F418420

General Info

Members Datasets Scaffolds Average Seq Length
350 241 700 242

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_193044_c1|nmdc:mga0n895_193044_c1_790_1596
Length 268
Sequence LRGEAHRGYGFGALRLSQPDPSAVQPVNPSPTLSVDVWRGAATGAFQTFTVPRRLNQTILDVVTEIQRDQDPTLSYRFACRVGMCGSCAMVVNGRPRWTCRTRVSEAAGADGALRLEPLRNFTIVKDLAVEMTDFFDKWRDAQGFFEPGRRPAKDFAVVPPATRERRAADEAIECIGCGICYSACDVVAWDRDYLGPAALNRAWTLVNDVRDTAGEARLAAVGGDSGCQCCHTHMSCTSFCPKGIAPTYSIAGLKRTMFWQALKGGRR

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 2738543032 Methylobacterium sp. GV104 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.71
Nodule 0
Rhizoplane 4.86
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_193044_c1 3300050512 Bacteria 2067
2 Ga0070658_10027714 3300005327 Bacteria 4546
3 Ga0070676_10033623 3300005328 Bacteria 2942
4 Ga0070680_100023831 3300005336 Bacteria 4885
5 Ga0070680_100031093 3300005336 Bacteria 4291
6 Ga0070680_100034462 3300005336 Bacteria 4081
7 Ga0070680_100351175 3300005336 Bacteria 1254
8 Ga0070682_100012075 3300005337 Bacteria 4943
9 Ga0070689_100004043 3300005340 Bacteria 9868
10 Ga0070661_100311439 3300005344 Bacteria 1228
11 Ga0070668_100474856 3300005347 Bacteria 1079
12 Ga0070669_100046064 3300005353 Bacteria 3180
13 Ga0070675_100043439 3300005354 Bacteria 3673
14 Ga0070675_100759884 3300005354 Bacteria 885
15 Ga0070671_100361260 3300005355 Bacteria 1240
16 Ga0070674_100296318 3300005356 Bacteria 1288
17 Ga0070673_100116365 3300005364 Bacteria 2224
18 Ga0070667_100633346 3300005367 Bacteria 987
19 Ga0070714_100089584 3300005435 Bacteria 2693
20 Ga0070714_100338980 3300005435 Bacteria 1410
21 Ga0070713_100307550 3300005436 Bacteria 1461
22 Ga0070701_10136866 3300005438 Bacteria 1397
23 Ga0070708_100408095 3300005445 Bacteria 1281
24 Ga0070663_100205026 3300005455 Bacteria 1541
25 Ga0070678_100298743 3300005456 Bacteria 1368
26 Ga0070681_10085223 3300005458 Bacteria 3112
27 Ga0070681_10490385 3300005458 Bacteria 1142
28 Ga0068867_100566831 3300005459 Bacteria 986
29 Ga0070699_100001364 3300005518 Bacteria 22452
30 Ga0070699_100143716 3300005518 Bacteria 2108
31 Ga0070679_100020658 3300005530 Bacteria 6422
32 Ga0070679_100041995 3300005530 Bacteria 4554
33 Ga0070679_100057101 3300005530 Bacteria 3890
34 Ga0070679_100104158 3300005530 Bacteria 2824
35 Ga0070679_100447517 3300005530 Bacteria 1236
36 Ga0070697_100074049 3300005536 Bacteria 2797
37 Ga0068853_100000659 3300005539 Bacteria 23749
38 Ga0070672_100275392 3300005543 Bacteria 1422
39 Ga0070672_100611801 3300005543 Bacteria 950
40 Ga0070695_100001361 3300005545 Bacteria 13561
41 Ga0070696_100045224 3300005546 Bacteria 3050
42 Ga0070693_100026277 3300005547 Bacteria 3142
43 Ga0070665_100401820 3300005548 Bacteria 1378
44 Ga0068855_100028216 3300005563 Bacteria 6713
45 Ga0068855_100072828 3300005563 Bacteria 3993
46 Ga0068856_100839803 3300005614 Bacteria 938
47 Ga0068852_100741981 3300005616 Bacteria 994
48 Ga0068864_100079401 3300005618 Bacteria 2873
49 Ga0068858_100186050 3300005842 Bacteria 1962
50 Ga0068860_100406978 3300005843 Bacteria 1347
51 Ga0081538_10003269 3300005981 Bacteria 15388
52 Ga0081540_1000233 3300005983 Bacteria 58300
53 Ga0081540_1004188 3300005983 Bacteria 11091
54 Ga0075365_10080508 3300006038 Bacteria 2205
55 Ga0075368_10035952 3300006042 Bacteria 1934
56 Ga0075363_100057984 3300006048 Bacteria 2079
57 Ga0075364_10228254 3300006051 Bacteria 1264
58 Ga0075364_10443860 3300006051 Bacteria 886
59 Ga0070712_100028173 3300006175 Bacteria 3756
60 Ga0075362_10144462 3300006177 Bacteria 1138
61 Ga0075370_10189530 3300006353 Bacteria 1211
62 Ga0075428_100007549 3300006844 Bacteria 12051
63 Ga0075428_100044680 3300006844 Bacteria 4867
64 Ga0075428_100861905 3300006844 Bacteria 961
65 Ga0075430_100074418 3300006846 Bacteria 2848
66 Ga0075430_100579529 3300006846 Bacteria 926
67 Ga0075431_100005968 3300006847 Bacteria 12063
68 Ga0075431_100248348 3300006847 Bacteria 1808
69 Ga0075433_10015526 3300006852 Bacteria 6251
70 Ga0075429_100004465 3300006880 Bacteria 12038
71 Ga0075436_100000499 3300006914 Bacteria 25388
72 Ga0075436_100001270 3300006914 Bacteria 17140
73 Ga0075436_100033467 3300006914 Bacteria 3543
74 Ga0075435_100045945 3300007076 Bacteria 3501
75 Ga0075435_100317643 3300007076 Bacteria 1333
76 Ga0075435_100459788 3300007076 Bacteria 1098
77 Ga0099795_10048633 3300007788 Bacteria 1536
78 Ga0111539_10009844 3300009094 Bacteria 12063
79 Ga0111539_10208993 3300009094 Bacteria 2274
80 Ga0111539_10557202 3300009094 Unclassified 1335
81 Ga0105245_10581238 3300009098 Bacteria 1145
82 Ga0105247_10077046 3300009101 Bacteria 2095
83 Ga0114129_10012508 3300009147 Bacteria 12083
84 Ga0114129_10178163 3300009147 Bacteria 2894
85 Ga0105243_10085177 3300009148 Bacteria 2590
86 Ga0105241_10077806 3300009174 Bacteria 2590
87 Ga0105242_10066260 3300009176 Bacteria 2982
88 Ga0105237_10236795 3300009545 Bacteria 1827
89 Ga0105238_10247192 3300009551 Bacteria 1762
90 Ga0105239_10201935 3300010375 Bacteria 2227
91 Ga0157373_10014189 3300013100 Bacteria 5844
92 Ga0157373_10282007 3300013100 Bacteria 1177
93 Ga0157370_10017634 3300013104 Bacteria 7198
94 Ga0157370_10019638 3300013104 Bacteria 6768
95 Ga0157370_10073461 3300013104 Bacteria 3227
96 Ga0157369_10217018 3300013105 Bacteria 2003
97 Ga0157369_10823569 3300013105 Bacteria 953
98 Ga0157378_11096397 3300013297 Bacteria 833
99 Ga0163162_10436920 3300013306 Bacteria 1441
100 Ga0163162_10727191 3300013306 Bacteria 1113
101 Ga0157372_10006805 3300013307 Bacteria 12156
102 Ga0157372_10221038 3300013307 Bacteria 2196
103 Ga0157375_10394214 3300013308 Bacteria 1551
104 Ga0157380_10657260 3300014326 Bacteria 1047
105 Ga0157379_10084370 3300014968 Bacteria 2847
106 Ga0206356_11903661 3300020070 Bacteria 2336
107 Ga0213876_10258878 3300021384 Bacteria 924
108 Ga0207688_10205970 3300025901 Bacteria 1181
109 Ga0207699_10017536 3300025906 Bacteria 3772
110 Ga0207645_10107561 3300025907 Bacteria 1804
111 Ga0207707_10034582 3300025912 Bacteria 4421
112 Ga0207693_10118804 3300025915 Bacteria 2076
113 Ga0207693_10307641 3300025915 Bacteria 1241
114 Ga0207660_10346395 3300025917 Bacteria 1190
115 Ga0207660_10384764 3300025917 Bacteria 1128
116 Ga0207657_10074308 3300025919 Bacteria 2871
117 Ga0207649_10026641 3300025920 Bacteria 3384
118 Ga0207646_10665532 3300025922 Bacteria 932
119 Ga0207687_10219503 3300025927 Bacteria 1496
120 Ga0207700_10328229 3300025928 Bacteria 1327
121 Ga0207664_10193811 3300025929 Bacteria 1750
122 Ga0207706_10149309 3300025933 Bacteria 2056
123 Ga0207669_10207515 3300025937 Bacteria 1427
124 Ga0207669_10334178 3300025937 Bacteria 1164
125 Ga0207665_10096244 3300025939 Bacteria 2059
126 Ga0207711_10029441 3300025941 Bacteria 4632
127 Ga0207661_10256570 3300025944 Bacteria 1556
128 Ga0207667_10081619 3300025949 Bacteria 3349
129 Ga0207640_10274698 3300025981 Bacteria 1320
130 Ga0207703_10089652 3300026035 Bacteria 2583
131 Ga0207639_10016250 3300026041 Bacteria 5261
132 Ga0207678_10392595 3300026067 Bacteria 1201
133 Ga0207708_10227250 3300026075 Bacteria 1497
134 Ga0207676_10034018 3300026095 Bacteria 3856
135 Ga0207675_100273573 3300026118 Bacteria 1639
136 Ga0207683_10039842 3300026121 Bacteria 4099
137 Ga0209969_1000759 3300027360 Bacteria 4329
138 Ga0209967_1000554 3300027364 Bacteria 4917
139 Ga0209981_1006576 3300027378 Bacteria 1557
140 Ga0209996_1000669 3300027395 Bacteria 4101
141 Ga0209999_1005633 3300027543 Bacteria 2253
142 Ga0209970_1006947 3300027614 Bacteria 1856
143 Ga0209971_1001259 3300027682 Bacteria 6321
144 Ga0207428_10006244 3300027907 Bacteria 11012
145 Ga0268266_10220544 3300028379 Bacteria 1743
146 Ga0268264_10148835 3300028381 Bacteria 2097
147 Ga0265318_10100489 3300028577 Bacteria 1064
148 Ga0265338_10111528 3300028800 Bacteria 2201
149 Ga0265330_10030488 3300031235 Bacteria 2421
150 Ga0265325_10006946 3300031241 Bacteria 6827
151 Ga0265316_10312701 3300031344 Bacteria 1142
152 Ga0307408_100888772 3300031548 Bacteria 815
153 Ga0265313_10009488 3300031595 Bacteria 6313
154 Ga0265313_10062568 3300031595 Bacteria 1738
155 Ga0316575_10025126 3300031665 Bacteria 2309
156 Ga0265314_10017279 3300031711 Bacteria 5666
157 Ga0265342_10000290 3300031712 Bacteria 56854
158 Ga0265342_10011669 3300031712 Bacteria 5994
159 Ga0373930_0038194 3300034816 Bacteria 1014
160 Ga0373934_0052894 3300035086 Bacteria 1611
161 Ga0373934_0058381 3300035086 Bacteria 1535
162 Ga0373944_0017801 3300035089 Bacteria 2022
163 Ga0373923_0000212 3300035111 Bacteria 12051
164 Ga0373936_0007522 3300035113 Bacteria 4098
165 Ga0373936_0025195 3300035113 Bacteria 2325
166 Ga0373953_0090149 3300035117 Bacteria 1282
167 Ga0373954_0003106 3300035118 Bacteria 7012
168 Ga0373954_0009492 3300035118 Bacteria 4279
169 Ga0373956_0025246 3300035119 Bacteria 2566
170 Ga0373957_0019025 3300035120 Bacteria 2411
171 Ga0373957_0019259 3300035120 Bacteria 2399
172 Ga0373960_0084308 3300035121 Bacteria 1006
173 Ga0373943_0001439 3300035170 Bacteria 10744
174 Ga0373946_0001549 3300035171 Bacteria 8013
175 Ga0373955_0000673 3300035172 Bacteria 14609
176 Ga0373955_0001617 3300035172 Bacteria 9649
177 Ga0373961_0003003 3300035241 Bacteria 4255
178 Ga0373961_0014560 3300035241 Bacteria 1999
179 Ga0373924_0004607 3300035410 Bacteria 4828
180 Ga0373924_0054708 3300035410 Bacteria 1660
181 Ga0373931_0030650 3300035691 Bacteria 2770
182 Ga0373931_0031210 3300035691 Bacteria 2749
183 Ga0373935_0000017 3300035692 Bacteria 70368
184 Ga0373935_0141811 3300035692 Bacteria 1624
185 Ga0373935_0290039 3300035692 Bacteria 1154
186 Ga0373927_0058369 3300035695 Bacteria 2496
187 Ga0373927_0140042 3300035695 Bacteria 1582
188 Ga0373933_0001228 3300035724 Bacteria 15165
189 Ga0373933_0003500 3300035724 Bacteria 8743
190 Ga0373933_0282290 3300035724 Bacteria 1073
191 Ga0373947_0001167 3300035725 Bacteria 16142
192 Ga0373947_0159369 3300035725 Bacteria 1458
193 Ga0373937_0000103 3300036401 Bacteria 80386
194 Ga0373937_0088746 3300036401 Bacteria 2863
195 Ga0373937_0708384 3300036401 Bacteria 953
196 Ga0373925_0000058 3300037068 Bacteria 122682
197 Ga0373925_0092625 3300037068 Bacteria 2312
198 Ga0436364_0089373 3300037853 Bacteria 6508
199 Ga0436364_0365187 3300037853 Bacteria 2644
200 Ga0436364_0801630 3300037853 Bacteria 13758
201 Ga0436365_1305481 3300039437 Unclassified 1641
202 Ga0436363_0340543 3300039450 Bacteria 2697
203 Ga0436363_0760042 3300039450 Bacteria 2565
204 Ga0436363_1620675 3300039450 Bacteria 17092
205 Ga0439453_0000481 3300041408 Bacteria 4376
206 Ga0439454_007764 3300042011 Bacteria 1353
207 Ga0439435_0000427 3300042436 Bacteria 6569
208 Ga0439444_0000069 3300042437 Bacteria 7681
209 Ga0439460_0006595 3300042461 Bacteria 2886
210 Ga0466967_0489885 3300045976 Bacteria 1205
211 Ga0495592_0000062 3300046454 Bacteria 99207
212 Ga0495629_0001807 3300046459 Bacteria 16771
213 Ga0495629_0496449 3300046459 Bacteria 823
214 Ga0495651_0001912 3300046462 Bacteria 16134
215 Ga0495651_0022500 3300046462 Bacteria 4899
216 Ga0495653_0000072 3300046463 Bacteria 85266
217 Ga0495582_0081487 3300046473 Bacteria 1797
218 Ga0495582_0112153 3300046473 Bacteria 1532
219 Ga0495662_0006876 3300046476 Bacteria 5654
220 Ga0495664_0000009 3300046477 Bacteria 289534
221 Ga0495608_0000061 3300046511 Bacteria 86891
222 Ga0495608_0042269 3300046511 Bacteria 3048
223 Ga0495618_0000061 3300046514 Bacteria 78337
224 Ga0495618_0259325 3300046514 Bacteria 1089
225 Ga0495628_0000012 3300046516 Bacteria 224162
226 Ga0495628_0085065 3300046516 Bacteria 2454
227 Ga0495652_0000021 3300046529 Bacteria 181454
228 Ga0495665_0158525 3300046531 Bacteria 1180
229 Ga0495640_0000028 3300046533 Bacteria 79904
230 Ga0495586_0049379 3300046535 Bacteria 2275
231 Ga0495587_0000033 3300046536 Bacteria 123885
232 Ga0495587_0093481 3300046536 Bacteria 1736
233 Ga0495645_0000017 3300046543 Bacteria 156865
234 Ga0495667_0000011 3300046559 Bacteria 222545
235 Ga0495667_0001149 3300046559 Bacteria 17261
236 Ga0495656_0063101 3300046615 Bacteria 1623
237 Ga0495634_0000220 3300046642 Bacteria 53609
238 Ga0495635_0000019 3300046663 Bacteria 193402
239 Ga0495657_0000378 3300046675 Bacteria 41496
240 Ga0495657_0073561 3300046675 Bacteria 2225
241 Ga0495599_0000024 3300046678 Bacteria 121388
242 Ga0495623_0000022 3300046679 Bacteria 98899
243 Ga0495623_0087501 3300046679 Bacteria 1919
244 Ga0495646_0000033 3300046680 Bacteria 83930
245 Ga0495613_0009938 3300046689 Bacteria 7072
246 Ga0495624_0045276 3300046690 Bacteria 2802
247 Ga0495670_0289195 3300046691 Bacteria 877
248 Ga0495600_0000028 3300046809 Bacteria 90661
249 Ga0495600_0017554 3300046809 Bacteria 4554
250 Ga0495581_0001914 3300047315 Bacteria 11661
251 Ga0495604_0000011 3300047317 Bacteria 292024
252 Ga0495674_0000015 3300047319 Bacteria 224071
253 Ga0495674_0189624 3300047319 Bacteria 1709
254 Ga0495680_0009066 3300047322 Bacteria 8982
255 Ga0495675_0000295 3300047444 Bacteria 35782
256 Ga0495675_0038070 3300047444 Bacteria 3063
257 Ga0495684_0000036 3300047471 Bacteria 107181
258 Ga0495593_0001674 3300047673 Bacteria 13131
259 Ga0495602_0000018 3300048088 Bacteria 183837
260 Ga0495602_0016134 3300048088 Bacteria 7517
261 Ga0496101_0213261 3300048904 Bacteria 1496
262 Ga0496103_0069488 3300048906 Bacteria 2202
263 Ga0496104_0142029 3300048907 Bacteria 2306
264 Ga0496104_0218403 3300048907 Bacteria 1818
265 Ga0496104_0727889 3300048907 Bacteria 899
266 Ga0496105_0160228 3300048908 Bacteria 1847
267 Ga0496106_0105934 3300048909 Bacteria 2185
268 Ga0496106_0597466 3300048909 Bacteria 884
269 Ga0496108_0631436 3300048911 Bacteria 932
270 Ga0496109_0140830 3300048912 Bacteria 2255
271 Ga0496110_0042236 3300048913 Bacteria 3980
272 Ga0496110_0218004 3300048913 Bacteria 1735
273 Ga0496110_0483518 3300048913 Bacteria 1128
274 Ga0496111_0023530 3300048914 Bacteria 4326
275 Ga0496112_0263098 3300048915 Bacteria 1674
276 Ga0496113_0151910 3300048916 Bacteria 1827
277 Ga0496115_0256362 3300048918 Bacteria 1439
278 Ga0501032_0179209 3300049569 Bacteria 1388
279 Ga0501033_0072596 3300049570 Bacteria 2527
280 Ga0501033_0107292 3300049570 Bacteria 2034
281 Ga0501033_0480918 3300049570 Bacteria 860
282 Ga0501034_0236159 3300049571 Bacteria 1776
283 Ga0501034_0293066 3300049571 Bacteria 1565
284 Ga0501034_0641050 3300049571 Bacteria 965
285 Ga0501034_0797125 3300049571 Bacteria 837
286 Ga0501036_0066148 3300049572 Bacteria 3058
287 Ga0501036_0203264 3300049572 Bacteria 1666
288 Ga0501037_0291288 3300049573 Bacteria 1135
289 Ga0501038_0097509 3300049574 Bacteria 2452
290 Ga0501039_0170893 3300049575 Bacteria 1709
291 Ga0501039_0433999 3300049575 Bacteria 1032
292 Ga0501040_0138180 3300049576 Bacteria 1716
293 Ga0501043_0280163 3300049579 Bacteria 1278
294 Ga0501047_0077151 3300049581 Bacteria 3206
295 Ga0501047_0531057 3300049581 Bacteria 1002
296 Ga0501048_0214449 3300049582 Bacteria 1365
297 Ga0501068_0146564 3300049584 Bacteria 1482
298 Ga0501069_0137244 3300049585 Bacteria 1402
299 Ga0501070_0009217 3300049586 Bacteria 8345
300 Ga0501070_0081886 3300049586 Bacteria 2671
301 Ga0501070_0130323 3300049586 Bacteria 2078
302 Ga0501070_0477379 3300049586 Bacteria 1003
303 Ga0501073_0009999 3300049589 Bacteria 6976
304 Ga0501073_0199476 3300049589 Bacteria 1384
305 Ga0501075_0350248 3300049591 Bacteria 1125
306 Ga0501076_0663495 3300049592 Bacteria 861
307 Ga0501080_0437903 3300049742 Bacteria 1173
308 Ga0501080_0576751 3300049742 Bacteria 1000
309 Ga0501083_0031949 3300049744 Bacteria 3611
310 Ga0501083_0119013 3300049744 Bacteria 1733
311 Ga0501083_0255360 3300049744 Bacteria 1141
312 Ga0501035_0263598 3300049822 Bacteria 1460
313 Ga0501035_0305519 3300049822 Bacteria 1339
314 Ga0501044_0006667 3300049823 Bacteria 12727
315 Ga0501044_0231041 3300049823 Bacteria 1797
316 nmdc:mga03n38_44727_c1 3300050490 Bacteria 1947
317 nmdc:mga00v17_79459_c1 3300050491 Bacteria 2046
318 nmdc:mga06z11_154305_c1 3300050494 Bacteria 1308
319 nmdc:mga05p37_5061_c2 3300050507 Bacteria 9847
320 nmdc:mga05p37_856863_c1 3300050507 Bacteria 986
321 nmdc:mga09592_32266_c1 3300050508 Bacteria 4367
322 nmdc:mga09592_473230_c1 3300050508 Unclassified 1080
323 nmdc:mga09592_95954_c1 3300050508 Bacteria 2537
324 nmdc:mga0qj67_120318_c1 3300050509 Bacteria 2123
325 nmdc:mga0qj67_573680_c1 3300050509 Bacteria 904
326 nmdc:mga0qj67_68462_c1 3300050509 Bacteria 2829
327 nmdc:mga06r32_223353_c1 3300050510 Bacteria 1872
328 nmdc:mga06r32_258692_c1 3300050510 Bacteria 1728
329 nmdc:mga06r32_417168_c1 3300050510 Bacteria 1324
330 nmdc:mga06r32_4869_c1 3300050510 Bacteria 12090
331 nmdc:mga08y16_23263_c1 3300050511 Bacteria 6543
332 nmdc:mga0rr50_168564_c1 3300050513 Bacteria 1782
333 nmdc:mga0rr50_357608_c1 3300050513 Bacteria 1229
334 nmdc:mga0rr50_461572_c1 3300050513 Bacteria 1077
335 nmdc:mga08x19_313044_c1 3300050514 Bacteria 1092
336 nmdc:mga08x19_60938_c1 3300050514 Bacteria 2445
337 nmdc:mga08x19_9079_c1 3300050514 Bacteria 5936
338 nmdc:mga0sz30_14618_c1 3300050516 Bacteria 3093
339 Ga0495601_0000024 3300053077 Bacteria 133160
340 Ga0495612_0000079 3300053078 Bacteria 44236
341 Ga0495612_0226582 3300053078 Bacteria 828
342 Ga0495595_0000036 3300053084 Bacteria 79035
343 Ga0495595_0010703 3300053084 Bacteria 3819
344 Ga0495619_0000034 3300053085 Bacteria 129851
345 Ga0495619_0041109 3300053085 Bacteria 3023
346 Ga0500595_010584 3300053119 Bacteria 3658
347 Ga0500616_0032987 3300053153 Bacteria 2828
348 Ga0501084_0235741 3300054114 Bacteria 1545
349 Ga0501082_0245198 3300060353 Bacteria 1559
350 2739355204 2738543032 Bacteria 5115625
351 nmdc:mga0n895_193044_c1
352 Ga0070658_10027714
353 Ga0070676_10033623
354 Ga0070680_100023831
355 Ga0070680_100031093
356 Ga0070680_100034462
357 Ga0070680_100351175
358 Ga0070682_100012075
359 Ga0070689_100004043
360 Ga0070661_100311439
361 Ga0070668_100474856
362 Ga0070669_100046064
363 Ga0070675_100043439
364 Ga0070675_100759884
365 Ga0070671_100361260
366 Ga0070674_100296318
367 Ga0070673_100116365
368 Ga0070667_100633346
369 Ga0070714_100089584
370 Ga0070714_100338980
371 Ga0070713_100307550
372 Ga0070701_10136866
373 Ga0070708_100408095
374 Ga0070663_100205026
375 Ga0070678_100298743
376 Ga0070681_10085223
377 Ga0070681_10490385
378 Ga0068867_100566831
379 Ga0070699_100001364
380 Ga0070699_100143716
381 Ga0070679_100020658
382 Ga0070679_100041995
383 Ga0070679_100057101
384 Ga0070679_100104158
385 Ga0070679_100447517
386 Ga0070697_100074049
387 Ga0068853_100000659
388 Ga0070672_100275392
389 Ga0070672_100611801
390 Ga0070695_100001361
391 Ga0070696_100045224
392 Ga0070693_100026277
393 Ga0070665_100401820
394 Ga0068855_100028216
395 Ga0068855_100072828
396 Ga0068856_100839803
397 Ga0068852_100741981
398 Ga0068864_100079401
399 Ga0068858_100186050
400 Ga0068860_100406978
401 Ga0081538_10003269
402 Ga0081540_1000233
403 Ga0081540_1004188
404 Ga0075365_10080508
405 Ga0075368_10035952
406 Ga0075363_100057984
407 Ga0075364_10228254
408 Ga0075364_10443860
409 Ga0070712_100028173
410 Ga0075362_10144462
411 Ga0075370_10189530
412 Ga0075428_100007549
413 Ga0075428_100044680
414 Ga0075428_100861905
415 Ga0075430_100074418
416 Ga0075430_100579529
417 Ga0075431_100005968
418 Ga0075431_100248348
419 Ga0075433_10015526
420 Ga0075429_100004465
421 Ga0075436_100000499
422 Ga0075436_100001270
423 Ga0075436_100033467
424 Ga0075435_100045945
425 Ga0075435_100317643
426 Ga0075435_100459788
427 Ga0099795_10048633
428 Ga0111539_10009844
429 Ga0111539_10208993
430 Ga0111539_10557202
431 Ga0105245_10581238
432 Ga0105247_10077046
433 Ga0114129_10012508
434 Ga0114129_10178163
435 Ga0105243_10085177
436 Ga0105241_10077806
437 Ga0105242_10066260
438 Ga0105237_10236795
439 Ga0105238_10247192
440 Ga0105239_10201935
441 Ga0157373_10014189
442 Ga0157373_10282007
443 Ga0157370_10017634
444 Ga0157370_10019638
445 Ga0157370_10073461
446 Ga0157369_10217018
447 Ga0157369_10823569
448 Ga0157378_11096397
449 Ga0163162_10436920
450 Ga0163162_10727191
451 Ga0157372_10006805
452 Ga0157372_10221038
453 Ga0157375_10394214
454 Ga0157380_10657260
455 Ga0157379_10084370
456 Ga0206356_11903661
457 Ga0213876_10258878
458 Ga0207688_10205970
459 Ga0207699_10017536
460 Ga0207645_10107561
461 Ga0207707_10034582
462 Ga0207693_10118804
463 Ga0207693_10307641
464 Ga0207660_10346395
465 Ga0207660_10384764
466 Ga0207657_10074308
467 Ga0207649_10026641
468 Ga0207646_10665532
469 Ga0207687_10219503
470 Ga0207700_10328229
471 Ga0207664_10193811
472 Ga0207706_10149309
473 Ga0207669_10207515
474 Ga0207669_10334178
475 Ga0207665_10096244
476 Ga0207711_10029441
477 Ga0207661_10256570
478 Ga0207667_10081619
479 Ga0207640_10274698
480 Ga0207703_10089652
481 Ga0207639_10016250
482 Ga0207678_10392595
483 Ga0207708_10227250
484 Ga0207676_10034018
485 Ga0207675_100273573
486 Ga0207683_10039842
487 Ga0209969_1000759
488 Ga0209967_1000554
489 Ga0209981_1006576
490 Ga0209996_1000669
491 Ga0209999_1005633
492 Ga0209970_1006947
493 Ga0209971_1001259
494 Ga0207428_10006244
495 Ga0268266_10220544
496 Ga0268264_10148835
497 Ga0265318_10100489
498 Ga0265338_10111528
499 Ga0265330_10030488
500 Ga0265325_10006946
501 Ga0265316_10312701
502 Ga0307408_100888772
503 Ga0265313_10009488
504 Ga0265313_10062568
505 Ga0316575_10025126
506 Ga0265314_10017279
507 Ga0265342_10000290
508 Ga0265342_10011669
509 Ga0373930_0038194
510 Ga0373934_0052894
511 Ga0373934_0058381
512 Ga0373944_0017801
513 Ga0373923_0000212
514 Ga0373936_0007522
515 Ga0373936_0025195
516 Ga0373953_0090149
517 Ga0373954_0003106
518 Ga0373954_0009492
519 Ga0373956_0025246
520 Ga0373957_0019025
521 Ga0373957_0019259
522 Ga0373960_0084308
523 Ga0373943_0001439
524 Ga0373946_0001549
525 Ga0373955_0000673
526 Ga0373955_0001617
527 Ga0373961_0003003
528 Ga0373961_0014560
529 Ga0373924_0004607
530 Ga0373924_0054708
531 Ga0373931_0030650
532 Ga0373931_0031210
533 Ga0373935_0000017
534 Ga0373935_0141811
535 Ga0373935_0290039
536 Ga0373927_0058369
537 Ga0373927_0140042
538 Ga0373933_0001228
539 Ga0373933_0003500
540 Ga0373933_0282290
541 Ga0373947_0001167
542 Ga0373947_0159369
543 Ga0373937_0000103
544 Ga0373937_0088746
545 Ga0373937_0708384
546 Ga0373925_0000058
547 Ga0373925_0092625
548 Ga0436364_0089373
549 Ga0436364_0365187
550 Ga0436364_0801630
551 Ga0436365_1305481
552 Ga0436363_0340543
553 Ga0436363_0760042
554 Ga0436363_1620675
555 Ga0439453_0000481
556 Ga0439454_007764
557 Ga0439435_0000427
558 Ga0439444_0000069
559 Ga0439460_0006595
560 Ga0466967_0489885
561 Ga0495592_0000062
562 Ga0495629_0001807
563 Ga0495629_0496449
564 Ga0495651_0001912
565 Ga0495651_0022500
566 Ga0495653_0000072
567 Ga0495582_0081487
568 Ga0495582_0112153
569 Ga0495662_0006876
570 Ga0495664_0000009
571 Ga0495608_0000061
572 Ga0495608_0042269
573 Ga0495618_0000061
574 Ga0495618_0259325
575 Ga0495628_0000012
576 Ga0495628_0085065
577 Ga0495652_0000021
578 Ga0495665_0158525
579 Ga0495640_0000028
580 Ga0495586_0049379
581 Ga0495587_0000033
582 Ga0495587_0093481
583 Ga0495645_0000017
584 Ga0495667_0000011
585 Ga0495667_0001149
586 Ga0495656_0063101
587 Ga0495634_0000220
588 Ga0495635_0000019
589 Ga0495657_0000378
590 Ga0495657_0073561
591 Ga0495599_0000024
592 Ga0495623_0000022
593 Ga0495623_0087501
594 Ga0495646_0000033
595 Ga0495613_0009938
596 Ga0495624_0045276
597 Ga0495670_0289195
598 Ga0495600_0000028
599 Ga0495600_0017554
600 Ga0495581_0001914
601 Ga0495604_0000011
602 Ga0495674_0000015
603 Ga0495674_0189624
604 Ga0495680_0009066
605 Ga0495675_0000295
606 Ga0495675_0038070
607 Ga0495684_0000036
608 Ga0495593_0001674
609 Ga0495602_0000018
610 Ga0495602_0016134
611 Ga0496101_0213261
612 Ga0496103_0069488
613 Ga0496104_0142029
614 Ga0496104_0218403
615 Ga0496104_0727889
616 Ga0496105_0160228
617 Ga0496106_0105934
618 Ga0496106_0597466
619 Ga0496108_0631436
620 Ga0496109_0140830
621 Ga0496110_0042236
622 Ga0496110_0218004
623 Ga0496110_0483518
624 Ga0496111_0023530
625 Ga0496112_0263098
626 Ga0496113_0151910
627 Ga0496115_0256362
628 Ga0501032_0179209
629 Ga0501033_0072596
630 Ga0501033_0107292
631 Ga0501033_0480918
632 Ga0501034_0236159
633 Ga0501034_0293066
634 Ga0501034_0641050
635 Ga0501034_0797125
636 Ga0501036_0066148
637 Ga0501036_0203264
638 Ga0501037_0291288
639 Ga0501038_0097509
640 Ga0501039_0170893
641 Ga0501039_0433999
642 Ga0501040_0138180
643 Ga0501043_0280163
644 Ga0501047_0077151
645 Ga0501047_0531057
646 Ga0501048_0214449
647 Ga0501068_0146564
648 Ga0501069_0137244
649 Ga0501070_0009217
650 Ga0501070_0081886
651 Ga0501070_0130323
652 Ga0501070_0477379
653 Ga0501073_0009999
654 Ga0501073_0199476
655 Ga0501075_0350248
656 Ga0501076_0663495
657 Ga0501080_0437903
658 Ga0501080_0576751
659 Ga0501083_0031949
660 Ga0501083_0119013
661 Ga0501083_0255360
662 Ga0501035_0263598
663 Ga0501035_0305519
664 Ga0501044_0006667
665 Ga0501044_0231041
666 nmdc:mga03n38_44727_c1
667 nmdc:mga00v17_79459_c1
668 nmdc:mga06z11_154305_c1
669 nmdc:mga05p37_5061_c2
670 nmdc:mga05p37_856863_c1
671 nmdc:mga09592_32266_c1
672 nmdc:mga09592_473230_c1
673 nmdc:mga09592_95954_c1
674 nmdc:mga0qj67_120318_c1
675 nmdc:mga0qj67_573680_c1
676 nmdc:mga0qj67_68462_c1
677 nmdc:mga06r32_223353_c1
678 nmdc:mga06r32_258692_c1
679 nmdc:mga06r32_417168_c1
680 nmdc:mga06r32_4869_c1
681 nmdc:mga08y16_23263_c1
682 nmdc:mga0rr50_168564_c1
683 nmdc:mga0rr50_357608_c1
684 nmdc:mga0rr50_461572_c1
685 nmdc:mga08x19_313044_c1
686 nmdc:mga08x19_60938_c1
687 nmdc:mga08x19_9079_c1
688 nmdc:mga0sz30_14618_c1
689 Ga0495601_0000024
690 Ga0495612_0000079
691 Ga0495612_0226582
692 Ga0495595_0000036
693 Ga0495595_0010703
694 Ga0495619_0000034
695 Ga0495619_0041109
696 Ga0500595_010584
697 Ga0500616_0032987
698 Ga0501084_0235741
699 Ga0501082_0245198
700 2739355204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

34

137

0.94

PF13534

Fer4_17

4Fe-4S dicluster domain

174

246

0.8

PF13183

Fer4_8

4Fe-4S dicluster domain

171

245

0.79

Map