F418307

General Info

Members Datasets Scaffolds Average Seq Length
350 199 700 162

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100046915|Ga0307416_1000469152
Length 178
Sequence MASGETNTMPDETVDTSEQAAAADAAAQGPDAAELTRQRDDYYDRLLRKTAEFDNYRRRTDRERQQLADAAAADLIKDLLPLVDDLERALKADAGSEGDGAIRRGVELIHKQLVETLRKRGVSPIEALGQDFDPHFHNAVAYEPAEGRREGEVIEEFARGYMLGDRLLRPAMVKVAKA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.71
Nodule 0
Rhizoplane 2.86
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100046915 3300032002 Bacteria 3415
2 Ga0058859_11712943 3300004798 Bacteria 980
3 Ga0065712_10142444 3300005290 Bacteria 1438
4 Ga0065715_10004151 3300005293 Bacteria 5545
5 Ga0065715_10104932 3300005293 Bacteria 2899
6 Ga0065715_10110982 3300005293 Bacteria 2594
7 Ga0065715_10414671 3300005293 Bacteria 836
8 Ga0065707_10089426 3300005295 Bacteria 4372
9 Ga0065707_10116890 3300005295 Unclassified 2225
10 Ga0070676_10019777 3300005328 Bacteria 3751
11 Ga0070676_10113314 3300005328 Bacteria 1692
12 Ga0070690_100050086 3300005330 Bacteria 2664
13 Ga0070670_100012728 3300005331 Bacteria 7200
14 Ga0070670_100022880 3300005331 Bacteria 5377
15 Ga0070670_100138052 3300005331 Bacteria 2107
16 Ga0068869_100180950 3300005334 Bacteria 1652
17 Ga0068869_100294415 3300005334 Bacteria 1309
18 Ga0070666_10676916 3300005335 Bacteria 756
19 Ga0070680_100373023 3300005336 Bacteria 1214
20 Ga0068868_100065673 3300005338 Bacteria 2883
21 Ga0070689_100018595 3300005340 Bacteria 5123
22 Ga0070689_100170264 3300005340 Bacteria 1764
23 Ga0070691_10051238 3300005341 Bacteria 1971
24 Ga0070687_100010391 3300005343 Bacteria 4025
25 Ga0070687_100026763 3300005343 Bacteria 2780
26 Ga0070687_100030123 3300005343 Bacteria 2650
27 Ga0070692_10018452 3300005345 Bacteria 3357
28 Ga0070668_100012528 3300005347 Bacteria 6315
29 Ga0070668_100112726 3300005347 Bacteria 2166
30 Ga0070669_100001411 3300005353 Bacteria 17369
31 Ga0070669_100042452 3300005353 Bacteria 3309
32 Ga0070669_100067325 3300005353 Bacteria 2642
33 Ga0070675_100000062 3300005354 Bacteria 66400
34 Ga0070675_100027195 3300005354 Bacteria 4594
35 Ga0070675_100058417 3300005354 Bacteria 3182
36 Ga0070675_100272934 3300005354 Bacteria 1484
37 Ga0070675_101130001 3300005354 Unclassified 721
38 Ga0070675_101428409 3300005354 Bacteria 638
39 Ga0070671_100008260 3300005355 Bacteria 8333
40 Ga0070671_100019278 3300005355 Bacteria 5549
41 Ga0070674_100056132 3300005356 Bacteria 2730
42 Ga0070673_100002098 3300005364 Bacteria 12037
43 Ga0070673_100047044 3300005364 Bacteria 3354
44 Ga0070673_100142248 3300005364 Bacteria 2025
45 Ga0070673_100606421 3300005364 Bacteria 999
46 Ga0070688_100021271 3300005365 Unclassified 3787
47 Ga0070688_100106068 3300005365 Bacteria 1861
48 Ga0070688_100219958 3300005365 Bacteria 1338
49 Ga0070659_100037798 3300005366 Bacteria 3764
50 Ga0070667_100156147 3300005367 Bacteria 2007
51 Ga0070667_100228859 3300005367 Bacteria 1657
52 Ga0070713_100137595 3300005436 Bacteria 2160
53 Ga0070713_100625898 3300005436 Bacteria 1024
54 Ga0070713_101230998 3300005436 Bacteria 725
55 Ga0070701_10003375 3300005438 Bacteria 6311
56 Ga0070701_10080749 3300005438 Bacteria 1760
57 Ga0070701_10117906 3300005438 Bacteria 1492
58 Ga0070701_10125333 3300005438 Bacteria 1453
59 Ga0070705_100223715 3300005440 Bacteria 1305
60 Ga0070700_100061735 3300005441 Bacteria 2365
61 Ga0070700_100149364 3300005441 Bacteria 1596
62 Ga0070694_100034690 3300005444 Bacteria 3329
63 Ga0070694_100038490 3300005444 Unclassified 3179
64 Ga0070694_100349091 3300005444 Bacteria 1146
65 Ga0070662_100006804 3300005457 Bacteria 7389
66 Ga0070662_100027382 3300005457 Bacteria 3956
67 Ga0068867_100000315 3300005459 Bacteria 32014
68 Ga0068867_100017177 3300005459 Bacteria 5141
69 Ga0070685_10079724 3300005466 Bacteria 1960
70 Ga0070685_10096721 3300005466 Unclassified 1797
71 Ga0070698_100237479 3300005471 Unclassified 1756
72 Ga0070699_100963351 3300005518 Bacteria 782
73 Ga0070679_100426694 3300005530 Bacteria 1271
74 Ga0070697_100737860 3300005536 Bacteria 870
75 Ga0070672_100004735 3300005543 Bacteria 8928
76 Ga0070672_100016798 3300005543 Bacteria 5249
77 Ga0070672_100059661 3300005543 Bacteria 3002
78 Ga0070672_100100229 3300005543 Bacteria 2349
79 Ga0070686_100024902 3300005544 Unclassified 3592
80 Ga0070686_100321518 3300005544 Bacteria 1154
81 Ga0070695_100051078 3300005545 Bacteria 2652
82 Ga0070695_100158182 3300005545 Unclassified 1588
83 Ga0070693_100106143 3300005547 Bacteria 1719
84 Ga0070665_100551196 3300005548 Bacteria 1165
85 Ga0070704_100004567 3300005549 Bacteria 7999
86 Ga0070704_100324526 3300005549 Bacteria 1291
87 Ga0070664_100277920 3300005564 Bacteria 1510
88 Ga0070664_100409072 3300005564 Bacteria 1241
89 Ga0070664_100643722 3300005564 Bacteria 985
90 Ga0068857_100021067 3300005577 Bacteria 5735
91 Ga0068854_100046814 3300005578 Bacteria 3081
92 Ga0070702_100058921 3300005615 Bacteria 2226
93 Ga0068852_100077726 3300005616 Bacteria 2934
94 Ga0068852_100345643 3300005616 Bacteria 1451
95 Ga0068859_100002444 3300005617 Bacteria 18914
96 Ga0068859_100056586 3300005617 Bacteria 3948
97 Ga0068864_100010243 3300005618 Bacteria 7742
98 Ga0068864_100037971 3300005618 Bacteria 4111
99 Ga0068864_100085902 3300005618 Bacteria 2767
100 Ga0068864_101633079 3300005618 Bacteria 649
101 Ga0068866_10081916 3300005718 Bacteria 1735
102 Ga0068861_100019046 3300005719 Bacteria 4899
103 Ga0068861_100125034 3300005719 Bacteria 2080
104 Ga0068870_10070701 3300005840 Bacteria 1903
105 Ga0068870_10120093 3300005840 Bacteria 1513
106 Ga0068863_100048103 3300005841 Bacteria 4044
107 Ga0068863_100079811 3300005841 Bacteria 3099
108 Ga0068863_100191808 3300005841 Bacteria 1964
109 Ga0068858_100043133 3300005842 Bacteria 4183
110 Ga0068860_100052847 3300005843 Bacteria 3863
111 Ga0068860_100122154 3300005843 Bacteria 2495
112 Ga0068862_100002685 3300005844 Bacteria 15641
113 Ga0068862_100040461 3300005844 Bacteria 3962
114 Ga0068862_100105768 3300005844 Bacteria 2466
115 Ga0068862_100439784 3300005844 Bacteria 1227
116 Ga0070717_10448334 3300006028 Bacteria 1163
117 Ga0075365_10003979 3300006038 Bacteria 7739
118 Ga0075365_10112777 3300006038 Bacteria 1870
119 Ga0075368_10008837 3300006042 Bacteria 3607
120 Ga0075368_10090584 3300006042 Bacteria 1251
121 Ga0075368_10233141 3300006042 Bacteria 784
122 Ga0075364_10002343 3300006051 Bacteria 10639
123 Ga0075364_10007626 3300006051 Bacteria 6433
124 Ga0075364_10446175 3300006051 Bacteria 884
125 Ga0075367_10031742 3300006178 Bacteria 3035
126 Ga0075367_10172742 3300006178 Bacteria 1346
127 Ga0075366_10004428 3300006195 Bacteria 7538
128 Ga0075366_10018759 3300006195 Bacteria 3997
129 Ga0097621_100090141 3300006237 Bacteria 2565
130 Ga0097621_100243600 3300006237 Bacteria 1572
131 Ga0075370_10275053 3300006353 Bacteria 1000
132 Ga0068871_100510905 3300006358 Bacteria 1084
133 Ga0075428_100034259 3300006844 Bacteria 5602
134 Ga0075428_100213523 3300006844 Bacteria 2085
135 Ga0075428_100704289 3300006844 Unclassified 1076
136 Ga0075433_10023560 3300006852 Bacteria 5184
137 Ga0075433_10719474 3300006852 Bacteria 874
138 Ga0075434_100224149 3300006871 Bacteria 1900
139 Ga0075434_100519767 3300006871 Bacteria 1211
140 Ga0075429_100290429 3300006880 Unclassified 1432
141 Ga0068865_100373588 3300006881 Unclassified 1161
142 Ga0068865_101113495 3300006881 Bacteria 696
143 Ga0075436_100466316 3300006914 Bacteria 921
144 Ga0097620_100002444 3300006931 Bacteria 18914
145 Ga0097620_100056586 3300006931 Bacteria 3948
146 Ga0075435_100013654 3300007076 Bacteria 6051
147 Ga0075435_100030615 3300007076 Bacteria 4233
148 Ga0111539_10040027 3300009094 Bacteria 5645
149 Ga0111539_10875942 3300009094 Unclassified 1044
150 Ga0111539_11627831 3300009094 Bacteria 749
151 Ga0111539_12285480 3300009094 Bacteria 627
152 Ga0105245_10030233 3300009098 Bacteria 4790
153 Ga0105247_10471858 3300009101 Bacteria 909
154 Ga0114129_10007832 3300009147 Bacteria 15200
155 Ga0114129_11075243 3300009147 Bacteria 1008
156 Ga0105243_10643128 3300009148 Unclassified 1027
157 Ga0105241_10471152 3300009174 Bacteria 1114
158 Ga0105242_10007442 3300009176 Bacteria 8430
159 Ga0105248_10039556 3300009177 Bacteria 5283
160 Ga0105248_11051104 3300009177 Bacteria 920
161 Ga0105238_10748854 3300009551 Bacteria 991
162 Ga0105249_10003393 3300009553 Bacteria 13797
163 Ga0105249_10226800 3300009553 Unclassified 1841
164 Ga0105239_10022464 3300010375 Bacteria 6954
165 Ga0157378_10183813 3300013297 Bacteria 1968
166 Ga0157378_11169687 3300013297 Bacteria 808
167 Ga0163162_10138160 3300013306 Unclassified 2548
168 Ga0157375_10002792 3300013308 Bacteria 15108
169 Ga0157375_10357941 3300013308 Bacteria 1625
170 Ga0157375_10903684 3300013308 Bacteria 1027
171 Ga0163163_10055264 3300014325 Bacteria 3924
172 Ga0157380_10354375 3300014326 Bacteria 1374
173 Ga0157377_10208353 3300014745 Bacteria 1245
174 Ga0157377_10539979 3300014745 Bacteria 822
175 Ga0157379_10408811 3300014968 Bacteria 1248
176 Ga0207697_10035362 3300025315 Bacteria 2045
177 Ga0207656_10050170 3300025321 Bacteria 1801
178 Ga0207653_10057918 3300025885 Bacteria 1301
179 Ga0207642_10046766 3300025899 Bacteria 1930
180 Ga0207688_10023239 3300025901 Bacteria 3394
181 Ga0207680_10065758 3300025903 Bacteria 2227
182 Ga0207645_10017347 3300025907 Bacteria 4753
183 Ga0207645_10040043 3300025907 Unclassified 3001
184 Ga0207643_10025038 3300025908 Bacteria 3296
185 Ga0207643_10029273 3300025908 Bacteria 3063
186 Ga0207660_10557196 3300025917 Bacteria 932
187 Ga0207662_10002545 3300025918 Bacteria 9183
188 Ga0207662_10053449 3300025918 Bacteria 2406
189 Ga0207681_10003933 3300025923 Bacteria 9212
190 Ga0207681_10097499 3300025923 Bacteria 2113
191 Ga0207681_10100446 3300025923 Bacteria 2085
192 Ga0207650_10039744 3300025925 Bacteria 3438
193 Ga0207650_10050685 3300025925 Bacteria 3071
194 Ga0207659_10000349 3300025926 Bacteria 27566
195 Ga0207659_10002000 3300025926 Bacteria 12076
196 Ga0207659_10015494 3300025926 Bacteria 4942
197 Ga0207659_10456738 3300025926 Bacteria 1077
198 Ga0207659_10754010 3300025926 Bacteria 835
199 Ga0207687_10255241 3300025927 Bacteria 1396
200 Ga0207644_10030966 3300025931 Bacteria 3725
201 Ga0207690_10035508 3300025932 Bacteria 3221
202 Ga0207706_10011987 3300025933 Bacteria 7898
203 Ga0207706_10012026 3300025933 Bacteria 7886
204 Ga0207709_10411651 3300025935 Bacteria 1036
205 Ga0207670_10017147 3300025936 Bacteria 4372
206 Ga0207670_10085100 3300025936 Bacteria 2221
207 Ga0207670_10545705 3300025936 Bacteria 946
208 Ga0207669_10027904 3300025937 Bacteria 3098
209 Ga0207704_10020824 3300025938 Bacteria 3478
210 Ga0207704_10274375 3300025938 Bacteria 1278
211 Ga0207704_11139950 3300025938 Bacteria 663
212 Ga0207691_10009582 3300025940 Bacteria 9296
213 Ga0207691_10011573 3300025940 Bacteria 8472
214 Ga0207691_10025969 3300025940 Bacteria 5497
215 Ga0207691_10103136 3300025940 Bacteria 2544
216 Ga0207711_10051320 3300025941 Bacteria 3532
217 Ga0207689_10044587 3300025942 Bacteria 3667
218 Ga0207689_10514531 3300025942 Bacteria 1003
219 Ga0207661_11567590 3300025944 Bacteria 603
220 Ga0207679_10256308 3300025945 Bacteria 1490
221 Ga0207679_10295839 3300025945 Bacteria 1393
222 Ga0207651_10005866 3300025960 Bacteria 6351
223 Ga0207651_10034435 3300025960 Bacteria 3280
224 Ga0207651_10370210 3300025960 Bacteria 1212
225 Ga0207712_10017505 3300025961 Bacteria 4655
226 Ga0207712_10180125 3300025961 Bacteria 1659
227 Ga0207668_10038007 3300025972 Bacteria 3227
228 Ga0207668_10182003 3300025972 Bacteria 1659
229 Ga0207640_10364085 3300025981 Bacteria 1166
230 Ga0207640_10602245 3300025981 Unclassified 930
231 Ga0207640_10657659 3300025981 Bacteria 894
232 Ga0207658_10250985 3300025986 Bacteria 1503
233 Ga0207658_11050199 3300025986 Bacteria 744
234 Ga0207703_10035312 3300026035 Bacteria 3973
235 Ga0207678_10144149 3300026067 Bacteria 2033
236 Ga0207678_10526586 3300026067 Bacteria 1032
237 Ga0207708_10001724 3300026075 Bacteria 16171
238 Ga0207708_10128793 3300026075 Bacteria 1977
239 Ga0207708_10644387 3300026075 Bacteria 901
240 Ga0207641_10019016 3300026088 Bacteria 5635
241 Ga0207641_10081930 3300026088 Bacteria 2803
242 Ga0207641_10581837 3300026088 Bacteria 1094
243 Ga0207648_10000927 3300026089 Bacteria 33036
244 Ga0207648_10002141 3300026089 Bacteria 21470
245 Ga0207676_10004074 3300026095 Bacteria 10303
246 Ga0207676_10019834 3300026095 Bacteria 4912
247 Ga0207676_10052452 3300026095 Bacteria 3188
248 Ga0207676_10090856 3300026095 Bacteria 2507
249 Ga0207676_10600076 3300026095 Bacteria 1057
250 Ga0207674_10016823 3300026116 Bacteria 7992
251 Ga0207674_10148232 3300026116 Bacteria 2304
252 Ga0207675_100002209 3300026118 Bacteria 19340
253 Ga0207675_100027560 3300026118 Bacteria 5291
254 Ga0207683_10032856 3300026121 Bacteria 4508
255 Ga0209813_10098547 3300027866 Bacteria 991
256 Ga0207428_10005379 3300027907 Bacteria 11948
257 Ga0207428_10103365 3300027907 Bacteria 2199
258 Ga0268265_10000073 3300028380 Bacteria 128856
259 Ga0268265_10083778 3300028380 Bacteria 2526
260 Ga0268265_10461958 3300028380 Bacteria 1188
261 Ga0268265_10610307 3300028380 Bacteria 1044
262 Ga0268264_10027857 3300028381 Bacteria 4619
263 Ga0268264_10043719 3300028381 Bacteria 3714
264 Ga0268264_10509774 3300028381 Bacteria 1174
265 Ga0307407_10695870 3300031903 Bacteria 765
266 Ga0307409_100706328 3300031995 Bacteria 1008
267 Ga0307416_100100815 3300032002 Bacteria 2513
268 Ga0373932_0171425 3300035112 Bacteria 756
269 Ga0373936_0112892 3300035113 Bacteria 1155
270 Ga0373939_0013366 3300035114 Bacteria 2111
271 Ga0373960_0037602 3300035121 Bacteria 1384
272 Ga0373943_0279117 3300035170 Bacteria 944
273 Ga0373943_0390058 3300035170 Bacteria 803
274 Ga0373955_0611449 3300035172 Bacteria 668
275 Ga0373961_0042511 3300035241 Bacteria 1318
276 Ga0373962_0044468 3300035242 Bacteria 1261
277 Ga0373931_0227611 3300035691 Bacteria 1125
278 Ga0373933_0549901 3300035724 Bacteria 757
279 Ga0373937_0068409 3300036401 Bacteria 3274
280 Ga0373937_0313234 3300036401 Bacteria 1485
281 Ga0373925_0002221 3300037068 Bacteria 15748
282 Ga0439462_0116578 3300042015 Unclassified 741
283 Ga0439462_0141423 3300042015 Bacteria 674
284 Ga0450923_106872 3300042125 Bacteria 650
285 Ga0439446_0067577 3300042156 Bacteria 1089
286 Ga0439444_0117211 3300042437 Bacteria 618
287 Ga0495603_0011546 3300046455 Bacteria 5344
288 Ga0495580_0774561 3300046472 Bacteria 623
289 Ga0495582_0575304 3300046473 Bacteria 652
290 Ga0495594_0028868 3300046499 Bacteria 2995
291 Ga0495609_0268890 3300046538 Bacteria 699
292 Ga0495621_0002219 3300046539 Bacteria 5187
293 Ga0495645_0408588 3300046543 Bacteria 864
294 Ga0495659_0002796 3300046664 Bacteria 5606
295 Ga0495588_0000846 3300046674 Bacteria 13529
296 Ga0495613_0115938 3300046689 Bacteria 1927
297 Ga0495684_0485027 3300047471 Bacteria 853
298 Ga0496102_0214807 3300048905 Bacteria 1813
299 Ga0496104_0282554 3300048907 Unclassified 1573
300 Ga0496106_0250587 3300048909 Bacteria 1416
301 Ga0496108_0114776 3300048911 Bacteria 2306
302 Ga0496108_0848922 3300048911 Bacteria 786
303 Ga0496109_0242962 3300048912 Bacteria 1695
304 Ga0496109_0285432 3300048912 Bacteria 1556
305 Ga0496112_0033386 3300048915 Bacteria 5003
306 Ga0496113_0090135 3300048916 Bacteria 2362
307 Ga0496113_0193503 3300048916 Bacteria 1615
308 Ga0501034_0004870 3300049571 Bacteria 14811
309 Ga0501036_0924681 3300049572 Bacteria 715
310 Ga0501043_0394839 3300049579 Bacteria 1046
311 Ga0501067_0193030 3300049583 Bacteria 1134
312 Ga0501068_0132334 3300049584 Bacteria 1560
313 Ga0501074_0820448 3300049590 Bacteria 655
314 Ga0501079_0165570 3300049741 Bacteria 1724
315 Ga0501081_0305985 3300049743 Bacteria 1166
316 Ga0501081_0580756 3300049743 Bacteria 838
317 nmdc:mga03683_21687_c1 3300050489 Bacteria 2481
318 nmdc:mga00v17_428983_c1 3300050491 Bacteria 859
319 nmdc:mga00v17_5662_c1 3300050491 Bacteria 6594
320 nmdc:mga0yw44_255055_c1 3300050492 Bacteria 1168
321 nmdc:mga0yw44_31871_c1 3300050492 Bacteria 3068
322 nmdc:mga0k408_20915_c1 3300050493 Bacteria 3672
323 nmdc:mga0k408_351480_c1 3300050493 Bacteria 879
324 nmdc:mga06z11_185504_c1 3300050494 Bacteria 1202
325 nmdc:mga06z11_7778_c1 3300050494 Bacteria 4429
326 nmdc:mga04h51_159432_c1 3300050495 Bacteria 867
327 nmdc:mga04h51_199363_c1 3300050495 Bacteria 786
328 nmdc:mga04h51_438463_c1 3300050495 Bacteria 551
329 nmdc:mga05p37_1238_c1 3300050507 Bacteria 29628
330 nmdc:mga05p37_805878_c1 3300050507 Bacteria 1027
331 nmdc:mga05p37_856862_c1 3300050507 Unclassified 986
332 nmdc:mga09592_551684_c1 3300050508 Unclassified 990
333 nmdc:mga08y16_1484188_c1 3300050511 Bacteria 639
334 nmdc:mga08y16_270780_c1 3300050511 Unclassified 1753
335 nmdc:mga08y16_475_c1 3300050511 Bacteria 37006
336 nmdc:mga0n895_120886_c1 3300050512 Bacteria 2640
337 nmdc:mga0n895_499688_c1 3300050512 Bacteria 1225
338 nmdc:mga0n895_72599_c1 3300050512 Bacteria 3414
339 nmdc:mga0rr50_44696_c1 3300050513 Bacteria 3251
340 nmdc:mga0rr50_600801_c1 3300050513 Bacteria 938
341 nmdc:mga0rr50_74056_c1 3300050513 Bacteria 2605
342 nmdc:mga08x19_168858_c1 3300050514 Bacteria 1489
343 nmdc:mga0a205_1127894_c1 3300050515 Bacteria 632
344 nmdc:mga0a205_25113_c1 3300050515 Bacteria 5673
345 Ga0495619_0098091 3300053085 Bacteria 1992
346 Ga0500628_031686 3300053129 Unclassified 1152
347 Ga0590071_004191 3300059421 Bacteria 3513
348 Ga0590074_036356 3300059423 Bacteria 879
349 Ga0501082_1100498 3300060353 Bacteria 695
350 Ga0530510_0244733 3300061734 Bacteria 1336
351 Ga0307416_100046915
352 Ga0058859_11712943
353 Ga0065712_10142444
354 Ga0065715_10004151
355 Ga0065715_10104932
356 Ga0065715_10110982
357 Ga0065715_10414671
358 Ga0065707_10089426
359 Ga0065707_10116890
360 Ga0070676_10019777
361 Ga0070676_10113314
362 Ga0070690_100050086
363 Ga0070670_100012728
364 Ga0070670_100022880
365 Ga0070670_100138052
366 Ga0068869_100180950
367 Ga0068869_100294415
368 Ga0070666_10676916
369 Ga0070680_100373023
370 Ga0068868_100065673
371 Ga0070689_100018595
372 Ga0070689_100170264
373 Ga0070691_10051238
374 Ga0070687_100010391
375 Ga0070687_100026763
376 Ga0070687_100030123
377 Ga0070692_10018452
378 Ga0070668_100012528
379 Ga0070668_100112726
380 Ga0070669_100001411
381 Ga0070669_100042452
382 Ga0070669_100067325
383 Ga0070675_100000062
384 Ga0070675_100027195
385 Ga0070675_100058417
386 Ga0070675_100272934
387 Ga0070675_101130001
388 Ga0070675_101428409
389 Ga0070671_100008260
390 Ga0070671_100019278
391 Ga0070674_100056132
392 Ga0070673_100002098
393 Ga0070673_100047044
394 Ga0070673_100142248
395 Ga0070673_100606421
396 Ga0070688_100021271
397 Ga0070688_100106068
398 Ga0070688_100219958
399 Ga0070659_100037798
400 Ga0070667_100156147
401 Ga0070667_100228859
402 Ga0070713_100137595
403 Ga0070713_100625898
404 Ga0070713_101230998
405 Ga0070701_10003375
406 Ga0070701_10080749
407 Ga0070701_10117906
408 Ga0070701_10125333
409 Ga0070705_100223715
410 Ga0070700_100061735
411 Ga0070700_100149364
412 Ga0070694_100034690
413 Ga0070694_100038490
414 Ga0070694_100349091
415 Ga0070662_100006804
416 Ga0070662_100027382
417 Ga0068867_100000315
418 Ga0068867_100017177
419 Ga0070685_10079724
420 Ga0070685_10096721
421 Ga0070698_100237479
422 Ga0070699_100963351
423 Ga0070679_100426694
424 Ga0070697_100737860
425 Ga0070672_100004735
426 Ga0070672_100016798
427 Ga0070672_100059661
428 Ga0070672_100100229
429 Ga0070686_100024902
430 Ga0070686_100321518
431 Ga0070695_100051078
432 Ga0070695_100158182
433 Ga0070693_100106143
434 Ga0070665_100551196
435 Ga0070704_100004567
436 Ga0070704_100324526
437 Ga0070664_100277920
438 Ga0070664_100409072
439 Ga0070664_100643722
440 Ga0068857_100021067
441 Ga0068854_100046814
442 Ga0070702_100058921
443 Ga0068852_100077726
444 Ga0068852_100345643
445 Ga0068859_100002444
446 Ga0068859_100056586
447 Ga0068864_100010243
448 Ga0068864_100037971
449 Ga0068864_100085902
450 Ga0068864_101633079
451 Ga0068866_10081916
452 Ga0068861_100019046
453 Ga0068861_100125034
454 Ga0068870_10070701
455 Ga0068870_10120093
456 Ga0068863_100048103
457 Ga0068863_100079811
458 Ga0068863_100191808
459 Ga0068858_100043133
460 Ga0068860_100052847
461 Ga0068860_100122154
462 Ga0068862_100002685
463 Ga0068862_100040461
464 Ga0068862_100105768
465 Ga0068862_100439784
466 Ga0070717_10448334
467 Ga0075365_10003979
468 Ga0075365_10112777
469 Ga0075368_10008837
470 Ga0075368_10090584
471 Ga0075368_10233141
472 Ga0075364_10002343
473 Ga0075364_10007626
474 Ga0075364_10446175
475 Ga0075367_10031742
476 Ga0075367_10172742
477 Ga0075366_10004428
478 Ga0075366_10018759
479 Ga0097621_100090141
480 Ga0097621_100243600
481 Ga0075370_10275053
482 Ga0068871_100510905
483 Ga0075428_100034259
484 Ga0075428_100213523
485 Ga0075428_100704289
486 Ga0075433_10023560
487 Ga0075433_10719474
488 Ga0075434_100224149
489 Ga0075434_100519767
490 Ga0075429_100290429
491 Ga0068865_100373588
492 Ga0068865_101113495
493 Ga0075436_100466316
494 Ga0097620_100002444
495 Ga0097620_100056586
496 Ga0075435_100013654
497 Ga0075435_100030615
498 Ga0111539_10040027
499 Ga0111539_10875942
500 Ga0111539_11627831
501 Ga0111539_12285480
502 Ga0105245_10030233
503 Ga0105247_10471858
504 Ga0114129_10007832
505 Ga0114129_11075243
506 Ga0105243_10643128
507 Ga0105241_10471152
508 Ga0105242_10007442
509 Ga0105248_10039556
510 Ga0105248_11051104
511 Ga0105238_10748854
512 Ga0105249_10003393
513 Ga0105249_10226800
514 Ga0105239_10022464
515 Ga0157378_10183813
516 Ga0157378_11169687
517 Ga0163162_10138160
518 Ga0157375_10002792
519 Ga0157375_10357941
520 Ga0157375_10903684
521 Ga0163163_10055264
522 Ga0157380_10354375
523 Ga0157377_10208353
524 Ga0157377_10539979
525 Ga0157379_10408811
526 Ga0207697_10035362
527 Ga0207656_10050170
528 Ga0207653_10057918
529 Ga0207642_10046766
530 Ga0207688_10023239
531 Ga0207680_10065758
532 Ga0207645_10017347
533 Ga0207645_10040043
534 Ga0207643_10025038
535 Ga0207643_10029273
536 Ga0207660_10557196
537 Ga0207662_10002545
538 Ga0207662_10053449
539 Ga0207681_10003933
540 Ga0207681_10097499
541 Ga0207681_10100446
542 Ga0207650_10039744
543 Ga0207650_10050685
544 Ga0207659_10000349
545 Ga0207659_10002000
546 Ga0207659_10015494
547 Ga0207659_10456738
548 Ga0207659_10754010
549 Ga0207687_10255241
550 Ga0207644_10030966
551 Ga0207690_10035508
552 Ga0207706_10011987
553 Ga0207706_10012026
554 Ga0207709_10411651
555 Ga0207670_10017147
556 Ga0207670_10085100
557 Ga0207670_10545705
558 Ga0207669_10027904
559 Ga0207704_10020824
560 Ga0207704_10274375
561 Ga0207704_11139950
562 Ga0207691_10009582
563 Ga0207691_10011573
564 Ga0207691_10025969
565 Ga0207691_10103136
566 Ga0207711_10051320
567 Ga0207689_10044587
568 Ga0207689_10514531
569 Ga0207661_11567590
570 Ga0207679_10256308
571 Ga0207679_10295839
572 Ga0207651_10005866
573 Ga0207651_10034435
574 Ga0207651_10370210
575 Ga0207712_10017505
576 Ga0207712_10180125
577 Ga0207668_10038007
578 Ga0207668_10182003
579 Ga0207640_10364085
580 Ga0207640_10602245
581 Ga0207640_10657659
582 Ga0207658_10250985
583 Ga0207658_11050199
584 Ga0207703_10035312
585 Ga0207678_10144149
586 Ga0207678_10526586
587 Ga0207708_10001724
588 Ga0207708_10128793
589 Ga0207708_10644387
590 Ga0207641_10019016
591 Ga0207641_10081930
592 Ga0207641_10581837
593 Ga0207648_10000927
594 Ga0207648_10002141
595 Ga0207676_10004074
596 Ga0207676_10019834
597 Ga0207676_10052452
598 Ga0207676_10090856
599 Ga0207676_10600076
600 Ga0207674_10016823
601 Ga0207674_10148232
602 Ga0207675_100002209
603 Ga0207675_100027560
604 Ga0207683_10032856
605 Ga0209813_10098547
606 Ga0207428_10005379
607 Ga0207428_10103365
608 Ga0268265_10000073
609 Ga0268265_10083778
610 Ga0268265_10461958
611 Ga0268265_10610307
612 Ga0268264_10027857
613 Ga0268264_10043719
614 Ga0268264_10509774
615 Ga0307407_10695870
616 Ga0307409_100706328
617 Ga0307416_100100815
618 Ga0373932_0171425
619 Ga0373936_0112892
620 Ga0373939_0013366
621 Ga0373960_0037602
622 Ga0373943_0279117
623 Ga0373943_0390058
624 Ga0373955_0611449
625 Ga0373961_0042511
626 Ga0373962_0044468
627 Ga0373931_0227611
628 Ga0373933_0549901
629 Ga0373937_0068409
630 Ga0373937_0313234
631 Ga0373925_0002221
632 Ga0439462_0116578
633 Ga0439462_0141423
634 Ga0450923_106872
635 Ga0439446_0067577
636 Ga0439444_0117211
637 Ga0495603_0011546
638 Ga0495580_0774561
639 Ga0495582_0575304
640 Ga0495594_0028868
641 Ga0495609_0268890
642 Ga0495621_0002219
643 Ga0495645_0408588
644 Ga0495659_0002796
645 Ga0495588_0000846
646 Ga0495613_0115938
647 Ga0495684_0485027
648 Ga0496102_0214807
649 Ga0496104_0282554
650 Ga0496106_0250587
651 Ga0496108_0114776
652 Ga0496108_0848922
653 Ga0496109_0242962
654 Ga0496109_0285432
655 Ga0496112_0033386
656 Ga0496113_0090135
657 Ga0496113_0193503
658 Ga0501034_0004870
659 Ga0501036_0924681
660 Ga0501043_0394839
661 Ga0501067_0193030
662 Ga0501068_0132334
663 Ga0501074_0820448
664 Ga0501079_0165570
665 Ga0501081_0305985
666 Ga0501081_0580756
667 nmdc:mga03683_21687_c1
668 nmdc:mga00v17_428983_c1
669 nmdc:mga00v17_5662_c1
670 nmdc:mga0yw44_255055_c1
671 nmdc:mga0yw44_31871_c1
672 nmdc:mga0k408_20915_c1
673 nmdc:mga0k408_351480_c1
674 nmdc:mga06z11_185504_c1
675 nmdc:mga06z11_7778_c1
676 nmdc:mga04h51_159432_c1
677 nmdc:mga04h51_199363_c1
678 nmdc:mga04h51_438463_c1
679 nmdc:mga05p37_1238_c1
680 nmdc:mga05p37_805878_c1
681 nmdc:mga05p37_856862_c1
682 nmdc:mga09592_551684_c1
683 nmdc:mga08y16_1484188_c1
684 nmdc:mga08y16_270780_c1
685 nmdc:mga08y16_475_c1
686 nmdc:mga0n895_120886_c1
687 nmdc:mga0n895_499688_c1
688 nmdc:mga0n895_72599_c1
689 nmdc:mga0rr50_44696_c1
690 nmdc:mga0rr50_600801_c1
691 nmdc:mga0rr50_74056_c1
692 nmdc:mga08x19_168858_c1
693 nmdc:mga0a205_1127894_c1
694 nmdc:mga0a205_25113_c1
695 Ga0495619_0098091
696 Ga0500628_031686
697 Ga0590071_004191
698 Ga0590074_036356
699 Ga0501082_1100498
700 Ga0530510_0244733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

10

177

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ff6-assembly2.cif.gz_C human acc2 ct domain with cp-640186 0.7306 40 86
8x2q-assembly1.cif.gz_A the crystal structure of apc from biortus. 0.7212 34 87
7y6c-assembly2.cif.gz_D crystal structure of the esce/esag/esah complex 0.7128 39 85
7y6b-assembly2.cif.gz_D crystal structure of the esce/esah complex 0.7013 40 85
4ani-assembly1.cif.gz_B structural basis for the intermolecular communication between dnak and grpe in the dnak chaperone system from geobacillus kaustophilus hta426 0.6971 9 143
ID Description Score Start End Superfamily
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9929 87 141 2.30.22.10
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9889 87 141 2.30.22.10
af_A0A1D6EAQ0_210_272_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9783 87 143 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9669 87 143 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9584 87 141 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A6L7EAJ7-F1-model_v4 deleted 0.9628 40 143
AF-A0A7V6ZNN3-F1-model_v4 Protein GrpE 0.9592 40 144 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A7S0DTE4-F1-model_v4 GrpE protein homolog 0.9504 40 144 GO:0000774
GO:0001405
GO:0006457
GO:0030150
GO:0042803
GO:0051082
GO:0051087
AF-A0A2K2VVR3-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9474 40 143 GO:0000774
GO:0005829
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A085DT23-F1-model_v4 deleted 0.946 40 144

Map