669_10002586
432 Ga0207704_10926421
433 Ga0207711_10471987
434 Ga0207661_10814918
435 Ga0207667_10166052
436 Ga0207712_10029723
437 Ga0207668_10000470
438 Ga0207668_10062940
439 Ga0207639_10043555
440 Ga0207702_10592746
441 Ga0268264_10108590
442 Ga0265327_10000004
443 Ga0265327_10000264
444 Ga0307408_100172941
445 Ga0307405_10045787
446 Ga0307405_10415277
447 Ga0307410_10021556
448 Ga0307410_10023563
449 Ga0307410_10070228
450 Ga0307410_10166823
451 Ga0307410_10273603
452 Ga0307406_10130449
453 Ga0307406_10170732
454 Ga0307406_10257638
455 Ga0307407_10037429
456 Ga0307407_10042922
457 Ga0307407_10236404
458 Ga0307407_10291343
459 Ga0307407_10733280
460 Ga0307407_10984753
461 Ga0307412_10024063
462 Ga0307412_10221999
463 Ga0307412_10313284
464 Ga0307412_10739993
465 Ga0307409_100101954
466 Ga0307409_100116191
467 Ga0307409_100123992
468 Ga0307409_100185918
469 Ga0307409_100468096
470 Ga0307409_100500284
471 Ga0307409_100510194
472 Ga0307409_100710771
473 Ga0307409_100891156
474 Ga0307409_101034503
475 Ga0307416_100094224
476 Ga0307416_100208076
477 Ga0307416_100386855
478 Ga0307416_100446640
479 Ga0307416_100659421
480 Ga0307416_100757164
481 Ga0307416_100769963
482 Ga0307414_10435495
483 Ga0307414_10716871
484 Ga0307414_10820558
485 Ga0307414_11156292
486 Ga0307411_10532798
487 Ga0307411_10654543
488 Ga0307415_100011974
489 Ga0307415_100046188
490 Ga0307415_100155979
491 Ga0307415_100188090
492 Ga0307415_100475509
493 Ga0307415_100578486
494 Ga0307415_101464548
495 Ga0395899_0338544
496 Ga0395900_0062066
497 Ga0395900_0168217
498 Ga0395898_0039345
499 Ga0395898_0433341
500 Ga0395898_0559105
501 Ga0395901_0003288
502 Ga0395901_0116464
503 Ga0395901_0435946
504 Ga0439436_0034352
505 Ga0439461_0001884
506 Ga0439466_0006549
507 Ga0439466_0009954
508 Ga0439465_0000991
509 Ga0439465_0043607
510 Ga0451789_0576654
511 Ga0451793_1067402
512 Ga0451797_0210984
513 Ga0451795_0602195
514 Ga0451802_1655579
515 Ga0451807_0016676
516 Ga0451807_2718678
517 Ga0439431_0000812
518 Ga0439442_023248
519 Ga0439445_0000485
520 Ga0439445_0032252
521 Ga0450906_023312
522 Ga0439434_0001691
523 Ga0439434_0063936
524 Ga0466972_0013932
525 Ga0466972_0017075
526 Ga0466965_0002108
527 Ga0466965_0026733
528 Ga0466965_0096022
529 Ga0466965_0182328
530 Ga0466965_0253287
531 Ga0466966_0104239
532 Ga0466966_0291883
533 Ga0466966_0527414
534 Ga0466961_0111467
535 Ga0466961_0367031
536 Ga0466961_0642460
537 Ga0466963_0105933
538 Ga0466963_0112870
539 Ga0466963_0440506
540 Ga0466963_0649932
541 Ga0466968_0021062
542 Ga0466970_0039099
543 Ga0466970_0054124
544 Ga0466970_0091302
545 Ga0466970_0233466
546 Ga0466970_0285368
547 Ga0466957_0092886
548 Ga0466957_0177589
549 Ga0466957_0203640
550 Ga0466957_0754085
551 Ga0466960_0000267
552 Ga0466960_0058150
553 Ga0466960_0064020
554 Ga0466960_0076141
555 Ga0466960_0078884
556 Ga0466960_0117769
557 Ga0466960_0133082
558 Ga0466960_0142021
559 Ga0466960_0488255
560 Ga0466959_0006438
561 Ga0466959_0068284
562 Ga0466959_0138300
563 Ga0466959_0147346
564 Ga0466958_0060046
565 Ga0466958_0508750
566 Ga0466958_0652232
567 Ga0466967_0010701
568 Ga0466967_0029003
569 Ga0466967_0043923
570 Ga0466967_0073380
571 Ga0466967_0107071
572 Ga0466967_0141357
573 Ga0466967_0215117
574 Ga0466967_0610757
575 Ga0495583_0095429
576 Ga0495644_0225007
577 Ga0495648_0005940
578 Ga0495663_0077537
579 Ga0495621_0096424
580 Ga0495668_0059713
581 Ga0495668_0101985
582 Ga0495611_0004558
583 Ga0495635_0046168
584 Ga0495649_0143704
585 Ga0495672_0119810
586 Ga0495677_0172895
587 Ga0495685_066630
588 Ga0495673_0004609
589 Ga0495686_0004017
590 Ga0495686_0069120
591 Ga0495615_0149866
592 Ga0496100_0010640
593 Ga0496100_0262876
594 Ga0496101_0000650
595 Ga0496101_0110610
596 Ga0496101_0401386
597 Ga0496102_0000041
598 Ga0496102_0050851
599 Ga0496102_0432117
600 Ga0496103_0000150
601 Ga0496103_0036470
602 Ga0496104_0002069
603 Ga0496104_0024624
604 Ga0496104_0293686
605 Ga0496105_0015015
606 Ga0496105_0016739
607 Ga0496106_0008947
608 Ga0496106_0010199
609 Ga0496106_0347795
610 Ga0496107_0004758
611 Ga0496107_0065075
612 Ga0496108_0038118
613 Ga0496108_0241015
614 Ga0496109_0027813
615 Ga0496109_0642588
616 Ga0496110_0128917
617 Ga0496110_0322607
618 Ga0496110_0333707
619 Ga0496110_0914506
620 Ga0496112_0022228
621 Ga0496112_0175860
622 Ga0496112_0430282
623 Ga0496113_0529089
624 Ga0496113_1011951
625 Ga0496114_0006522
626 Ga0496115_0006734
627 Ga0496116_0000098
628 Ga0496117_0000096
629 Ga0496118_0000073
630 Ga0496119_0015819
631 Ga0496119_0254184
632 Ga0496120_0018525
633 Ga0496121_0001389
634 Ga0496126_0000762
635 Ga0501032_0002429
636 Ga0501034_0002167
637 Ga0501036_0041337
638 Ga0501037_0001694
639 Ga0501039_0004531
640 Ga0501039_0385610
641 Ga0501042_0174753
642 Ga0501043_0000892
643 Ga0501047_0029852
644 Ga0501070_0000501
645 Ga0501070_0213368
646 Ga0501072_0693123
647 Ga0501075_0215444
648 Ga0501044_0004306
649 Ga0501044_0640469
650 nmdc:mga03683_144948_c1
651 nmdc:mga00v17_48893_c1
652 nmdc:mga00v17_49047_c1
653 nmdc:mga0yw44_118846_c1
654 nmdc:mga04h51_111348_c1
655 nmdc:mga0sz30_4098_c1
656 nmdc:mga0sz30_45127_c2
657 nmdc:mga0sz30_6561_c1
658 Ga0500610_0013495
659 Ga0500643_016366
660 Ga0500643_025803
661 Ga0500646_0102988
662 Ga0500652_140290
663 Ga0500652_153914
664 Ga0500568_0069895
665 Ga0500573_0010910
666 Ga0500616_0128198
667 Ga0500627_0005110
668 Ga0500587_017088
669 Ga0466962_0025924
670 Ga0466962_0064002
671 Ga0466962_0075212
672 Ga0466962_0088711
673 2623499343
674 2644487361
675 2644638982
676 2738702607
677 2739329517
678 2753037369
679 2753325238
680 2842135184
681 2867481171
682 2902794409
683 2902803247
684 2904767745
685 2904774479
686 2908813393
687 2919423826
688 2919436434
689 2939587124
690 2956942222
691 2997452792
692 2997600838
693 3001121970
694 8047894441
695 8048134776
696 8048364611
697 8048371458
698 8048380259
699 8054164232
700 8056672305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

26

191

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e3u-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis peptide deformylase in complex with inhibitor 0.9619 16 211
3e3u-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis peptide deformylase in complex with inhibitor 0.9571 16 211
5mte-assembly2.cif.gz_B crystal structure of pdf from the vibrio parahaemolyticus bacteriophage vp16t in complex with actinonin - crystal form ii 0.9383 20 171
6il2-assembly1.cif.gz_A k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae 0.9187 17 178
5mte-assembly2.cif.gz_B crystal structure of pdf from the vibrio parahaemolyticus bacteriophage vp16t in complex with actinonin - crystal form ii 0.9118 20 171
ID Description Score Start End Superfamily
3e3uA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9619 16 211 3.90.45.10
3e3uA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9571 16 211 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9099 20 171 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8965 16 176 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.896 17 178 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A853LIX9-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9929 16 188 GO:0006412
GO:0042586
GO:0043686
AF-A0A1Q4TJL9-F1-model_v4 deleted 0.9842 16 209
AF-A0A2S8M8T6-F1-model_v4 deleted 0.9831 76 211
AF-A0A853LIX9-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9816 16 188 GO:0006412
GO:0042586
GO:0043686
AF-A0A1V3WS22-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.977 96 211 GO:0006412
GO:0042586
GO:0043686

Map