F418305

General Info

Members Datasets Scaffolds Average Seq Length
350 203 700 102

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10783986|Ga0307413_107839862
Length 115
Sequence MVPHLAVRQPMSHWVPVAPAESIAPGDYAQTEIDGALVAVFNVCGEFYAIDDVCTHDGGELAGGAVEGDVVICPRHGARFCLRTGAALSPPAYEPVRTYPTRINEQGIVEVNADV

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
201 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 3.43
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10783986 3300031824 Bacteria 800
2 MBSR1b_contig_10434335 2162886012 Bacteria 1098
3 Ga0065712_10003849 3300005290 Bacteria 4867
4 Ga0065715_10092544 3300005293 Bacteria 5067
5 Ga0065707_10081966 3300005295 Bacteria 26944
6 Ga0065707_10246031 3300005295 Bacteria 1140
7 Ga0070658_10909651 3300005327 Bacteria 765
8 Ga0070690_100172696 3300005330 Bacteria 1489
9 Ga0070670_100022137 3300005331 Bacteria 5471
10 Ga0070670_100782974 3300005331 Unclassified 861
11 Ga0068869_100017831 3300005334 Bacteria 4822
12 Ga0068869_100200156 3300005334 Bacteria 1574
13 Ga0070682_100045936 3300005337 Bacteria 2709
14 Ga0068868_100523297 3300005338 Bacteria 1041
15 Ga0068868_101397095 3300005338 Unclassified 653
16 Ga0070660_100563444 3300005339 Bacteria 951
17 Ga0070689_100008629 3300005340 Bacteria 7188
18 Ga0070691_10125309 3300005341 Bacteria 1297
19 Ga0070691_10603791 3300005341 Bacteria 648
20 Ga0070687_100105991 3300005343 Bacteria 1583
21 Ga0070687_100303633 3300005343 Bacteria 1014
22 Ga0070661_100007962 3300005344 Bacteria 7321
23 Ga0070692_10315219 3300005345 Bacteria 960
24 Ga0070668_100018090 3300005347 Bacteria 5287
25 Ga0070668_100031631 3300005347 Bacteria 4026
26 Ga0070669_100016708 3300005353 Bacteria 5238
27 Ga0070675_100010875 3300005354 Bacteria 7118
28 Ga0070675_100660626 3300005354 Bacteria 950
29 Ga0070671_100178777 3300005355 Bacteria 1796
30 Ga0070674_100060672 3300005356 Bacteria 2637
31 Ga0070673_100006740 3300005364 Bacteria 7494
32 Ga0070688_100024750 3300005365 Bacteria 3547
33 Ga0070659_100187541 3300005366 Bacteria 1699
34 Ga0070667_100224291 3300005367 Bacteria 1674
35 Ga0070667_101802798 3300005367 Bacteria 576
36 Ga0070705_100013346 3300005440 Bacteria 4199
37 Ga0070700_100076162 3300005441 Bacteria 2154
38 Ga0070663_100257985 3300005455 Bacteria 1382
39 Ga0070662_100003547 3300005457 Bacteria 9730
40 Ga0070681_10153535 3300005458 Bacteria 2228
41 Ga0070681_10986963 3300005458 Bacteria 762
42 Ga0068867_100021713 3300005459 Bacteria 4581
43 Ga0070685_10004948 3300005466 Bacteria 6745
44 Ga0070685_10075124 3300005466 Bacteria 2012
45 Ga0070679_100209202 3300005530 Bacteria 1915
46 Ga0070684_100086852 3300005535 Bacteria 2777
47 Ga0070686_100063807 3300005544 Bacteria 2387
48 Ga0070695_101734091 3300005545 Bacteria 523
49 Ga0070665_100214769 3300005548 Bacteria 1924
50 Ga0070665_100338999 3300005548 Bacteria 1508
51 Ga0070665_101566799 3300005548 Bacteria 667
52 Ga0070704_100515100 3300005549 Bacteria 1040
53 Ga0070704_100758962 3300005549 Bacteria 864
54 Ga0070664_100033747 3300005564 Bacteria 4289
55 Ga0068857_100018195 3300005577 Bacteria 6162
56 Ga0068857_100291813 3300005577 Bacteria 1502
57 Ga0068854_100590468 3300005578 Bacteria 947
58 Ga0070702_100014488 3300005615 Bacteria 4000
59 Ga0068859_100007132 3300005617 Bacteria 11343
60 Ga0068859_100634220 3300005617 Bacteria 1161
61 Ga0068864_100018191 3300005618 Bacteria 5866
62 Ga0068864_100957106 3300005618 Bacteria 847
63 Ga0068866_10093917 3300005718 Bacteria 1640
64 Ga0068861_100000256 3300005719 Bacteria 29591
65 Ga0068861_100010076 3300005719 Bacteria 6554
66 Ga0068861_100217521 3300005719 Bacteria 1613
67 Ga0068861_101888841 3300005719 Bacteria 594
68 Ga0068870_10021396 3300005840 Bacteria 3163
69 Ga0068870_10272509 3300005840 Bacteria 1058
70 Ga0068870_10502361 3300005840 Bacteria 808
71 Ga0068870_10559242 3300005840 Bacteria 771
72 Ga0068863_100084268 3300005841 Bacteria 3013
73 Ga0068860_100057858 3300005843 Bacteria 3685
74 Ga0068860_102266449 3300005843 Bacteria 564
75 Ga0068862_100000878 3300005844 Bacteria 29297
76 Ga0068862_100017462 3300005844 Bacteria 5977
77 Ga0068862_100125265 3300005844 Bacteria 2268
78 Ga0068862_100191347 3300005844 Bacteria 1841
79 Ga0081455_10007291 3300005937 Bacteria 11670
80 Ga0097621_100348705 3300006237 Bacteria 1316
81 Ga0097621_101018873 3300006237 Bacteria 775
82 Ga0068871_100029018 3300006358 Bacteria 4343
83 Ga0075428_100001451 3300006844 Bacteria 25355
84 Ga0075428_100013976 3300006844 Bacteria 8937
85 Ga0075428_100168484 3300006844 Bacteria 2375
86 Ga0075428_100186017 3300006844 Bacteria 2248
87 Ga0075428_101800371 3300006844 Bacteria 637
88 Ga0075428_102098009 3300006844 Bacteria 585
89 Ga0075430_100003326 3300006846 Bacteria 13466
90 Ga0075430_100005330 3300006846 Bacteria 10855
91 Ga0075430_100029879 3300006846 Bacteria 4627
92 Ga0075430_100170397 3300006846 Bacteria 1811
93 Ga0075430_100200475 3300006846 Bacteria 1657
94 Ga0075430_100317649 3300006846 Bacteria 1288
95 Ga0075430_101151260 3300006846 Unclassified 639
96 Ga0075431_100004956 3300006847 Bacteria 13103
97 Ga0075431_100012402 3300006847 Bacteria 8602
98 Ga0075431_100033316 3300006847 Bacteria 5309
99 Ga0075431_100446690 3300006847 Unclassified 1289
100 Ga0075431_100509532 3300006847 Bacteria 1194
101 Ga0075431_102032683 3300006847 Bacteria 530
102 Ga0075433_11199245 3300006852 Bacteria 659
103 Ga0075434_100154578 3300006871 Bacteria 2314
104 Ga0075429_100001381 3300006880 Bacteria 19862
105 Ga0075429_100109148 3300006880 Bacteria 2419
106 Ga0075429_100213419 3300006880 Bacteria 1691
107 Ga0075429_100214890 3300006880 Bacteria 1685
108 Ga0075429_101365882 3300006880 Bacteria 617
109 Ga0097620_100007132 3300006931 Bacteria 11343
110 Ga0097620_100634282 3300006931 Bacteria 1161
111 Ga0111539_10004344 3300009094 Bacteria 18562
112 Ga0111539_10066066 3300009094 Bacteria 4272
113 Ga0111539_10403005 3300009094 Bacteria 1593
114 Ga0111539_10454013 3300009094 Bacteria 1492
115 Ga0111539_11508411 3300009094 Bacteria 780
116 Ga0111539_11700338 3300009094 Bacteria 732
117 Ga0105245_12442733 3300009098 Bacteria 576
118 Ga0105247_10170133 3300009101 Bacteria 1448
119 Ga0114129_10003124 3300009147 Bacteria 23226
120 Ga0114129_10051588 3300009147 Bacteria 5774
121 Ga0114129_11270763 3300009147 Unclassified 914
122 Ga0114129_12946151 3300009147 Bacteria 561
123 Ga0105243_10037553 3300009148 Bacteria 3766
124 Ga0105243_10210487 3300009148 Bacteria 1712
125 Ga0105241_10394934 3300009174 Bacteria 1212
126 Ga0105248_10001950 3300009177 Bacteria 22929
127 Ga0105237_10870963 3300009545 Bacteria 907
128 Ga0105249_10007767 3300009553 Bacteria 9348
129 Ga0105249_10054854 3300009553 Bacteria 3645
130 Ga0105246_10442575 3300011119 Bacteria 1090
131 Ga0157346_1008592 3300012480 Bacteria 707
132 Ga0157378_10593007 3300013297 Bacteria 1118
133 Ga0157378_11672760 3300013297 Bacteria 683
134 Ga0163162_10024984 3300013306 Bacteria 5902
135 Ga0157372_12011893 3300013307 Bacteria 664
136 Ga0157375_10157001 3300013308 Bacteria 2414
137 Ga0163163_10026463 3300014325 Bacteria 5545
138 Ga0163163_12152867 3300014325 Bacteria 617
139 Ga0157380_10416241 3300014326 Bacteria 1280
140 Ga0157377_10001056 3300014745 Bacteria 11660
141 Ga0157379_10295597 3300014968 Bacteria 1475
142 Ga0157379_11084541 3300014968 Bacteria 766
143 Ga0157376_10715201 3300014969 Bacteria 1008
144 Ga0157376_11396664 3300014969 Bacteria 732
145 Ga0163161_11124696 3300017792 Bacteria 676
146 Ga0207642_10012826 3300025899 Bacteria 3038
147 Ga0207645_10083156 3300025907 Bacteria 2053
148 Ga0207643_10028973 3300025908 Bacteria 3078
149 Ga0207643_10267040 3300025908 Bacteria 1058
150 Ga0207643_10420305 3300025908 Bacteria 847
151 Ga0207705_10943447 3300025909 Bacteria 668
152 Ga0207707_10056338 3300025912 Bacteria 3420
153 Ga0207707_11463163 3300025912 Unclassified 543
154 Ga0207660_10253391 3300025917 Bacteria 1390
155 Ga0207660_11041681 3300025917 Bacteria 667
156 Ga0207662_10133708 3300025918 Bacteria 1566
157 Ga0207662_10161671 3300025918 Bacteria 1431
158 Ga0207657_10356078 3300025919 Bacteria 1154
159 Ga0207657_11223356 3300025919 Bacteria 570
160 Ga0207652_10186598 3300025921 Bacteria 1865
161 Ga0207681_10021598 3300025923 Bacteria 4095
162 Ga0207681_11227258 3300025923 Bacteria 630
163 Ga0207650_10053397 3300025925 Bacteria 2995
164 Ga0207650_10762188 3300025925 Bacteria 819
165 Ga0207659_10010463 3300025926 Bacteria 5831
166 Ga0207659_10522216 3300025926 Bacteria 1007
167 Ga0207687_10524259 3300025927 Bacteria 991
168 Ga0207644_10511084 3300025931 Bacteria 992
169 Ga0207690_10695443 3300025932 Bacteria 836
170 Ga0207706_10022412 3300025933 Bacteria 5670
171 Ga0207686_10212913 3300025934 Bacteria 1390
172 Ga0207709_10349139 3300025935 Bacteria 1116
173 Ga0207670_10004031 3300025936 Bacteria 7853
174 Ga0207669_10021850 3300025937 Bacteria 3387
175 Ga0207691_10057873 3300025940 Bacteria 3527
176 Ga0207711_10006071 3300025941 Bacteria 10206
177 Ga0207689_10009129 3300025942 Bacteria 8580
178 Ga0207689_10249268 3300025942 Bacteria 1468
179 Ga0207679_10006042 3300025945 Bacteria 7629
180 Ga0207679_11221240 3300025945 Bacteria 690
181 Ga0207651_10896785 3300025960 Bacteria 789
182 Ga0207712_10014997 3300025961 Bacteria 4993
183 Ga0207712_10075801 3300025961 Bacteria 2432
184 Ga0207668_10013314 3300025972 Bacteria 5060
185 Ga0207640_10111925 3300025981 Bacteria 1937
186 Ga0207640_11102929 3300025981 Bacteria 702
187 Ga0207658_10295609 3300025986 Bacteria 1393
188 Ga0207677_10129895 3300026023 Bacteria 1911
189 Ga0207677_10867081 3300026023 Bacteria 812
190 Ga0207703_10228587 3300026035 Unclassified 1667
191 Ga0207703_11295129 3300026035 Unclassified 701
192 Ga0207678_10141799 3300026067 Bacteria 2051
193 Ga0207708_10028460 3300026075 Bacteria 4231
194 Ga0207708_10631208 3300026075 Bacteria 910
195 Ga0207641_10004245 3300026088 Bacteria 12488
196 Ga0207641_10569064 3300026088 Bacteria 1107
197 Ga0207648_10016032 3300026089 Bacteria 6865
198 Ga0207676_10101344 3300026095 Bacteria 2387
199 Ga0207676_10412301 3300026095 Bacteria 1265
200 Ga0207674_10026270 3300026116 Bacteria 6190
201 Ga0207674_10145161 3300026116 Bacteria 2331
202 Ga0207675_100001062 3300026118 Bacteria 27254
203 Ga0207675_100007848 3300026118 Bacteria 10070
204 Ga0207675_100017987 3300026118 Bacteria 6592
205 Ga0207675_100720285 3300026118 Bacteria 1007
206 Ga0207675_101323053 3300026118 Bacteria 741
207 Ga0207683_10128246 3300026121 Bacteria 2281
208 Ga0207683_10418528 3300026121 Bacteria 1234
209 Ga0209984_1012238 3300027424 Bacteria 1117
210 Ga0207428_10019641 3300027907 Bacteria 5759
211 Ga0207428_10198374 3300027907 Bacteria 1510
212 Ga0207428_10578686 3300027907 Bacteria 810
213 Ga0268266_10243375 3300028379 Bacteria 1661
214 Ga0268266_10491035 3300028379 Bacteria 1171
215 Ga0268266_12018791 3300028379 Bacteria 550
216 Ga0268265_10000559 3300028380 Bacteria 37946
217 Ga0268265_10042522 3300028380 Bacteria 3372
218 Ga0268265_10108016 3300028380 Bacteria 2264
219 Ga0268265_10311200 3300028380 Bacteria 1422
220 Ga0268265_12519578 3300028380 Unclassified 520
221 Ga0268264_10174279 3300028381 Bacteria 1948
222 Ga0268264_11923856 3300028381 Bacteria 601
223 Ga0265318_10283297 3300028577 Unclassified 605
224 Ga0307515_10440481 3300028794 Bacteria 920
225 Ga0265327_10480847 3300031251 Unclassified 536
226 Ga0307513_10039826 3300031456 Bacteria 5204
227 Ga0307513_10061256 3300031456 Bacteria 3985
228 Ga0307513_10070076 3300031456 Bacteria 3667
229 Ga0307513_10609754 3300031456 Bacteria 800
230 Ga0307509_10000229 3300031507 Bacteria 90514
231 Ga0307408_100010613 3300031548 Bacteria 6077
232 Ga0307408_100226409 3300031548 Bacteria 1529
233 Ga0307408_101051929 3300031548 Bacteria 753
234 Ga0307405_10791945 3300031731 Unclassified 793
235 Ga0307413_12075529 3300031824 Unclassified 514
236 Ga0307410_10063148 3300031852 Bacteria 2540
237 Ga0307410_10455206 3300031852 Bacteria 1045
238 Ga0307406_10151018 3300031901 Bacteria 1657
239 Ga0307406_11163276 3300031901 Bacteria 668
240 Ga0307407_11688787 3300031903 Unclassified 504
241 Ga0307412_10117700 3300031911 Bacteria 1908
242 Ga0307412_10487509 3300031911 Bacteria 1023
243 Ga0307412_10740276 3300031911 Bacteria 848
244 Ga0307412_11356226 3300031911 Bacteria 642
245 Ga0307412_12179127 3300031911 Unclassified 516
246 Ga0307409_100649051 3300031995 Bacteria 1049
247 Ga0307409_101078851 3300031995 Bacteria 824
248 Ga0307416_100777025 3300032002 Bacteria 1052
249 Ga0307416_101119155 3300032002 Bacteria 892
250 Ga0307414_10083099 3300032004 Bacteria 2351
251 Ga0307414_10363491 3300032004 Bacteria 1246
252 Ga0307411_10050935 3300032005 Bacteria 2699
253 Ga0373951_0055916 3300035091 Bacteria 980
254 Ga0373942_0260075 3300035207 Unclassified 592
255 Ga0373961_0103315 3300035241 Bacteria 925
256 Ga0436360_0145061 3300039438 Bacteria 1323
257 Ga0451797_0004359 3300041453 Bacteria 771
258 Ga0451798_0844107 3300041458 Bacteria 912
259 Ga0451807_1049252 3300041486 Bacteria 1114
260 Ga0451807_2389076 3300041486 Bacteria 1134
261 Ga0451839_0224851 3300041496 Unclassified 716
262 Ga0439442_097772 3300042002 Unclassified 634
263 Ga0439449_0140799 3300042007 Bacteria 898
264 Ga0450905_053151 3300042142 Bacteria 664
265 Ga0439464_0036149 3300042439 Bacteria 1397
266 Ga0439464_0331324 3300042439 Unclassified 500
267 Ga0451576_0065462 3300045051 Bacteria 3784
268 Ga0451576_0340881 3300045051 Bacteria 1569
269 Ga0495590_0044414 3300046457 Bacteria 1549
270 Ga0495638_0013885 3300046460 Bacteria 5463
271 Ga0495638_0041670 3300046460 Bacteria 2903
272 Ga0495638_0051811 3300046460 Bacteria 2559
273 Ga0495638_0099002 3300046460 Bacteria 1746
274 Ga0495650_0011192 3300046471 Bacteria 4938
275 Ga0495584_0087097 3300046491 Bacteria 1574
276 Ga0495632_0375990 3300046519 Bacteria 623
277 Ga0495668_0076887 3300046616 Bacteria 1833
278 Ga0495668_0254934 3300046616 Bacteria 960
279 Ga0495611_0241658 3300046648 Bacteria 838
280 Ga0495625_0003302 3300046660 Bacteria 16275
281 Ga0495625_0153796 3300046660 Bacteria 1545
282 Ga0495625_0271451 3300046660 Bacteria 1094
283 Ga0495669_0188991 3300046684 Bacteria 983
284 Ga0495649_0163417 3300046694 Bacteria 1167
285 Ga0495672_0096260 3300047320 Bacteria 1614
286 Ga0495672_0314364 3300047320 Bacteria 738
287 Ga0495673_0087673 3300047469 Bacteria 1277
288 Ga0495686_0069563 3300047472 Bacteria 2170
289 Ga0496104_0855359 3300048907 Bacteria 815
290 Ga0496106_0083681 3300048909 Bacteria 2454
291 Ga0496107_0328496 3300048910 Bacteria 1138
292 Ga0496108_0514088 3300048911 Bacteria 1045
293 Ga0496110_0097051 3300048913 Bacteria 2641
294 Ga0496110_0341172 3300048913 Bacteria 1365
295 Ga0496113_0010563 3300048916 Bacteria 6110
296 Ga0496114_1502704 3300048917 Unclassified 561
297 Ga0496121_0009942 3300048924 Bacteria 10829
298 Ga0496124_0156181 3300048927 Bacteria 1784
299 Ga0501036_1122258 3300049572 Bacteria 642
300 Ga0501046_0046018 3300049580 Bacteria 3464
301 Ga0501072_1342700 3300049588 Bacteria 554
302 Ga0501249_012272 3300049679 Bacteria 1809
303 Ga0501225_0022640 3300049705 Bacteria 1735
304 Ga0501282_043394 3300049778 Bacteria 542
305 nmdc:mga0k408_533411_c1 3300050493 Bacteria 694
306 nmdc:mga05p37_12690_c1 3300050507 Bacteria 10069
307 nmdc:mga05p37_1893585_c1 3300050507 Unclassified 570
308 nmdc:mga05p37_36150_c1 3300050507 Bacteria 6060
309 nmdc:mga09592_1218036_c1 3300050508 Bacteria 622
310 nmdc:mga09592_1333424_c1 3300050508 Bacteria 589
311 nmdc:mga09592_180578_c1 3300050508 Bacteria 1826
312 nmdc:mga09592_261664_c1 3300050508 Bacteria 1500
313 nmdc:mga09592_3569_c1 3300050508 Bacteria 12561
314 nmdc:mga0qj67_1303991_c1 3300050509 Bacteria 562
315 nmdc:mga0qj67_24831_c1 3300050509 Bacteria 4624
316 nmdc:mga0qj67_58667_c1 3300050509 Bacteria 3052
317 nmdc:mga0qj67_733363_c1 3300050509 Bacteria 785
318 nmdc:mga0qj67_826545_c1 3300050509 Bacteria 732
319 nmdc:mga0qj67_9189_c1 3300050509 Bacteria 7341
320 nmdc:mga06r32_29_c1 3300050510 Bacteria 85620
321 nmdc:mga06r32_437908_c1 3300050510 Bacteria 1287
322 nmdc:mga06r32_441120_c1 3300050510 Unclassified 1282
323 nmdc:mga06r32_69838_c1 3300050510 Bacteria 3396
324 nmdc:mga06r32_745_c1 3300050510 Bacteria 28580
325 nmdc:mga08y16_1085_c1 3300050511 Bacteria 26787
326 nmdc:mga08y16_1447727_c1 3300050511 Bacteria 649
327 nmdc:mga08y16_40025_c1 3300050511 Bacteria 4915
328 nmdc:mga08y16_600146_c1 3300050511 Bacteria 1110
329 nmdc:mga08y16_769468_c1 3300050511 Unclassified 958
330 nmdc:mga08y16_784467_c1 3300050511 Bacteria 947
331 nmdc:mga08y16_94823_c1 3300050511 Bacteria 3109
332 nmdc:mga0a205_1522111_c1 3300050515 Unclassified 517
333 Ga0500610_0249482 3300053079 Bacteria 819
334 Ga0500583_0227609 3300053092 Bacteria 924
335 Ga0500583_0382492 3300053092 Bacteria 678
336 Ga0500556_0097163 3300053104 Bacteria 1131
337 Ga0500594_0345127 3300053118 Bacteria 501
338 Ga0500642_0444025 3300053130 Bacteria 558
339 Ga0500658_0053603 3300053134 Bacteria 1655
340 Ga0500658_0449076 3300053134 Bacteria 587
341 Ga0500568_0072809 3300053139 Bacteria 1313
342 Ga0500588_0001145 3300053146 Bacteria 4874
343 Ga0500588_0264208 3300053146 Bacteria 648
344 Ga0500604_0105471 3300053151 Bacteria 932
345 Ga0500622_0003682 3300053156 Bacteria 10060
346 Ga0500622_0010223 3300053156 Bacteria 5158
347 Ga0500637_0004637 3300053178 Bacteria 6556
348 Ga0500611_002414 3300053727 Bacteria 2233
349 Ga0500645_127916 3300053730 Bacteria 707
350 Ga0590071_022709 3300059421 Bacteria 1481
351 Ga0307413_10783986
352 MBSR1b_contig_10434335
353 Ga0065712_10003849
354 Ga0065715_10092544
355 Ga0065707_10081966
356 Ga0065707_10246031
357 Ga0070658_10909651
358 Ga0070690_100172696
359 Ga0070670_100022137
360 Ga0070670_100782974
361 Ga0068869_100017831
362 Ga0068869_100200156
363 Ga0070682_100045936
364 Ga0068868_100523297
365 Ga0068868_101397095
366 Ga0070660_100563444
367 Ga0070689_100008629
368 Ga0070691_10125309
369 Ga0070691_10603791
370 Ga0070687_100105991
371 Ga0070687_100303633
372 Ga0070661_100007962
373 Ga0070692_10315219
374 Ga0070668_100018090
375 Ga0070668_100031631
376 Ga0070669_100016708
377 Ga0070675_100010875
378 Ga0070675_100660626
379 Ga0070671_100178777
380 Ga0070674_100060672
381 Ga0070673_100006740
382 Ga0070688_100024750
383 Ga0070659_100187541
384 Ga0070667_100224291
385 Ga0070667_101802798
386 Ga0070705_100013346
387 Ga0070700_100076162
388 Ga0070663_100257985
389 Ga0070662_100003547
390 Ga0070681_10153535
391 Ga0070681_10986963
392 Ga0068867_100021713
393 Ga0070685_10004948
394 Ga0070685_10075124
395 Ga0070679_100209202
396 Ga0070684_100086852
397 Ga0070686_100063807
398 Ga0070695_101734091
399 Ga0070665_100214769
400 Ga0070665_100338999
401 Ga0070665_101566799
402 Ga0070704_100515100
403 Ga0070704_100758962
404 Ga0070664_100033747
405 Ga0068857_100018195
406 Ga0068857_100291813
407 Ga0068854_100590468
408 Ga0070702_100014488
409 Ga0068859_100007132
410 Ga0068859_100634220
411 Ga0068864_100018191
412 Ga0068864_100957106
413 Ga0068866_10093917
414 Ga0068861_100000256
415 Ga0068861_100010076
416 Ga0068861_100217521
417 Ga0068861_101888841
418 Ga0068870_10021396
419 Ga0068870_10272509
420 Ga0068870_10502361
421 Ga0068870_10559242
422 Ga0068863_100084268
423 Ga0068860_100057858
424 Ga0068860_102266449
425 Ga0068862_100000878
426 Ga0068862_100017462
427 Ga0068862_100125265
428 Ga0068862_100191347
429 Ga0081455_10007291
430 Ga0097621_100348705
431 Ga0097621_101018873
432 Ga0068871_100029018
433 Ga0075428_100001451
434 Ga0075428_100013976
435 Ga0075428_100168484
436 Ga0075428_100186017
437 Ga0075428_101800371
438 Ga0075428_102098009
439 Ga0075430_100003326
440 Ga0075430_100005330
441 Ga0075430_100029879
442 Ga0075430_100170397
443 Ga0075430_100200475
444 Ga0075430_100317649
445 Ga0075430_101151260
446 Ga0075431_100004956
447 Ga0075431_100012402
448 Ga0075431_100033316
449 Ga0075431_100446690
450 Ga0075431_100509532
451 Ga0075431_102032683
452 Ga0075433_11199245
453 Ga0075434_100154578
454 Ga0075429_100001381
455 Ga0075429_100109148
456 Ga0075429_100213419
457 Ga0075429_100214890
458 Ga0075429_101365882
459 Ga0097620_100007132
460 Ga0097620_100634282
461 Ga0111539_10004344
462 Ga0111539_10066066
463 Ga0111539_10403005
464 Ga0111539_10454013
465 Ga0111539_11508411
466 Ga0111539_11700338
467 Ga0105245_12442733
468 Ga0105247_10170133
469 Ga0114129_10003124
470 Ga0114129_10051588
471 Ga0114129_11270763
472 Ga0114129_12946151
473 Ga0105243_10037553
474 Ga0105243_10210487
475 Ga0105241_10394934
476 Ga0105248_10001950
477 Ga0105237_10870963
478 Ga0105249_10007767
479 Ga0105249_10054854
480 Ga0105246_10442575
481 Ga0157346_1008592
482 Ga0157378_10593007
483 Ga0157378_11672760
484 Ga0163162_10024984
485 Ga0157372_12011893
486 Ga0157375_10157001
487 Ga0163163_10026463
488 Ga0163163_12152867
489 Ga0157380_10416241
490 Ga0157377_10001056
491 Ga0157379_10295597
492 Ga0157379_11084541
493 Ga0157376_10715201
494 Ga0157376_11396664
495 Ga0163161_11124696
496 Ga0207642_10012826
497 Ga0207645_10083156
498 Ga0207643_10028973
499 Ga0207643_10267040
500 Ga0207643_10420305
501 Ga0207705_10943447
502 Ga0207707_10056338
503 Ga0207707_11463163
504 Ga0207660_10253391
505 Ga0207660_11041681
506 Ga0207662_10133708
507 Ga0207662_10161671
508 Ga0207657_10356078
509 Ga0207657_11223356
510 Ga0207652_10186598
511 Ga0207681_10021598
512 Ga0207681_11227258
513 Ga0207650_10053397
514 Ga0207650_10762188
515 Ga0207659_10010463
516 Ga0207659_10522216
517 Ga0207687_10524259
518 Ga0207644_10511084
519 Ga0207690_10695443
520 Ga0207706_10022412
521 Ga0207686_10212913
522 Ga0207709_10349139
523 Ga0207670_10004031
524 Ga0207669_10021850
525 Ga0207691_10057873
526 Ga0207711_10006071
527 Ga0207689_10009129
528 Ga0207689_10249268
529 Ga0207679_10006042
530 Ga0207679_11221240
531 Ga0207651_10896785
532 Ga0207712_10014997
533 Ga0207712_10075801
534 Ga0207668_10013314
535 Ga0207640_10111925
536 Ga0207640_11102929
537 Ga0207658_10295609
538 Ga0207677_10129895
539 Ga0207677_10867081
540 Ga0207703_10228587
541 Ga0207703_11295129
542 Ga0207678_10141799
543 Ga0207708_10028460
544 Ga0207708_10631208
545 Ga0207641_10004245
546 Ga0207641_10569064
547 Ga0207648_10016032
548 Ga0207676_10101344
549 Ga0207676_10412301
550 Ga0207674_10026270
551 Ga0207674_10145161
552 Ga0207675_100001062
553 Ga0207675_100007848
554 Ga0207675_100017987
555 Ga0207675_100720285
556 Ga0207675_101323053
557 Ga0207683_10128246
558 Ga0207683_10418528
559 Ga0209984_1012238
560 Ga0207428_10019641
561 Ga0207428_10198374
562 Ga0207428_10578686
563 Ga0268266_10243375
564 Ga0268266_10491035
565 Ga0268266_12018791
566 Ga0268265_10000559
567 Ga0268265_10042522
568 Ga0268265_10108016
569 Ga0268265_10311200
570 Ga0268265_12519578
571 Ga0268264_10174279
572 Ga0268264_11923856
573 Ga0265318_10283297
574 Ga0307515_10440481
575 Ga0265327_10480847
576 Ga0307513_10039826
577 Ga0307513_10061256
578 Ga0307513_10070076
579 Ga0307513_10609754
580 Ga0307509_10000229
581 Ga0307408_100010613
582 Ga0307408_100226409
583 Ga0307408_101051929
584 Ga0307405_10791945
585 Ga0307413_12075529
586 Ga0307410_10063148
587 Ga0307410_10455206
588 Ga0307406_10151018
589 Ga0307406_11163276
590 Ga0307407_11688787
591 Ga0307412_10117700
592 Ga0307412_10487509
593 Ga0307412_10740276
594 Ga0307412_11356226
595 Ga0307412_12179127
596 Ga0307409_100649051
597 Ga0307409_101078851
598 Ga0307416_100777025
599 Ga0307416_101119155
600 Ga0307414_10083099
601 Ga0307414_10363491
602 Ga0307411_10050935
603 Ga0373951_0055916
604 Ga0373942_0260075
605 Ga0373961_0103315
606 Ga0436360_0145061
607 Ga0451797_0004359
608 Ga0451798_0844107
609 Ga0451807_1049252
610 Ga0451807_2389076
611 Ga0451839_0224851
612 Ga0439442_097772
613 Ga0439449_0140799
614 Ga0450905_053151
615 Ga0439464_0036149
616 Ga0439464_0331324
617 Ga0451576_0065462
618 Ga0451576_0340881
619 Ga0495590_0044414
620 Ga0495638_0013885
621 Ga0495638_0041670
622 Ga0495638_0051811
623 Ga0495638_0099002
624 Ga0495650_0011192
625 Ga0495584_0087097
626 Ga0495632_0375990
627 Ga0495668_0076887
628 Ga0495668_0254934
629 Ga0495611_0241658
630 Ga0495625_0003302
631 Ga0495625_0153796
632 Ga0495625_0271451
633 Ga0495669_0188991
634 Ga0495649_0163417
635 Ga0495672_0096260
636 Ga0495672_0314364
637 Ga0495673_0087673
638 Ga0495686_0069563
639 Ga0496104_0855359
640 Ga0496106_0083681
641 Ga0496107_0328496
642 Ga0496108_0514088
643 Ga0496110_0097051
644 Ga0496110_0341172
645 Ga0496113_0010563
646 Ga0496114_1502704
647 Ga0496121_0009942
648 Ga0496124_0156181
649 Ga0501036_1122258
650 Ga0501046_0046018
651 Ga0501072_1342700
652 Ga0501249_012272
653 Ga0501225_0022640
654 Ga0501282_043394
655 nmdc:mga0k408_533411_c1
656 nmdc:mga05p37_12690_c1
657 nmdc:mga05p37_1893585_c1
658 nmdc:mga05p37_36150_c1
659 nmdc:mga09592_1218036_c1
660 nmdc:mga09592_1333424_c1
661 nmdc:mga09592_180578_c1
662 nmdc:mga09592_261664_c1
663 nmdc:mga09592_3569_c1
664 nmdc:mga0qj67_1303991_c1
665 nmdc:mga0qj67_24831_c1
666 nmdc:mga0qj67_58667_c1
667 nmdc:mga0qj67_733363_c1
668 nmdc:mga0qj67_826545_c1
669 nmdc:mga0qj67_9189_c1
670 nmdc:mga06r32_29_c1
671 nmdc:mga06r32_437908_c1
672 nmdc:mga06r32_441120_c1
673 nmdc:mga06r32_69838_c1
674 nmdc:mga06r32_745_c1
675 nmdc:mga08y16_1085_c1
676 nmdc:mga08y16_1447727_c1
677 nmdc:mga08y16_40025_c1
678 nmdc:mga08y16_600146_c1
679 nmdc:mga08y16_769468_c1
680 nmdc:mga08y16_784467_c1
681 nmdc:mga08y16_94823_c1
682 nmdc:mga0a205_1522111_c1
683 Ga0500610_0249482
684 Ga0500583_0227609
685 Ga0500583_0382492
686 Ga0500556_0097163
687 Ga0500594_0345127
688 Ga0500642_0444025
689 Ga0500658_0053603
690 Ga0500658_0449076
691 Ga0500568_0072809
692 Ga0500588_0001145
693 Ga0500588_0264208
694 Ga0500604_0105471
695 Ga0500622_0003682
696 Ga0500622_0010223
697 Ga0500637_0004637
698 Ga0500611_002414
699 Ga0500645_127916
700 Ga0590071_022709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

13

100

0.98

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

13

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9522 2 100
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9496 2 100
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9461 2 102
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.9437 1 100
7bui-assembly1.cif.gz_E complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9412 3 99
ID Description Score Start End Superfamily
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9557 1 103 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9533 2 101 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9467 1 103 2.102.10.10
4nbbE00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9462 1 99 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9409 4 103 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A829YNN8-F1-model_v4 Benzene 1,2-dioxygenase 1 1 102 GO:0046872
GO:0051213
GO:0051537
AF-A0A1F3B7Q0-F1-model_v4 Rieske domain-containing protein 0.9788 2 99 GO:0046872
GO:0051537
AF-A0A450SHH1-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin subunit 0.9778 1 103 GO:0046872
GO:0051213
GO:0051537
AF-A0A523IKP3-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9775 2 101 GO:0046872
GO:0051537
AF-A0A4R2UPC6-F1-model_v4 deleted 0.9771 2 101

Map