F418373

General Info

Members Datasets Scaffolds Average Seq Length
350 212 350 160

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0021824|Ga0495647_0021824_1648_2202
Length 184
Sequence MNVSPELDARFRTAALAEGIVDVRYDVVASPVGDLLIAATDRGLARIHFDSDGQEEVLARIFGNRVLRAPIDEVRRELDEYFEGRRRDFDLALDLRVIPFNAEVLGELARVPYGTTTTYGALAAKVGRPGAARAIGTVMNRNPIPIVLPCHRVIGANGSLTGFGGGLHVKRFLLEHEGALLPIG

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.86
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c014234 3300000044 Bacteria 676
2 Ga0070658_10116771 3300005327 Bacteria 2215
3 Ga0070658_10128434 3300005327 Bacteria 2111
4 Ga0070658_10186604 3300005327 Bacteria 1747
5 Ga0070683_100134167 3300005329 Bacteria 2344
6 Ga0070683_100539676 3300005329 Bacteria 1115
7 Ga0070690_100183747 3300005330 Bacteria 1446
8 Ga0070680_101164338 3300005336 Bacteria 667
9 Ga0070682_101296606 3300005337 Bacteria 619
10 Ga0068868_100157293 3300005338 Bacteria 1875
11 Ga0068868_100453600 3300005338 Bacteria 1116
12 Ga0070660_100002191 3300005339 Bacteria 13468
13 Ga0070691_10033022 3300005341 Bacteria 2433
14 Ga0070687_100031678 3300005343 Bacteria 2596
15 Ga0070692_10024127 3300005345 Bacteria 2986
16 Ga0070692_10322743 3300005345 Bacteria 950
17 Ga0070674_100947129 3300005356 Bacteria 753
18 Ga0070673_101002629 3300005364 Bacteria 778
19 Ga0070659_100012695 3300005366 Bacteria 6249
20 Ga0070667_100531657 3300005367 Bacteria 1079
21 Ga0070703_10338310 3300005406 Bacteria 639
22 Ga0070709_10407825 3300005434 Bacteria 1016
23 Ga0070714_100044954 3300005435 Bacteria 3740
24 Ga0070701_10457294 3300005438 Bacteria 820
25 Ga0070711_100005648 3300005439 Bacteria 7491
26 Ga0070705_100212443 3300005440 Bacteria 1334
27 Ga0070705_100514661 3300005440 Bacteria 911
28 Ga0070694_100475444 3300005444 Bacteria 991
29 Ga0070708_100384915 3300005445 Bacteria 1323
30 Ga0070678_100927613 3300005456 Bacteria 797
31 Ga0070662_100018938 3300005457 Bacteria 4665
32 Ga0070662_100632667 3300005457 Bacteria 902
33 Ga0070662_101340211 3300005457 Bacteria 616
34 Ga0070681_10038363 3300005458 Bacteria 4803
35 Ga0070681_10704179 3300005458 Bacteria 926
36 Ga0068867_100934023 3300005459 Bacteria 783
37 Ga0070707_101255265 3300005468 Bacteria 707
38 Ga0070679_100535452 3300005530 Bacteria 1115
39 Ga0070679_100584134 3300005530 Bacteria 1061
40 Ga0070684_100208072 3300005535 Bacteria 1783
41 Ga0070684_100464168 3300005535 Bacteria 1171
42 Ga0068853_100555432 3300005539 Bacteria 1088
43 Ga0070686_100053483 3300005544 Bacteria 2578
44 Ga0070695_100108675 3300005545 Bacteria 1878
45 Ga0070693_100537013 3300005547 Bacteria 835
46 Ga0070665_101402810 3300005548 Bacteria 708
47 Ga0070704_100183069 3300005549 Bacteria 1677
48 Ga0068855_100070286 3300005563 Bacteria 4073
49 Ga0068855_100307994 3300005563 Bacteria 1753
50 Ga0068855_100474294 3300005563 Bacteria 1363
51 Ga0068854_100156820 3300005578 Bacteria 1760
52 Ga0068856_100057869 3300005614 Bacteria 3828
53 Ga0068856_100510563 3300005614 Bacteria 1223
54 Ga0068852_100385984 3300005616 Bacteria 1375
55 Ga0068866_10235368 3300005718 Bacteria 1113
56 Ga0068861_100017407 3300005719 Bacteria 5102
57 Ga0068858_100156304 3300005842 Bacteria 2146
58 Ga0081540_1003444 3300005983 Bacteria 12496
59 Ga0070717_10118015 3300006028 Bacteria 2270
60 Ga0070717_10387535 3300006028 Bacteria 1254
61 Ga0070715_10181690 3300006163 Bacteria 1055
62 Ga0070712_100013324 3300006175 Bacteria 5252
63 Ga0070712_100544032 3300006175 Bacteria 978
64 Ga0070712_101176018 3300006175 Bacteria 667
65 Ga0097621_101782230 3300006237 Bacteria 587
66 Ga0075428_100444733 3300006844 Bacteria 1388
67 Ga0075431_100083222 3300006847 Bacteria 3303
68 Ga0075434_100385199 3300006871 Bacteria 1423
69 Ga0075434_101632348 3300006871 Bacteria 653
70 Ga0075435_100108162 3300007076 Bacteria 2310
71 Ga0105240_10994125 3300009093 Bacteria 898
72 Ga0105245_10028350 3300009098 Bacteria 4939
73 Ga0105245_10039914 3300009098 Bacteria 4179
74 Ga0105245_11291923 3300009098 Bacteria 779
75 Ga0114129_10146905 3300009147 Bacteria 3229
76 Ga0114129_10290006 3300009147 Bacteria 2184
77 Ga0105243_10102375 3300009148 Bacteria 2379
78 Ga0105243_10347325 3300009148 Bacteria 1361
79 Ga0105243_10383393 3300009148 Bacteria 1301
80 Ga0105243_10386665 3300009148 Bacteria 1296
81 Ga0105241_10285170 3300009174 Unclassified 1412
82 Ga0105242_10332524 3300009176 Bacteria 1397
83 Ga0105242_11850001 3300009176 Bacteria 643
84 Ga0105248_10338473 3300009177 Bacteria 1694
85 Ga0105249_10008645 3300009553 Bacteria 8873
86 Ga0105249_10347654 3300009553 Bacteria 1501
87 Ga0105239_10465886 3300010375 Bacteria 1434
88 Ga0105239_10468507 3300010375 Bacteria 1430
89 Ga0157341_1011278 3300012494 Bacteria 771
90 Ga0157371_10215241 3300013102 Bacteria 1379
91 Ga0157371_10575488 3300013102 Bacteria 836
92 Ga0157374_10601854 3300013296 Bacteria 1109
93 Ga0157374_11547623 3300013296 Bacteria 687
94 Ga0163162_10041860 3300013306 Bacteria 4583
95 Ga0163162_10100128 3300013306 Bacteria 2989
96 Ga0163162_10937962 3300013306 Bacteria 977
97 Ga0157372_10372456 3300013307 Bacteria 1664
98 Ga0157372_10503419 3300013307 Bacteria 1412
99 Ga0157372_10579635 3300013307 Bacteria 1308
100 Ga0157372_11691975 3300013307 Bacteria 728
101 Ga0157375_10029806 3300013308 Bacteria 5136
102 Ga0157375_12673865 3300013308 Bacteria 597
103 Ga0157380_11704891 3300014326 Bacteria 688
104 Ga0182008_10187728 3300014497 Bacteria 1048
105 Ga0182008_10309178 3300014497 Bacteria 829
106 Ga0157376_10419588 3300014969 Bacteria 1298
107 Ga0157376_11531123 3300014969 Bacteria 700
108 Ga0182006_1058474 3300015261 Bacteria 1462
109 Ga0163161_10054189 3300017792 Bacteria 2910
110 Ga0206356_11899891 3300020070 Bacteria 770
111 Ga0213874_10036615 3300021377 Bacteria 1448
112 Ga0207642_10181549 3300025899 Bacteria 1147
113 Ga0207685_10367951 3300025905 Bacteria 729
114 Ga0207699_10321789 3300025906 Bacteria 1085
115 Ga0207705_10095190 3300025909 Bacteria 2185
116 Ga0207705_10156617 3300025909 Bacteria 1709
117 Ga0207705_10171289 3300025909 Bacteria 1635
118 Ga0207707_10014436 3300025912 Bacteria 6881
119 Ga0207693_10031021 3300025915 Bacteria 4222
120 Ga0207693_10050465 3300025915 Bacteria 3267
121 Ga0207662_10339972 3300025918 Bacteria 1006
122 Ga0207657_10001211 3300025919 Bacteria 27484
123 Ga0207657_10081976 3300025919 Bacteria 2708
124 Ga0207657_10148937 3300025919 Bacteria 1907
125 Ga0207652_10269419 3300025921 Bacteria 1536
126 Ga0207659_10407406 3300025926 Bacteria 1138
127 Ga0207687_10055423 3300025927 Bacteria 2778
128 Ga0207664_11464283 3300025929 Bacteria 604
129 Ga0207690_10221270 3300025932 Bacteria 1448
130 Ga0207706_10010619 3300025933 Bacteria 8412
131 Ga0207686_10139866 3300025934 Bacteria 1672
132 Ga0207709_10145512 3300025935 Bacteria 1635
133 Ga0207709_10465172 3300025935 Bacteria 980
134 Ga0207709_10661533 3300025935 Bacteria 832
135 Ga0207669_10685146 3300025937 Bacteria 841
136 Ga0207665_10484589 3300025939 Bacteria 953
137 Ga0207661_10490582 3300025944 Bacteria 1122
138 Ga0207667_10209514 3300025949 Bacteria 1998
139 Ga0207667_10499165 3300025949 Bacteria 1234
140 Ga0207667_11314323 3300025949 Bacteria 699
141 Ga0207651_11261710 3300025960 Bacteria 664
142 Ga0207712_10053347 3300025961 Bacteria 2836
143 Ga0207712_10462670 3300025961 Bacteria 1078
144 Ga0207668_10114589 3300025972 Bacteria 2029
145 Ga0207658_10296392 3300025986 Bacteria 1392
146 Ga0207677_10489380 3300026023 Bacteria 1061
147 Ga0207677_11239060 3300026023 Bacteria 684
148 Ga0207639_10352542 3300026041 Bacteria 1315
149 Ga0207639_10528760 3300026041 Bacteria 1081
150 Ga0207708_10025535 3300026075 Bacteria 4471
151 Ga0207648_10049825 3300026089 Bacteria 3663
152 Ga0207675_100012260 3300026118 Bacteria 8008
153 Ga0207698_11924137 3300026142 Bacteria 606
154 Ga0207428_10004473 3300027907 Bacteria 13256
155 Ga0268266_11329489 3300028379 Bacteria 694
156 Ga0268265_10297041 3300028380 Bacteria 1453
157 Ga0268264_12281930 3300028381 Bacteria 548
158 Ga0265318_10213710 3300028577 Bacteria 705
159 Ga0265338_10028409 3300028800 Bacteria 5578
160 Ga0265338_10084324 3300028800 Bacteria 2653
161 Ga0265338_10091457 3300028800 Bacteria 2513
162 Ga0265338_10151117 3300028800 Bacteria 1804
163 Ga0265325_10014715 3300031241 Bacteria 4414
164 Ga0265325_10018119 3300031241 Bacteria 3905
165 Ga0265329_10029234 3300031242 Bacteria 1802
166 Ga0265339_10251926 3300031249 Bacteria 854
167 Ga0265331_10032299 3300031250 Bacteria 2595
168 Ga0265327_10010337 3300031251 Bacteria 6578
169 Ga0265327_10169765 3300031251 Bacteria 1003
170 Ga0265316_10018436 3300031344 Bacteria 5997
171 Ga0265313_10002606 3300031595 Bacteria 15361
172 Ga0265313_10011937 3300031595 Bacteria 5359
173 Ga0265314_10003947 3300031711 Bacteria 14068
174 Ga0265314_10112789 3300031711 Unclassified 1725
175 Ga0265314_10123131 3300031711 Bacteria 1629
176 Ga0265314_10164609 3300031711 Bacteria 1345
177 Ga0265342_10017581 3300031712 Bacteria 4647
178 Ga0307405_10242429 3300031731 Bacteria 1336
179 Ga0307415_100576286 3300032126 Bacteria 997
180 Ga0373944_0046955 3300035089 Bacteria 1351
181 Ga0373936_0036495 3300035113 Bacteria 1961
182 Ga0373945_0002233 3300035116 Bacteria 6055
183 Ga0373943_0002076 3300035170 Bacteria 9095
184 Ga0373931_0078456 3300035691 Bacteria 1817
185 Ga0373935_0022159 3300035692 Bacteria 3893
186 Ga0373927_0081431 3300035695 Bacteria 2098
187 Ga0373947_0006355 3300035725 Bacteria 6865
188 Ga0373925_0005621 3300037068 Bacteria 9327
189 Ga0395899_0005240 3300037312 Bacteria 10077
190 Ga0395899_0070977 3300037312 Bacteria 2549
191 Ga0395900_0002072 3300037418 Bacteria 22505
192 Ga0395900_0004415 3300037418 Bacteria 14913
193 Ga0395900_0068512 3300037418 Bacteria 3646
194 Ga0395898_0000836 3300037466 Bacteria 50987
195 Ga0395898_0001549 3300037466 Bacteria 31627
196 Ga0395898_0016320 3300037466 Bacteria 7601
197 Ga0395898_0214501 3300037466 Bacteria 1836
198 Ga0395898_0361603 3300037466 Bacteria 1384
199 Ga0395898_0565281 3300037466 Bacteria 1080
200 Ga0395905_0006407 3300037471 Bacteria 11848
201 Ga0395905_0010007 3300037471 Bacteria 9242
202 Ga0395905_0023148 3300037471 Bacteria 5872
203 Ga0395905_0846162 3300037471 Bacteria 818
204 Ga0436364_0288632 3300037853 Bacteria 760
205 Ga0395901_0001774 3300038443 Bacteria 22253
206 Ga0395901_0002245 3300038443 Bacteria 19716
207 Ga0395901_0074776 3300038443 Bacteria 3534
208 Ga0395901_0082652 3300038443 Bacteria 3356
209 Ga0395901_1016672 3300038443 Bacteria 804
210 Ga0242420_005559 3300038996 Bacteria 1959
211 Ga0436365_0805085 3300039437 Bacteria 1041
212 Ga0436365_0870578 3300039437 Bacteria 1063
213 Ga0436363_0387852 3300039450 Bacteria 1294
214 Ga0436363_1345780 3300039450 Bacteria 1045
215 Ga0439448_0088958 3300042005 Bacteria 1042
216 Ga0439455_0173321 3300042012 Bacteria 620
217 Ga0439463_138718 3300042016 Bacteria 630
218 Ga0439458_0016822 3300042157 Bacteria 1665
219 Ga0466963_0294071 3300044694 Bacteria 1142
220 Ga0466964_0026727 3300044706 Bacteria 2261
221 Ga0466964_0041387 3300044706 Bacteria 1863
222 Ga0466964_0195763 3300044706 Bacteria 967
223 Ga0466964_0263490 3300044706 Bacteria 855
224 Ga0466968_0195155 3300044735 Unclassified 946
225 Ga0466957_0008824 3300044842 Bacteria 5741
226 Ga0466957_0159395 3300044842 Bacteria 1465
227 Ga0466957_1162721 3300044842 Bacteria 557
228 Ga0451576_0102293 3300045051 Bacteria 2980
229 Ga0466958_0175189 3300045836 Bacteria 1360
230 Ga0466958_0375716 3300045836 Bacteria 916
231 Ga0466967_0060260 3300045976 Bacteria 3362
232 Ga0466967_0118361 3300045976 Bacteria 2443
233 Ga0466967_0140318 3300045976 Bacteria 2250
234 Ga0466967_0156754 3300045976 Bacteria 2133
235 Ga0466967_0402991 3300045976 Bacteria 1331
236 Ga0466967_0421581 3300045976 Bacteria 1301
237 Ga0466967_0450849 3300045976 Bacteria 1257
238 Ga0466967_0846988 3300045976 Bacteria 908
239 Ga0466967_2039650 3300045976 Bacteria 570
240 Ga0495629_0000593 3300046459 Bacteria 29449
241 Ga0495641_0001017 3300046461 Bacteria 24111
242 Ga0495651_0049802 3300046462 Bacteria 3233
243 Ga0495653_0077468 3300046463 Bacteria 2468
244 Ga0495582_0000056 3300046473 Bacteria 57084
245 Ga0495582_0091435 3300046473 Bacteria 1697
246 Ga0495662_0005163 3300046476 Bacteria 6546
247 Ga0495662_0030396 3300046476 Bacteria 2607
248 Ga0495664_0104847 3300046477 Bacteria 1704
249 Ga0495594_0066092 3300046499 Bacteria 2006
250 Ga0495608_0033734 3300046511 Bacteria 3457
251 Ga0495628_0079227 3300046516 Bacteria 2554
252 Ga0495630_0013075 3300046517 Bacteria 6034
253 Ga0495652_0047239 3300046529 Bacteria 3692
254 Ga0495652_0876651 3300046529 Bacteria 593
255 Ga0495665_0000364 3300046531 Bacteria 22881
256 Ga0495640_0025293 3300046533 Bacteria 4308
257 Ga0495640_0118561 3300046533 Bacteria 1722
258 Ga0495587_0102856 3300046536 Bacteria 1644
259 Ga0495667_0039314 3300046559 Bacteria 3145
260 Ga0495667_0056966 3300046559 Bacteria 2569
261 Ga0495634_0099388 3300046642 Bacteria 1881
262 Ga0495634_0133559 3300046642 Bacteria 1580
263 Ga0495599_0040471 3300046678 Bacteria 2927
264 Ga0495646_0058278 3300046680 Bacteria 2309
265 Ga0495647_0021824 3300046681 Bacteria 2309
266 Ga0495658_0000615 3300046683 Bacteria 19383
267 Ga0495613_0000401 3300046689 Bacteria 37127
268 Ga0495624_0023782 3300046690 Bacteria 4037
269 Ga0495581_0004589 3300047315 Bacteria 7980
270 Ga0495604_0010914 3300047317 Bacteria 7213
271 Ga0495674_0026429 3300047319 Bacteria 5311
272 Ga0495674_0061228 3300047319 Bacteria 3281
273 Ga0495674_0162415 3300047319 Bacteria 1868
274 Ga0495676_0000415 3300047321 Bacteria 34646
275 Ga0495676_0205487 3300047321 Bacteria 1366
276 Ga0495680_0004249 3300047322 Bacteria 13751
277 Ga0495680_0008243 3300047322 Bacteria 9493
278 Ga0495684_0010685 3300047471 Bacteria 7097
279 Ga0495684_0017436 3300047471 Bacteria 5528
280 Ga0495593_0001438 3300047673 Bacteria 13969
281 Ga0495602_0193104 3300048088 Bacteria 1559
282 Ga0495614_0000769 3300048089 Bacteria 13583
283 Ga0496100_0000546 3300048903 Bacteria 17825
284 Ga0496101_0000331 3300048904 Bacteria 32370
285 Ga0496101_0064861 3300048904 Bacteria 2661
286 Ga0496101_0182151 3300048904 Bacteria 1618
287 Ga0496101_0260235 3300048904 Bacteria 1353
288 Ga0496102_0004008 3300048905 Bacteria 12472
289 Ga0496102_0012289 3300048905 Bacteria 7405
290 Ga0496102_0134441 3300048905 Bacteria 2317
291 Ga0496102_0281253 3300048905 Bacteria 1568
292 Ga0496102_0528293 3300048905 Bacteria 1102
293 Ga0496102_1253292 3300048905 Bacteria 661
294 Ga0496102_1490666 3300048905 Bacteria 595
295 Ga0496103_0343339 3300048906 Bacteria 960
296 Ga0496103_0701673 3300048906 Bacteria 641
297 Ga0496104_0007265 3300048907 Bacteria 9776
298 Ga0496104_0009079 3300048907 Bacteria 8839
299 Ga0496104_0023643 3300048907 Bacteria 5651
300 Ga0496105_0005763 3300048908 Bacteria 9441
301 Ga0496105_0064854 3300048908 Bacteria 3014
302 Ga0496105_0104654 3300048908 Bacteria 2337
303 Ga0496106_0002681 3300048909 Bacteria 13225
304 Ga0496106_0814593 3300048909 Bacteria 740
305 Ga0496107_0027388 3300048910 Bacteria 4047
306 Ga0496107_0133286 3300048910 Bacteria 1835
307 Ga0496107_0793949 3300048910 Bacteria 693
308 Ga0496108_0080040 3300048911 Bacteria 2767
309 Ga0496108_0164143 3300048911 Bacteria 1920
310 Ga0496108_0603736 3300048911 Bacteria 956
311 Ga0496109_0002305 3300048912 Bacteria 15886
312 Ga0496109_0006722 3300048912 Bacteria 9681
313 Ga0496109_0012487 3300048912 Bacteria 7334
314 Ga0496109_0460871 3300048912 Unclassified 1200
315 Ga0496110_0122683 3300048913 Bacteria 2342
316 Ga0496110_0516792 3300048913 Bacteria 1086
317 Ga0496111_0059191 3300048914 Bacteria 2775
318 Ga0496111_1003672 3300048914 Bacteria 598
319 Ga0496112_0003178 3300048915 Bacteria 13499
320 Ga0496112_0013061 3300048915 Bacteria 7661
321 Ga0496112_0051735 3300048915 Bacteria 4029
322 Ga0496112_0071450 3300048915 Bacteria 3430
323 Ga0496112_0084687 3300048915 Bacteria 3136
324 Ga0496112_0187792 3300048915 Bacteria 2030
325 Ga0496113_0020283 3300048916 Bacteria 4671
326 Ga0496113_0058304 3300048916 Bacteria 2905
327 Ga0496113_0112264 3300048916 Bacteria 2123
328 Ga0496113_1579432 3300048916 Bacteria 505
329 Ga0496114_0001098 3300048917 Bacteria 20419
330 Ga0496114_0006912 3300048917 Bacteria 8939
331 Ga0496114_0017360 3300048917 Bacteria 5808
332 Ga0496114_1035099 3300048917 Bacteria 705
333 Ga0496115_0012363 3300048918 Bacteria 6420
334 Ga0496115_0031234 3300048918 Bacteria 4195
335 Ga0501067_0073703 3300049583 Bacteria 1891
336 Ga0501069_0097601 3300049585 Bacteria 1666
337 Ga0501070_0000881 3300049586 Bacteria 27236
338 Ga0501080_0459135 3300049742 Bacteria 1141
339 nmdc:mga05p37_899560_c1 3300050507 Bacteria 955
340 nmdc:mga09592_1274601_c1 3300050508 Bacteria 605
341 nmdc:mga0qj67_948680_c1 3300050509 Bacteria 676
342 nmdc:mga06r32_21305_c1 3300050510 Bacteria 5983
343 nmdc:mga08y16_101664_c1 3300050511 Bacteria 2993
344 nmdc:mga0n895_25843_c1 3300050512 Bacteria 5554
345 nmdc:mga08x19_18321_c1 3300050514 Bacteria 4291
346 Ga0495601_0036592 3300053077 Bacteria 3066
347 Ga0495595_0001393 3300053084 Bacteria 9382
348 Ga0495595_0090514 3300053084 Bacteria 1467
349 Ga0495619_0000860 3300053085 Bacteria 19904
350 Ga0495619_0006009 3300053085 Bacteria 7689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042016 Ga0439463_138718 Ga0439463_138718_221_616 131
2 3300050508 nmdc:mga09592_1274601_c1 nmdc:mga09592_1274601_c1_182_577 131
3 3300048916 Ga0496113_1579432 Ga0496113_1579432_44_472 142
4 3300006175 Ga0070712_100544032 Ga0070712_1005440322 147
5 3300025915 Ga0207693_10050465 Ga0207693_100504653 147
6 3300035089 Ga0373944_0046955 Ga0373944_0046955_662_1210 147
7 3300035113 Ga0373936_0036495 Ga0373936_0036495_396_944 147
8 3300035116 Ga0373945_0002233 Ga0373945_0002233_2507_3055 147
9 3300035170 Ga0373943_0002076 Ga0373943_0002076_7570_8118 147
10 3300035692 Ga0373935_0022159 Ga0373935_0022159_3091_3639 147
11 3300035695 Ga0373927_0081431 Ga0373927_0081431_447_995 147
12 3300035725 Ga0373947_0006355 Ga0373947_0006355_5550_6098 147
13 3300037068 Ga0373925_0005621 Ga0373925_0005621_919_1467 147
14 3300046459 Ga0495629_0000593 Ga0495629_0000593_21656_22204 147
15 3300046461 Ga0495641_0001017 Ga0495641_0001017_11646_12194 147
16 3300046462 Ga0495651_0049802 Ga0495651_0049802_998_1546 147
17 3300046463 Ga0495653_0077468 Ga0495653_0077468_1127_1675 147
18 3300046473 Ga0495582_0000056 Ga0495582_0000056_52245_52793 147
19 3300046476 Ga0495662_0005163 Ga0495662_0005163_2357_2905 147
20 3300046476 Ga0495662_0030396 Ga0495662_0030396_166_714 147
21 3300046477 Ga0495664_0104847 Ga0495664_0104847_1111_1659 147
22 3300046499 Ga0495594_0066092 Ga0495594_0066092_1077_1625 147
23 3300046511 Ga0495608_0033734 Ga0495608_0033734_1778_2326 147
24 3300046516 Ga0495628_0079227 Ga0495628_0079227_1043_1591 147
25 3300046517 Ga0495630_0013075 Ga0495630_0013075_1901_2449 147
26 3300046529 Ga0495652_0047239 Ga0495652_0047239_236_784 147
27 3300046529 Ga0495652_0876651 Ga0495652_0876651_22_570 147
28 3300046531 Ga0495665_0000364 Ga0495665_0000364_4908_5456 147
29 3300046533 Ga0495640_0025293 Ga0495640_0025293_577_1125 147
30 3300046533 Ga0495640_0118561 Ga0495640_0118561_832_1380 147
31 3300046536 Ga0495587_0102856 Ga0495587_0102856_549_1097 147
32 3300046559 Ga0495667_0039314 Ga0495667_0039314_379_927 147
33 3300046559 Ga0495667_0056966 Ga0495667_0056966_983_1531 147
34 3300046642 Ga0495634_0099388 Ga0495634_0099388_653_1201 147
35 3300046642 Ga0495634_0133559 Ga0495634_0133559_66_614 147
36 3300046678 Ga0495599_0040471 Ga0495599_0040471_1981_2529 147
37 3300046680 Ga0495646_0058278 Ga0495646_0058278_192_740 147
38 3300046683 Ga0495658_0000615 Ga0495658_0000615_3967_4515 147
39 3300046689 Ga0495613_0000401 Ga0495613_0000401_32170_32718 147
40 3300046690 Ga0495624_0023782 Ga0495624_0023782_680_1228 147
41 3300047315 Ga0495581_0004589 Ga0495581_0004589_3264_3812 147
42 3300047317 Ga0495604_0010914 Ga0495604_0010914_2338_2886 147
43 3300047319 Ga0495674_0026429 Ga0495674_0026429_4084_4632 147
44 3300047319 Ga0495674_0061228 Ga0495674_0061228_490_1038 147
45 3300047319 Ga0495674_0162415 Ga0495674_0162415_148_696 147
46 3300047321 Ga0495676_0000415 Ga0495676_0000415_31744_32292 147
47 3300047322 Ga0495680_0004249 Ga0495680_0004249_3826_4374 147
48 3300047322 Ga0495680_0008243 Ga0495680_0008243_551_1099 147
49 3300047471 Ga0495684_0010685 Ga0495684_0010685_3265_3813 147
50 3300047471 Ga0495684_0017436 Ga0495684_0017436_1710_2258 147
51 3300047673 Ga0495593_0001438 Ga0495593_0001438_9592_10140 147
52 3300048088 Ga0495602_0193104 Ga0495602_0193104_325_873 147
53 3300048089 Ga0495614_0000769 Ga0495614_0000769_4409_4957 147
54 3300048904 Ga0496101_0260235 Ga0496101_0260235_234_782 147
55 3300048907 Ga0496104_0023643 Ga0496104_0023643_313_861 147
56 3300048908 Ga0496105_0104654 Ga0496105_0104654_1060_1608 147
57 3300048917 Ga0496114_0017360 Ga0496114_0017360_1509_2057 147
58 3300053077 Ga0495601_0036592 Ga0495601_0036592_848_1396 147
59 3300053084 Ga0495595_0001393 Ga0495595_0001393_4866_5414 147
60 3300053084 Ga0495595_0090514 Ga0495595_0090514_111_659 147
61 3300053085 Ga0495619_0000860 Ga0495619_0000860_3825_4373 147
62 3300053085 Ga0495619_0006009 Ga0495619_0006009_2355_2903 147
63 3300042012 Ga0439455_0173321 Ga0439455_0173321_31_582 148
64 3300046681 Ga0495647_0021824 Ga0495647_0021824_1648_2202 149
65 3300005614 Ga0068856_100510563 Ga0068856_1005105632 152
66 3300037312 Ga0395899_0070977 Ga0395899_0070977_1923_2381 152
67 3300037418 Ga0395900_0004415 Ga0395900_0004415_11764_12222 152
68 3300037466 Ga0395898_0000836 Ga0395898_0000836_47947_48405 152
69 3300037471 Ga0395905_0006407 Ga0395905_0006407_2096_2554 152
70 3300038443 Ga0395901_0074776 Ga0395901_0074776_1405_1863 152
71 3300039450 Ga0436363_0387852 Ga0436363_0387852_417_899 153
72 3300005327 Ga0070658_10128434 Ga0070658_101284342 154
73 3300005339 Ga0070660_100002191 Ga0070660_1000021918 154
74 3300005457 Ga0070662_101340211 Ga0070662_1013402111 154
75 3300005458 Ga0070681_10038363 Ga0070681_100383636 154
76 3300005458 Ga0070681_10704179 Ga0070681_107041792 154
77 3300005530 Ga0070679_100535452 Ga0070679_1005354522 154
78 3300005535 Ga0070684_100208072 Ga0070684_1002080722 154
79 3300005563 Ga0068855_100307994 Ga0068855_1003079943 154
80 3300009174 Ga0105241_10285170 Ga0105241_102851703 154
81 3300013102 Ga0157371_10575488 Ga0157371_105754881 154
82 3300013296 Ga0157374_10601854 Ga0157374_106018542 154
83 3300013307 Ga0157372_10579635 Ga0157372_105796352 154
84 3300013307 Ga0157372_11691975 Ga0157372_116919752 154
85 3300020070 Ga0206356_11899891 Ga0206356_118998911 154
86 3300025909 Ga0207705_10095190 Ga0207705_100951903 154
87 3300025912 Ga0207707_10014436 Ga0207707_100144365 154
88 3300025919 Ga0207657_10001211 Ga0207657_1000121113 154
89 3300025921 Ga0207652_10269419 Ga0207652_102694192 154
90 3300025949 Ga0207667_11314323 Ga0207667_113143231 154
91 3300028577 Ga0265318_10213710 Ga0265318_102137102 154
92 3300028800 Ga0265338_10091457 Ga0265338_100914573 154
93 3300031241 Ga0265325_10014715 Ga0265325_100147155 154
94 3300031250 Ga0265331_10032299 Ga0265331_100322993 154
95 3300031251 Ga0265327_10010337 Ga0265327_100103377 154
96 3300031344 Ga0265316_10018436 Ga0265316_100184363 154
97 3300031595 Ga0265313_10002606 Ga0265313_1000260615 154
98 3300031711 Ga0265314_10003947 Ga0265314_100039472 154
99 3300031712 Ga0265342_10017581 Ga0265342_100175813 154
100 3300037466 Ga0395898_0361603 Ga0395898_0361603_164_628 154
101 3300037466 Ga0395898_0565281 Ga0395898_0565281_395_862 154
102 3300037471 Ga0395905_0846162 Ga0395905_0846162_153_617 154
103 3300038443 Ga0395901_1016672 Ga0395901_1016672_251_718 154
104 3300047321 Ga0495676_0205487 Ga0495676_0205487_435_899 154
105 3300048905 Ga0496102_0012289 Ga0496102_0012289_676_1140 154
106 3300048905 Ga0496102_0281253 Ga0496102_0281253_363_827 154
107 3300048906 Ga0496103_0343339 Ga0496103_0343339_471_935 154
108 3300048909 Ga0496106_0814593 Ga0496106_0814593_33_497 154
109 3300048910 Ga0496107_0793949 Ga0496107_0793949_217_681 154
110 3300048911 Ga0496108_0080040 Ga0496108_0080040_50_514 154
111 3300048912 Ga0496109_0012487 Ga0496109_0012487_5656_6120 154
112 3300048913 Ga0496110_0516792 Ga0496110_0516792_306_770 154
113 3300048914 Ga0496111_1003672 Ga0496111_1003672_72_536 154
114 3300048915 Ga0496112_0003178 Ga0496112_0003178_3985_4449 154
115 3300048915 Ga0496112_0071450 Ga0496112_0071450_2703_3167 154
116 3300048916 Ga0496113_0058304 Ga0496113_0058304_1266_1730 154
117 3300048916 Ga0496113_0112264 Ga0496113_0112264_93_557 154
118 3300000044 ARSoilOldRDRAFT_c014234 ARSoilOldRDRAFT_0142341 155
119 3300005327 Ga0070658_10116771 Ga0070658_101167712 155
120 3300005327 Ga0070658_10186604 Ga0070658_101866043 155
121 3300005329 Ga0070683_100134167 Ga0070683_1001341676 155
122 3300005329 Ga0070683_100539676 Ga0070683_1005396762 155
123 3300005330 Ga0070690_100183747 Ga0070690_1001837474 155
124 3300005336 Ga0070680_101164338 Ga0070680_1011643382 155
125 3300005337 Ga0070682_101296606 Ga0070682_1012966061 155
126 3300005338 Ga0068868_100157293 Ga0068868_1001572933 155
127 3300005338 Ga0068868_100453600 Ga0068868_1004536002 155
128 3300005341 Ga0070691_10033022 Ga0070691_100330221 155
129 3300005343 Ga0070687_100031678 Ga0070687_1000316781 155
130 3300005345 Ga0070692_10024127 Ga0070692_100241276 155
131 3300005345 Ga0070692_10322743 Ga0070692_103227432 155
132 3300005356 Ga0070674_100947129 Ga0070674_1009471292 155
133 3300005364 Ga0070673_101002629 Ga0070673_1010026292 155
134 3300005366 Ga0070659_100012695 Ga0070659_1000126956 155
135 3300005367 Ga0070667_100531657 Ga0070667_1005316572 155
136 3300005406 Ga0070703_10338310 Ga0070703_103383101 155
137 3300005434 Ga0070709_10407825 Ga0070709_104078251 155
138 3300005435 Ga0070714_100044954 Ga0070714_1000449546 155
139 3300005438 Ga0070701_10457294 Ga0070701_104572941 155
140 3300005439 Ga0070711_100005648 Ga0070711_1000056482 155
141 3300005440 Ga0070705_100212443 Ga0070705_1002124433 155
142 3300005440 Ga0070705_100514661 Ga0070705_1005146612 155
143 3300005444 Ga0070694_100475444 Ga0070694_1004754442 155
144 3300005445 Ga0070708_100384915 Ga0070708_1003849153 155
145 3300005456 Ga0070678_100927613 Ga0070678_1009276132 155
146 3300005457 Ga0070662_100018938 Ga0070662_1000189383 155
147 3300005457 Ga0070662_100632667 Ga0070662_1006326672 155
148 3300005459 Ga0068867_100934023 Ga0068867_1009340231 155
149 3300005468 Ga0070707_101255265 Ga0070707_1012552651 155
150 3300005530 Ga0070679_100584134 Ga0070679_1005841342 155
151 3300005535 Ga0070684_100464168 Ga0070684_1004641682 155
152 3300005539 Ga0068853_100555432 Ga0068853_1005554322 155
153 3300005544 Ga0070686_100053483 Ga0070686_1000534833 155
154 3300005545 Ga0070695_100108675 Ga0070695_1001086752 155
155 3300005547 Ga0070693_100537013 Ga0070693_1005370131 155
156 3300005548 Ga0070665_101402810 Ga0070665_1014028102 155
157 3300005549 Ga0070704_100183069 Ga0070704_1001830691 155
158 3300005563 Ga0068855_100070286 Ga0068855_1000702862 155
159 3300005563 Ga0068855_100474294 Ga0068855_1004742943 155
160 3300005578 Ga0068854_100156820 Ga0068854_1001568202 155
161 3300005614 Ga0068856_100057869 Ga0068856_1000578694 155
162 3300005616 Ga0068852_100385984 Ga0068852_1003859843 155
163 3300005718 Ga0068866_10235368 Ga0068866_102353682 155
164 3300005719 Ga0068861_100017407 Ga0068861_1000174075 155
165 3300005842 Ga0068858_100156304 Ga0068858_1001563041 155
166 3300005983 Ga0081540_1003444 Ga0081540_100344410 155
167 3300006028 Ga0070717_10118015 Ga0070717_101180152 155
168 3300006028 Ga0070717_10387535 Ga0070717_103875352 155
169 3300006163 Ga0070715_10181690 Ga0070715_101816902 155
170 3300006175 Ga0070712_100013324 Ga0070712_1000133244 155
171 3300006175 Ga0070712_101176018 Ga0070712_1011760182 155
172 3300006237 Ga0097621_101782230 Ga0097621_1017822301 155
173 3300006844 Ga0075428_100444733 Ga0075428_1004447333 155
174 3300006847 Ga0075431_100083222 Ga0075431_1000832222 155
175 3300006871 Ga0075434_100385199 Ga0075434_1003851992 155
176 3300006871 Ga0075434_101632348 Ga0075434_1016323482 155
177 3300007076 Ga0075435_100108162 Ga0075435_1001081622 155
178 3300009093 Ga0105240_10994125 Ga0105240_109941252 155
179 3300009098 Ga0105245_10028350 Ga0105245_100283507 155
180 3300009098 Ga0105245_10039914 Ga0105245_100399142 155
181 3300009098 Ga0105245_11291923 Ga0105245_112919232 155
182 3300009147 Ga0114129_10146905 Ga0114129_101469053 155
183 3300009147 Ga0114129_10290006 Ga0114129_102900063 155
184 3300009148 Ga0105243_10102375 Ga0105243_101023752 155
185 3300009148 Ga0105243_10347325 Ga0105243_103473251 155
186 3300009148 Ga0105243_10383393 Ga0105243_103833933 155
187 3300009148 Ga0105243_10386665 Ga0105243_103866652 155
188 3300009176 Ga0105242_10332524 Ga0105242_103325243 155
189 3300009176 Ga0105242_11850001 Ga0105242_118500011 155
190 3300009177 Ga0105248_10338473 Ga0105248_103384733 155
191 3300009553 Ga0105249_10008645 Ga0105249_100086455 155
192 3300009553 Ga0105249_10347654 Ga0105249_103476542 155
193 3300010375 Ga0105239_10465886 Ga0105239_104658863 155
194 3300010375 Ga0105239_10468507 Ga0105239_104685073 155
195 3300012494 Ga0157341_1011278 Ga0157341_10112781 155
196 3300013102 Ga0157371_10215241 Ga0157371_102152412 155
197 3300013296 Ga0157374_11547623 Ga0157374_115476232 155
198 3300013306 Ga0163162_10041860 Ga0163162_100418603 155
199 3300013306 Ga0163162_10100128 Ga0163162_101001282 155
200 3300013306 Ga0163162_10937962 Ga0163162_109379621 155
201 3300013307 Ga0157372_10372456 Ga0157372_103724563 155
202 3300013307 Ga0157372_10503419 Ga0157372_105034194 155
203 3300013308 Ga0157375_10029806 Ga0157375_100298066 155
204 3300013308 Ga0157375_12673865 Ga0157375_126738651 155
205 3300014326 Ga0157380_11704891 Ga0157380_117048911 155
206 3300014497 Ga0182008_10187728 Ga0182008_101877282 155
207 3300014497 Ga0182008_10309178 Ga0182008_103091781 155
208 3300014969 Ga0157376_10419588 Ga0157376_104195882 155
209 3300014969 Ga0157376_11531123 Ga0157376_115311232 155
210 3300015261 Ga0182006_1058474 Ga0182006_10584741 155
211 3300017792 Ga0163161_10054189 Ga0163161_100541893 155
212 3300021377 Ga0213874_10036615 Ga0213874_100366152 155
213 3300025899 Ga0207642_10181549 Ga0207642_101815491 155
214 3300025905 Ga0207685_10367951 Ga0207685_103679511 155
215 3300025906 Ga0207699_10321789 Ga0207699_103217891 155
216 3300025909 Ga0207705_10156617 Ga0207705_101566172 155
217 3300025909 Ga0207705_10171289 Ga0207705_101712893 155
218 3300025915 Ga0207693_10031021 Ga0207693_100310214 155
219 3300025918 Ga0207662_10339972 Ga0207662_103399723 155
220 3300025919 Ga0207657_10081976 Ga0207657_100819762 155
221 3300025919 Ga0207657_10148937 Ga0207657_101489371 155
222 3300025926 Ga0207659_10407406 Ga0207659_104074062 155
223 3300025927 Ga0207687_10055423 Ga0207687_100554232 155
224 3300025929 Ga0207664_11464283 Ga0207664_114642831 155
225 3300025932 Ga0207690_10221270 Ga0207690_102212702 155
226 3300025933 Ga0207706_10010619 Ga0207706_1001061913 155
227 3300025934 Ga0207686_10139866 Ga0207686_101398661 155
228 3300025935 Ga0207709_10145512 Ga0207709_101455123 155
229 3300025935 Ga0207709_10465172 Ga0207709_104651722 155
230 3300025935 Ga0207709_10661533 Ga0207709_106615332 155
231 3300025937 Ga0207669_10685146 Ga0207669_106851462 155
232 3300025939 Ga0207665_10484589 Ga0207665_104845892 155
233 3300025944 Ga0207661_10490582 Ga0207661_104905822 155
234 3300025949 Ga0207667_10209514 Ga0207667_102095143 155
235 3300025949 Ga0207667_10499165 Ga0207667_104991652 155
236 3300025960 Ga0207651_11261710 Ga0207651_112617102 155
237 3300025961 Ga0207712_10053347 Ga0207712_100533474 155
238 3300025961 Ga0207712_10462670 Ga0207712_104626702 155
239 3300025972 Ga0207668_10114589 Ga0207668_101145892 155
240 3300025986 Ga0207658_10296392 Ga0207658_102963922 155
241 3300026023 Ga0207677_10489380 Ga0207677_104893802 155
242 3300026023 Ga0207677_11239060 Ga0207677_112390601 155
243 3300026041 Ga0207639_10352542 Ga0207639_103525422 155
244 3300026041 Ga0207639_10528760 Ga0207639_105287602 155
245 3300026075 Ga0207708_10025535 Ga0207708_100255352 155
246 3300026089 Ga0207648_10049825 Ga0207648_100498256 155
247 3300026118 Ga0207675_100012260 Ga0207675_1000122606 155
248 3300026142 Ga0207698_11924137 Ga0207698_119241371 155
249 3300027907 Ga0207428_10004473 Ga0207428_100044734 155
250 3300028379 Ga0268266_11329489 Ga0268266_113294892 155
251 3300028380 Ga0268265_10297041 Ga0268265_102970412 155
252 3300028381 Ga0268264_12281930 Ga0268264_122819301 155
253 3300028800 Ga0265338_10028409 Ga0265338_100284095 155
254 3300028800 Ga0265338_10084324 Ga0265338_100843243 155
255 3300028800 Ga0265338_10151117 Ga0265338_101511172 155
256 3300031241 Ga0265325_10018119 Ga0265325_100181192 155
257 3300031242 Ga0265329_10029234 Ga0265329_100292342 155
258 3300031249 Ga0265339_10251926 Ga0265339_102519261 155
259 3300031251 Ga0265327_10169765 Ga0265327_101697652 155
260 3300031595 Ga0265313_10011937 Ga0265313_100119372 155
261 3300031711 Ga0265314_10112789 Ga0265314_101127893 155
262 3300031711 Ga0265314_10123131 Ga0265314_101231312 155
263 3300031711 Ga0265314_10164609 Ga0265314_101646092 155
264 3300031731 Ga0307405_10242429 Ga0307405_102424292 155
265 3300032126 Ga0307415_100576286 Ga0307415_1005762862 155
266 3300035691 Ga0373931_0078456 Ga0373931_0078456_684_1151 155
267 3300037312 Ga0395899_0005240 Ga0395899_0005240_757_1224 155
268 3300037418 Ga0395900_0002072 Ga0395900_0002072_19621_20088 155
269 3300037418 Ga0395900_0068512 Ga0395900_0068512_1223_1690 155
270 3300037466 Ga0395898_0001549 Ga0395898_0001549_4954_5421 155
271 3300037466 Ga0395898_0016320 Ga0395898_0016320_4151_4618 155
272 3300037466 Ga0395898_0214501 Ga0395898_0214501_1071_1598 155
273 3300037471 Ga0395905_0010007 Ga0395905_0010007_6725_7192 155
274 3300037471 Ga0395905_0023148 Ga0395905_0023148_3359_3826 155
275 3300037853 Ga0436364_0288632 Ga0436364_0288632_276_743 155
276 3300038443 Ga0395901_0001774 Ga0395901_0001774_19765_20232 155
277 3300038443 Ga0395901_0002245 Ga0395901_0002245_8411_8878 155
278 3300038443 Ga0395901_0082652 Ga0395901_0082652_1719_2186 155
279 3300038996 Ga0242420_005559 Ga0242420_005559_329_799 155
280 3300039437 Ga0436365_0805085 Ga0436365_0805085_69_536 155
281 3300039437 Ga0436365_0870578 Ga0436365_0870578_436_903 155
282 3300039450 Ga0436363_1345780 Ga0436363_1345780_165_632 155
283 3300042005 Ga0439448_0088958 Ga0439448_0088958_149_616 155
284 3300042157 Ga0439458_0016822 Ga0439458_0016822_169_636 155
285 3300044694 Ga0466963_0294071 Ga0466963_0294071_304_771 155
286 3300044706 Ga0466964_0026727 Ga0466964_0026727_1653_2120 155
287 3300044706 Ga0466964_0041387 Ga0466964_0041387_158_625 155
288 3300044706 Ga0466964_0195763 Ga0466964_0195763_292_759 155
289 3300044706 Ga0466964_0263490 Ga0466964_0263490_89_556 155
290 3300044735 Ga0466968_0195155 Ga0466968_0195155_215_682 155
291 3300044842 Ga0466957_0008824 Ga0466957_0008824_169_636 155
292 3300044842 Ga0466957_0159395 Ga0466957_0159395_808_1278 155
293 3300044842 Ga0466957_1162721 Ga0466957_1162721_22_516 155
294 3300045051 Ga0451576_0102293 Ga0451576_0102293_2283_2750 155
295 3300045836 Ga0466958_0175189 Ga0466958_0175189_437_904 155
296 3300045836 Ga0466958_0375716 Ga0466958_0375716_405_899 155
297 3300045976 Ga0466967_0060260 Ga0466967_0060260_570_1037 155
298 3300045976 Ga0466967_0118361 Ga0466967_0118361_792_1259 155
299 3300045976 Ga0466967_0140318 Ga0466967_0140318_211_678 155
300 3300045976 Ga0466967_0156754 Ga0466967_0156754_1228_1695 155
301 3300045976 Ga0466967_0402991 Ga0466967_0402991_789_1259 155
302 3300045976 Ga0466967_0421581 Ga0466967_0421581_759_1226 155
303 3300045976 Ga0466967_0450849 Ga0466967_0450849_675_1142 155
304 3300045976 Ga0466967_0846988 Ga0466967_0846988_429_896 155
305 3300045976 Ga0466967_2039650 Ga0466967_2039650_24_512 155
306 3300046473 Ga0495582_0091435 Ga0495582_0091435_905_1375 155
307 3300048903 Ga0496100_0000546 Ga0496100_0000546_912_1379 155
308 3300048904 Ga0496101_0000331 Ga0496101_0000331_24159_24626 155
309 3300048904 Ga0496101_0064861 Ga0496101_0064861_585_1052 155
310 3300048904 Ga0496101_0182151 Ga0496101_0182151_968_1435 155
311 3300048905 Ga0496102_0004008 Ga0496102_0004008_5760_6227 155
312 3300048905 Ga0496102_0134441 Ga0496102_0134441_1000_1467 155
313 3300048905 Ga0496102_0528293 Ga0496102_0528293_605_1072 155
314 3300048905 Ga0496102_1253292 Ga0496102_1253292_183_650 155
315 3300048905 Ga0496102_1490666 Ga0496102_1490666_74_541 155
316 3300048906 Ga0496103_0701673 Ga0496103_0701673_58_525 155
317 3300048907 Ga0496104_0007265 Ga0496104_0007265_7616_8083 155
318 3300048907 Ga0496104_0009079 Ga0496104_0009079_8205_8672 155
319 3300048908 Ga0496105_0005763 Ga0496105_0005763_5757_6224 155
320 3300048908 Ga0496105_0064854 Ga0496105_0064854_914_1381 155
321 3300048909 Ga0496106_0002681 Ga0496106_0002681_423_890 155
322 3300048910 Ga0496107_0027388 Ga0496107_0027388_1018_1485 155
323 3300048910 Ga0496107_0133286 Ga0496107_0133286_562_1029 155
324 3300048911 Ga0496108_0164143 Ga0496108_0164143_706_1173 155
325 3300048911 Ga0496108_0603736 Ga0496108_0603736_356_832 155
326 3300048912 Ga0496109_0002305 Ga0496109_0002305_13415_13882 155
327 3300048912 Ga0496109_0006722 Ga0496109_0006722_6249_6716 155
328 3300048912 Ga0496109_0460871 Ga0496109_0460871_21_536 155
329 3300048913 Ga0496110_0122683 Ga0496110_0122683_1019_1486 155
330 3300048914 Ga0496111_0059191 Ga0496111_0059191_1669_2136 155
331 3300048915 Ga0496112_0013061 Ga0496112_0013061_6071_6538 155
332 3300048915 Ga0496112_0051735 Ga0496112_0051735_718_1185 155
333 3300048915 Ga0496112_0084687 Ga0496112_0084687_839_1306 155
334 3300048915 Ga0496112_0187792 Ga0496112_0187792_1398_1865 155
335 3300048916 Ga0496113_0020283 Ga0496113_0020283_745_1212 155
336 3300048917 Ga0496114_0001098 Ga0496114_0001098_6673_7140 155
337 3300048917 Ga0496114_0006912 Ga0496114_0006912_1146_1613 155
338 3300048917 Ga0496114_1035099 Ga0496114_1035099_90_557 155
339 3300048918 Ga0496115_0012363 Ga0496115_0012363_2334_2801 155
340 3300048918 Ga0496115_0031234 Ga0496115_0031234_532_999 155
341 3300049583 Ga0501067_0073703 Ga0501067_0073703_469_936 155
342 3300049585 Ga0501069_0097601 Ga0501069_0097601_787_1254 155
343 3300049586 Ga0501070_0000881 Ga0501070_0000881_26541_27008 155
344 3300049742 Ga0501080_0459135 Ga0501080_0459135_204_671 155
345 3300050507 nmdc:mga05p37_899560_c1 nmdc:mga05p37_899560_c1_467_934 155
346 3300050509 nmdc:mga0qj67_948680_c1 nmdc:mga0qj67_948680_c1_37_504 155
347 3300050510 nmdc:mga06r32_21305_c1 nmdc:mga06r32_21305_c1_4161_4628 155
348 3300050511 nmdc:mga08y16_101664_c1 nmdc:mga08y16_101664_c1_1119_1586 155
349 3300050512 nmdc:mga0n895_25843_c1 nmdc:mga0n895_25843_c1_1109_1576 155
350 3300050514 nmdc:mga08x19_18321_c1 nmdc:mga08x19_18321_c1_100_567 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

99

179

0.98

PF02870

Methyltransf_1N

6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

23

95

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyd-assembly2.cif.gz_A-3 crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna 0.8846 1 153
4zyd-assembly2.cif.gz_A-3 crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna 0.8792 1 153
4zye-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase 0.879 3 153
5llq-assembly2.cif.gz_B crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant 0.8763 3 149
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8748 1 150
ID Description Score Start End Superfamily
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9172 66 148 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8869 66 151 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8847 66 151 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8776 66 148 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8774 66 151 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538DH15-F1-model_v4 Cysteine methyltransferase 0.9792 1 82 GO:0003908
GO:0006281
GO:0032259
AF-A0A538DH15-F1-model_v4 Cysteine methyltransferase 0.9676 1 82 GO:0003908
GO:0006281
GO:0032259
AF-A0A537ZNS7-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase) 0.9603 1 155 GO:0003908
GO:0005737
GO:0006307
GO:0032259
AF-A0A7X4WNF4-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase) 0.9494 3 149 GO:0003908
GO:0005737
GO:0006307
GO:0032259
AF-A0A3L7XRB9-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase) 0.9478 2 152 GO:0003908
GO:0005737
GO:0006307
GO:0032259

Feature Viewer

pLDDT pTM Quality
88.8 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map