F418296

General Info

Members Datasets Scaffolds Average Seq Length
350 211 700 86

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10000839|Ga0265332_1000083912
Length 103
Sequence MLAASRYLEPTRNVCIMIRTILTEALLFLTPFAVYAVFLWATRAGVIDPLSWTPPVLAWLAIVALAAVIGGFLAMAEFSGAPPGSVYVPAHVENGRLIPGTTK

Samples

Sample ID Description Type Environment
1 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
184 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
185 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
186 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
187 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
188 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
189 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
190 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
191 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
192 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
193 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
194 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
195 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
196 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
197 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
198 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
199 2904699407
200 2906610324
201 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
202 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
203 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
204 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
205 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
206 2922425934
207 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
208 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
209 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
210 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
211 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.93
Metatranscriptomes 0.58
Isolates 7.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.57
Nodule 4.86
Rhizoplane 6
Rhizosphere 73.71
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265332_10000839 3300031238 Bacteria 18678
2 JGI25406J46586_10029213 3300003203 Bacteria 2090
3 Ga0070658_10182790 3300005327 Bacteria 1765
4 Ga0070658_10443559 3300005327 Bacteria 1118
5 Ga0070660_100227458 3300005339 Bacteria 1517
6 Ga0070689_101394597 3300005340 Bacteria 633
7 Ga0070691_10404727 3300005341 Bacteria 770
8 Ga0070661_100414382 3300005344 Bacteria 1067
9 Ga0070673_100783037 3300005364 Bacteria 880
10 Ga0070713_100338195 3300005436 Bacteria 1394
11 Ga0070713_100525687 3300005436 Bacteria 1118
12 Ga0070713_100539374 3300005436 Bacteria 1104
13 Ga0070710_11058104 3300005437 Bacteria 594
14 Ga0070711_100686799 3300005439 Bacteria 861
15 Ga0070711_101349114 3300005439 Bacteria 620
16 Ga0070705_100202323 3300005440 Bacteria 1362
17 Ga0070663_100024589 3300005455 Bacteria 4056
18 Ga0070663_101972071 3300005455 Bacteria 525
19 Ga0070681_11972311 3300005458 Bacteria 512
20 Ga0070699_102007850 3300005518 Bacteria 529
21 Ga0070679_101924064 3300005530 Bacteria 540
22 Ga0070684_100032285 3300005535 Bacteria 4461
23 Ga0070684_100922416 3300005535 Bacteria 818
24 Ga0068853_100425585 3300005539 Bacteria 1246
25 Ga0068853_100867815 3300005539 Bacteria 866
26 Ga0070672_100192818 3300005543 Bacteria 1702
27 Ga0068856_101259784 3300005614 Unclassified 755
28 Ga0068856_102216320 3300005614 Bacteria 558
29 Ga0068864_101001508 3300005618 Bacteria 829
30 Ga0081455_10266349 3300005937 Bacteria 1245
31 Ga0081540_1026792 3300005983 Bacteria 3281
32 Ga0081540_1179130 3300005983 Bacteria 796
33 Ga0081539_10001260 3300005985 Bacteria 44845
34 Ga0070717_10022620 3300006028 Bacteria 4970
35 Ga0070717_10107495 3300006028 Bacteria 2376
36 Ga0070717_11392522 3300006028 Bacteria 637
37 Ga0075365_10104007 3300006038 Bacteria 1947
38 Ga0075365_11184123 3300006038 Bacteria 538
39 Ga0075368_10009630 3300006042 Bacteria 3478
40 Ga0075363_100004615 3300006048 Bacteria 6051
41 Ga0075364_10094988 3300006051 Bacteria 1981
42 Ga0070712_100769012 3300006175 Bacteria 825
43 Ga0075362_10386061 3300006177 Bacteria 705
44 Ga0075362_10650255 3300006177 Bacteria 547
45 Ga0075367_10308222 3300006178 Bacteria 997
46 Ga0075369_10058525 3300006186 Bacteria 1678
47 Ga0075366_10007892 3300006195 Bacteria 5887
48 Ga0075366_10267425 3300006195 Bacteria 1044
49 Ga0075366_10359061 3300006195 Bacteria 895
50 Ga0075370_10001231 3300006353 Bacteria 10859
51 Ga0075370_10046961 3300006353 Bacteria 2445
52 Ga0075431_100729947 3300006847 Bacteria 967
53 Ga0105240_10105287 3300009093 Bacteria 3425
54 Ga0105240_10165981 3300009093 Bacteria 2619
55 Ga0105240_10447560 3300009093 Bacteria 1446
56 Ga0105240_10930385 3300009093 Bacteria 933
57 Ga0105240_11101820 3300009093 Bacteria 845
58 Ga0105240_11396066 3300009093 Bacteria 736
59 Ga0105240_12208629 3300009093 Bacteria 571
60 Ga0105240_12514649 3300009093 Bacteria 532
61 Ga0111539_11465644 3300009094 Bacteria 792
62 Ga0105245_10492815 3300009098 Bacteria 1240
63 Ga0114129_10217083 3300009147 Bacteria 2582
64 Ga0105243_10041737 3300009148 Bacteria 3588
65 Ga0105241_10604345 3300009174 Bacteria 991
66 Ga0105237_10149469 3300009545 Bacteria 2332
67 Ga0105237_10249248 3300009545 Bacteria 1778
68 Ga0105237_10411500 3300009545 Bacteria 1357
69 Ga0105238_10026223 3300009551 Bacteria 5939
70 Ga0105238_10078003 3300009551 Bacteria 3303
71 Ga0105238_10443796 3300009551 Bacteria 1294
72 Ga0105238_11818035 3300009551 Unclassified 641
73 Ga0157370_10318931 3300013104 Bacteria 1434
74 Ga0157370_10495248 3300013104 Bacteria 1122
75 Ga0157370_10551042 3300013104 Bacteria 1057
76 Ga0157369_10006379 3300013105 Bacteria 13682
77 Ga0157369_10013807 3300013105 Bacteria 9129
78 Ga0157369_10860179 3300013105 Bacteria 931
79 Ga0157369_11526308 3300013105 Bacteria 679
80 Ga0157372_10779086 3300013307 Bacteria 1112
81 Ga0157377_10953627 3300014745 Bacteria 646
82 Ga0157379_11384563 3300014968 Bacteria 681
83 Ga0206353_10524120 3300020082 Bacteria 910
84 Ga0213873_10016025 3300021358 Bacteria 1688
85 Ga0213873_10030168 3300021358 Bacteria 1341
86 Ga0213872_10248635 3300021361 Archaea 750
87 Ga0213874_10023014 3300021377 Bacteria 1734
88 Ga0213876_10047151 3300021384 Bacteria 2278
89 Ga0213876_10239063 3300021384 Bacteria 965
90 Ga0213871_10029062 3300021441 Bacteria 1431
91 Ga0224572_1059257 3300024225 Bacteria 710
92 Ga0228598_1018373 3300024227 Bacteria 1379
93 Ga0207642_10155560 3300025899 Bacteria 1222
94 Ga0207647_10318465 3300025904 Bacteria 884
95 Ga0207699_10031035 3300025906 Bacteria 2997
96 Ga0207705_10148118 3300025909 Bacteria 1757
97 Ga0207705_10452660 3300025909 Bacteria 995
98 Ga0207707_11125930 3300025912 Bacteria 639
99 Ga0207707_11445914 3300025912 Bacteria 547
100 Ga0207695_10063997 3300025913 Bacteria 3789
101 Ga0207695_10447524 3300025913 Bacteria 1175
102 Ga0207695_10469505 3300025913 Bacteria 1141
103 Ga0207695_10889106 3300025913 Bacteria 770
104 Ga0207671_10903452 3300025914 Bacteria 698
105 Ga0207671_11032660 3300025914 Bacteria 647
106 Ga0207693_10710007 3300025915 Bacteria 778
107 Ga0207663_10390016 3300025916 Bacteria 1063
108 Ga0207657_10251303 3300025919 Bacteria 1409
109 Ga0207652_11566893 3300025921 Bacteria 563
110 Ga0207700_10056042 3300025928 Bacteria 2965
111 Ga0207700_10526860 3300025928 Bacteria 1047
112 Ga0207700_10556340 3300025928 Bacteria 1019
113 Ga0207670_10952798 3300025936 Bacteria 721
114 Ga0207691_10546850 3300025940 Bacteria 982
115 Ga0207689_11709489 3300025942 Bacteria 521
116 Ga0207661_10001720 3300025944 Bacteria 14979
117 Ga0207661_10206347 3300025944 Bacteria 1730
118 Ga0207661_10347723 3300025944 Bacteria 1337
119 Ga0207661_10385922 3300025944 Bacteria 1268
120 Ga0207667_10186437 3300025949 Bacteria 2130
121 Ga0207651_10575981 3300025960 Bacteria 982
122 Ga0207651_11661760 3300025960 Bacteria 575
123 Ga0207668_11817893 3300025972 Bacteria 550
124 Ga0207640_10376680 3300025981 Bacteria 1149
125 Ga0207639_11290901 3300026041 Bacteria 685
126 Ga0207678_10146177 3300026067 Bacteria 2018
127 Ga0207702_12219192 3300026078 Bacteria 538
128 Ga0207674_10374232 3300026116 Bacteria 1377
129 Ga0207674_10419012 3300026116 Bacteria 1294
130 Ga0207698_12597434 3300026142 Bacteria 516
131 Ga0209813_10058398 3300027866 Bacteria 1226
132 Ga0265760_10114161 3300031090 Bacteria 862
133 Ga0265330_10178559 3300031235 Bacteria 899
134 Ga0265330_10247805 3300031235 Bacteria 751
135 Ga0265330_10305852 3300031235 Bacteria 670
136 Ga0265332_10268151 3300031238 Bacteria 706
137 Ga0265325_10012865 3300031241 Bacteria 4774
138 Ga0265325_10131968 3300031241 Bacteria 1195
139 Ga0265325_10167115 3300031241 Bacteria 1032
140 Ga0265329_10021273 3300031242 Bacteria 2180
141 Ga0265329_10217996 3300031242 Bacteria 631
142 Ga0265340_10000382 3300031247 Bacteria 23632
143 Ga0265339_10001051 3300031249 Bacteria 20994
144 Ga0265339_10004523 3300031249 Bacteria 9466
145 Ga0265339_10203564 3300031249 Bacteria 975
146 Ga0265331_10019051 3300031250 Bacteria 3548
147 Ga0265331_10111510 3300031250 Bacteria 1255
148 Ga0265316_10120922 3300031344 Bacteria 1978
149 Ga0265316_10148330 3300031344 Bacteria 1758
150 Ga0265316_10329716 3300031344 Bacteria 1107
151 Ga0307508_10770646 3300031616 Bacteria 577
152 Ga0265314_10038121 3300031711 Bacteria 3476
153 Ga0265314_10050315 3300031711 Bacteria 2911
154 Ga0265314_10055438 3300031711 Bacteria 2736
155 Ga0265314_10725679 3300031711 Bacteria 501
156 Ga0265342_10000179 3300031712 Bacteria 70615
157 Ga0265342_10195850 3300031712 Bacteria 1101
158 Ga0265342_10208441 3300031712 Bacteria 1058
159 Ga0373923_0453780 3300035111 Bacteria 622
160 Ga0373953_0319512 3300035117 Unclassified 679
161 Ga0373931_0908407 3300035691 Bacteria 592
162 Ga0373947_0659846 3300035725 Bacteria 713
163 Ga0373937_2078713 3300036401 Bacteria 514
164 Ga0395900_0138884 3300037418 Bacteria 2489
165 Ga0395900_0287510 3300037418 Bacteria 1634
166 Ga0395898_0006221 3300037466 Bacteria 12787
167 Ga0395898_1558439 3300037466 Bacteria 586
168 Ga0436364_0100052 3300037853 Bacteria 715
169 Ga0436364_0620402 3300037853 Bacteria 1532
170 Ga0436364_0631169 3300037853 Unclassified 697
171 Ga0436364_0641947 3300037853 Unclassified 553
172 Ga0395901_0107046 3300038443 Bacteria 2935
173 Ga0436365_1413221 3300039437 Bacteria 3028
174 Ga0436365_1515081 3300039437 Bacteria 8731
175 Ga0436360_0042619 3300039438 Unclassified 565
176 Ga0436360_0113707 3300039438 Bacteria 1039
177 Ga0436360_0747026 3300039438 Bacteria 1011
178 Ga0436360_0952889 3300039438 Bacteria 856
179 Ga0436360_0955411 3300039438 Bacteria 1290
180 Ga0436360_1339914 3300039438 Unclassified 540
181 Ga0436361_0193461 3300039447 Unclassified 1072
182 Ga0436363_0420889 3300039450 Bacteria 1784
183 Ga0436363_1065912 3300039450 Bacteria 2065
184 Ga0436362_0462952 3300039453 Bacteria 1614
185 Ga0436362_0659264 3300039453 Unclassified 622
186 Ga0436362_1132119 3300039453 Bacteria 4029
187 Ga0466966_0045467 3300044684 Bacteria 2807
188 Ga0466961_0159671 3300044693 Bacteria 1405
189 Ga0466971_0113744 3300044719 Bacteria 1250
190 Ga0466968_0237221 3300044735 Bacteria 863
191 Ga0466959_0009215 3300045049 Bacteria 7012
192 Ga0466958_0065413 3300045836 Bacteria 2219
193 Ga0466967_0236578 3300045976 Bacteria 1741
194 Ga0495592_0700587 3300046454 Bacteria 609
195 Ga0495639_0158978 3300046475 Bacteria 1093
196 Ga0495584_0107620 3300046491 Bacteria 1410
197 Ga0495652_0179777 3300046529 Bacteria 1625
198 Ga0495667_0493748 3300046559 Unclassified 767
199 Ga0495599_0734683 3300046678 Bacteria 567
200 Ga0495674_0955920 3300047319 Bacteria 659
201 Ga0495684_0790356 3300047471 Bacteria 621
202 Ga0495602_0238123 3300048088 Bacteria 1363
203 Ga0495602_0761987 3300048088 Unclassified 652
204 Ga0495602_1035886 3300048088 Bacteria 540
205 Ga0496100_0773406 3300048903 Bacteria 751
206 Ga0496101_0481023 3300048904 Bacteria 980
207 Ga0496101_0638675 3300048904 Bacteria 841
208 Ga0496102_0473980 3300048905 Unclassified 1173
209 Ga0496102_1297361 3300048905 Unclassified 647
210 Ga0496102_1652191 3300048905 Bacteria 559
211 Ga0496104_0088203 3300048907 Bacteria 2963
212 Ga0496105_0098051 3300048908 Bacteria 2421
213 Ga0496106_0237808 3300048909 Bacteria 1455
214 Ga0496107_0230415 3300048910 Bacteria 1378
215 Ga0496107_0833536 3300048910 Bacteria 674
216 Ga0496110_0133186 3300048913 Bacteria 2245
217 Ga0496114_0293866 3300048917 Bacteria 1434
218 Ga0496114_0427994 3300048917 Bacteria 1173
219 Ga0496114_1493889 3300048917 Bacteria 563
220 Ga0496115_0018626 3300048918 Bacteria 5335
221 Ga0496115_0249437 3300048918 Bacteria 1462
222 Ga0496115_0670836 3300048918 Bacteria 818
223 Ga0496115_1364262 3300048918 Bacteria 525
224 Ga0496126_0053854 3300048929 Bacteria 3648
225 Ga0496126_0583805 3300048929 Bacteria 882
226 Ga0501031_0035486 3300049568 Bacteria 3252
227 Ga0501031_0158328 3300049568 Bacteria 1480
228 Ga0501032_0237451 3300049569 Bacteria 1184
229 Ga0501032_0301102 3300049569 Bacteria 1036
230 Ga0501033_0007661 3300049570 Bacteria 8383
231 Ga0501033_0155767 3300049570 Bacteria 1646
232 Ga0501033_0660893 3300049570 Bacteria 713
233 Ga0501033_0660915 3300049570 Bacteria 713
234 Ga0501034_0029876 3300049571 Bacteria 5540
235 Ga0501034_0034234 3300049571 Bacteria 5150
236 Ga0501034_0170764 3300049571 Bacteria 2142
237 Ga0501034_0455658 3300049571 Bacteria 1196
238 Ga0501034_0759585 3300049571 Bacteria 864
239 Ga0501036_0052372 3300049572 Bacteria 3457
240 Ga0501036_0071275 3300049572 Bacteria 2938
241 Ga0501036_0616353 3300049572 Bacteria 899
242 Ga0501037_0024204 3300049573 Bacteria 4490
243 Ga0501037_0119968 3300049573 Bacteria 1891
244 Ga0501037_0154663 3300049573 Bacteria 1637
245 Ga0501037_0299330 3300049573 Bacteria 1117
246 Ga0501038_0073266 3300049574 Bacteria 2900
247 Ga0501038_0504566 3300049574 Bacteria 924
248 Ga0501038_0527331 3300049574 Bacteria 900
249 Ga0501039_0126755 3300049575 Bacteria 2002
250 Ga0501039_0170042 3300049575 Bacteria 1713
251 Ga0501040_0021329 3300049576 Bacteria 4325
252 Ga0501042_0030095 3300049578 Bacteria 3833
253 Ga0501043_0018518 3300049579 Bacteria 5463
254 Ga0501043_0027137 3300049579 Bacteria 4495
255 Ga0501043_0142813 3300049579 Bacteria 1874
256 Ga0501043_0213116 3300049579 Bacteria 1496
257 Ga0501043_0293201 3300049579 Bacteria 1245
258 Ga0501043_1233463 3300049579 Bacteria 524
259 Ga0501046_0119848 3300049580 Bacteria 2002
260 Ga0501047_0008451 3300049581 Bacteria 9715
261 Ga0501047_0061109 3300049581 Bacteria 3635
262 Ga0501047_0106097 3300049581 Bacteria 2690
263 Ga0501047_0119434 3300049581 Bacteria 2518
264 Ga0501048_0052492 3300049582 Bacteria 2901
265 Ga0501067_0067534 3300049583 Bacteria 1979
266 Ga0501068_0007338 3300049584 Bacteria 6105
267 Ga0501069_0029012 3300049585 Bacteria 3035
268 Ga0501070_0055732 3300049586 Bacteria 3276
269 Ga0501070_0082409 3300049586 Bacteria 2662
270 Ga0501072_0008410 3300049588 Bacteria 7832
271 Ga0501072_0033728 3300049588 Bacteria 4011
272 Ga0501072_0678640 3300049588 Bacteria 810
273 Ga0501073_0046445 3300049589 Bacteria 3054
274 Ga0501073_0072957 3300049589 Bacteria 2390
275 Ga0501073_0174441 3300049589 Bacteria 1488
276 Ga0501074_0015233 3300049590 Bacteria 5588
277 Ga0501075_0229301 3300049591 Bacteria 1416
278 Ga0501076_1118776 3300049592 Bacteria 648
279 Ga0501077_0322188 3300049593 Bacteria 985
280 Ga0501079_0066443 3300049741 Bacteria 2782
281 Ga0501080_0008473 3300049742 Bacteria 9317
282 Ga0501080_0100638 3300049742 Bacteria 2681
283 Ga0501080_0268113 3300049742 Bacteria 1554
284 Ga0501083_0092442 3300049744 Bacteria 1997
285 Ga0501083_0110420 3300049744 Bacteria 1808
286 Ga0501083_0448637 3300049744 Bacteria 839
287 Ga0501083_0666613 3300049744 Bacteria 676
288 Ga0501035_0049366 3300049822 Bacteria 3771
289 Ga0501035_0186835 3300049822 Bacteria 1783
290 Ga0501035_0207287 3300049822 Bacteria 1678
291 Ga0501044_0008204 3300049823 Bacteria 11460
292 Ga0501044_0063828 3300049823 Bacteria 3760
293 Ga0501044_0128509 3300049823 Bacteria 2529
294 Ga0501045_0020077 3300049824 Bacteria 4769
295 nmdc:mga03683_338961_c1 3300050489 Bacteria 710
296 nmdc:mga03683_370559_c1 3300050489 Bacteria 680
297 nmdc:mga00v17_23861_c1 3300050491 Bacteria 3542
298 nmdc:mga0k408_168872_c1 3300050493 Bacteria 1304
299 nmdc:mga0k408_256490_c1 3300050493 Bacteria 1044
300 nmdc:mga0k408_412743_c1 3300050493 Bacteria 803
301 nmdc:mga0k408_76864_c1 3300050493 Bacteria 1952
302 nmdc:mga06z11_38156_c1 3300050494 Bacteria 2384
303 nmdc:mga06z11_394786_c1 3300050494 Bacteria 832
304 nmdc:mga06z11_642489_c1 3300050494 Bacteria 646
305 nmdc:mga04h51_297682_c1 3300050495 Bacteria 657
306 nmdc:mga07m45_115929_c1 3300050496 Bacteria 1545
307 nmdc:mga06r32_1023303_c1 3300050510 Bacteria 778
308 nmdc:mga08y16_1332661_c1 3300050511 Bacteria 683
309 nmdc:mga08y16_1964221_c1 3300050511 Unclassified 535
310 nmdc:mga0n895_1851516_c1 3300050512 Bacteria 563
311 nmdc:mga0sz30_431890_c1 3300050516 Bacteria 591
312 Ga0495601_0634439 3300053077 Bacteria 684
313 Ga0495619_0259780 3300053085 Bacteria 1204
314 Ga0500568_0013383 3300053139 Bacteria 3742
315 Ga0500656_054149 3300053732 Bacteria 589
316 Ga0501084_0013841 3300054114 Bacteria 6678
317 Ga0501084_1847489 3300054114 Bacteria 504
318 Ga0501082_0000285 3300060353 Bacteria 44550
319 Ga0501082_0237144 3300060353 Bacteria 1587
320 Ga0501082_1441035 3300060353 Bacteria 601
321 Ga0466962_0035385 3300061719 Bacteria 2391
322 2513655776 2513237096 Bacteria 8722461
323 2513717452 2513237104 Bacteria 10034502
324 2513856729 2513237137 Bacteria 9558895
325 2513917311 2513237145 Bacteria 8979722
326 2517895404 2517572143 Bacteria 9484767
327 2524540495 2524023228 Bacteria 10118060
328 2603857764 2602042107 Bacteria 6226103
329 2643757305 2643221547 Bacteria 4740017
330 2671122079 2667528175 Bacteria 7532676
331 2728750863 2728368998 Bacteria 8720350
332 2857527137 2857524615 Bacteria 6615449
333 2876769081 2876761206 Bacteria 10111113
334 2885378932 2885374607 Bacteria 8927485
335 2893068085 2893066018 Bacteria 6158120
336 2903759083 2903748898 Bacteria 9972761
337 2904698745 2904690495 Bacteria 9412302
338 2904710867
339 2906615987
340 2906639074 2906635258 Bacteria 8601019
341 2906665219 2906660503 Bacteria 8595048
342 2908759259 2908756301 Bacteria 8864324
343 2922361431 2922361189 Bacteria 7436256
344 2922388854 2922386360 Bacteria 7017218
345 2922432047
346 3005476931 3005474847 Bacteria 9259049
347 8006934489 8006933436 Bacteria 10410654
348 8006974459 8006973647 Bacteria 10679141
349 8019564194 8019555841 Bacteria 9642137
350 8019574270 8019565922 Bacteria 9639779
351 Ga0265332_10000839
352 JGI25406J46586_10029213
353 Ga0070658_10182790
354 Ga0070658_10443559
355 Ga0070660_100227458
356 Ga0070689_101394597
357 Ga0070691_10404727
358 Ga0070661_100414382
359 Ga0070673_100783037
360 Ga0070713_100338195
361 Ga0070713_100525687
362 Ga0070713_100539374
363 Ga0070710_11058104
364 Ga0070711_100686799
365 Ga0070711_101349114
366 Ga0070705_100202323
367 Ga0070663_100024589
368 Ga0070663_101972071
369 Ga0070681_11972311
370 Ga0070699_102007850
371 Ga0070679_101924064
372 Ga0070684_100032285
373 Ga0070684_100922416
374 Ga0068853_100425585
375 Ga0068853_100867815
376 Ga0070672_100192818
377 Ga0068856_101259784
378 Ga0068856_102216320
379 Ga0068864_101001508
380 Ga0081455_10266349
381 Ga0081540_1026792
382 Ga0081540_1179130
383 Ga0081539_10001260
384 Ga0070717_10022620
385 Ga0070717_10107495
386 Ga0070717_11392522
387 Ga0075365_10104007
388 Ga0075365_11184123
389 Ga0075368_10009630
390 Ga0075363_100004615
391 Ga0075364_10094988
392 Ga0070712_100769012
393 Ga0075362_10386061
394 Ga0075362_10650255
395 Ga0075367_10308222
396 Ga0075369_10058525
397 Ga0075366_10007892
398 Ga0075366_10267425
399 Ga0075366_10359061
400 Ga0075370_10001231
401 Ga0075370_10046961
402 Ga0075431_100729947
403 Ga0105240_10105287
404 Ga0105240_10165981
405 Ga0105240_10447560
406 Ga0105240_10930385
407 Ga0105240_11101820
408 Ga0105240_11396066
409 Ga0105240_12208629
410 Ga0105240_12514649
411 Ga0111539_11465644
412 Ga0105245_10492815
413 Ga0114129_10217083
414 Ga0105243_10041737
415 Ga0105241_10604345
416 Ga0105237_10149469
417 Ga0105237_10249248
418 Ga0105237_10411500
419 Ga0105238_10026223
420 Ga0105238_10078003
421 Ga0105238_10443796
422 Ga0105238_11818035
423 Ga0157370_10318931
424 Ga0157370_10495248
425 Ga0157370_10551042
426 Ga0157369_10006379
427 Ga0157369_10013807
428 Ga0157369_10860179
429 Ga0157369_11526308
430 Ga0157372_10779086
431 Ga0157377_10953627
432 Ga0157379_11384563
433 Ga0206353_10524120
434 Ga0213873_10016025
435 Ga0213873_10030168
436 Ga0213872_10248635
437 Ga0213874_10023014
438 Ga0213876_10047151
439 Ga0213876_10239063
440 Ga0213871_10029062
441 Ga0224572_1059257
442 Ga0228598_1018373
443 Ga0207642_10155560
444 Ga0207647_10318465
445 Ga0207699_10031035
446 Ga0207705_10148118
447 Ga0207705_10452660
448 Ga0207707_11125930
449 Ga0207707_11445914
450 Ga0207695_10063997
451 Ga0207695_10447524
452 Ga0207695_10469505
453 Ga0207695_10889106
454 Ga0207671_10903452
455 Ga0207671_11032660
456 Ga0207693_10710007
457 Ga0207663_10390016
458 Ga0207657_10251303
459 Ga0207652_11566893
460 Ga0207700_10056042
461 Ga0207700_10526860
462 Ga0207700_10556340
463 Ga0207670_10952798
464 Ga0207691_10546850
465 Ga0207689_11709489
466 Ga0207661_10001720
467 Ga0207661_10206347
468 Ga0207661_10347723
469 Ga0207661_10385922
470 Ga0207667_10186437
471 Ga0207651_10575981
472 Ga0207651_11661760
473 Ga0207668_11817893
474 Ga0207640_10376680
475 Ga0207639_11290901
476 Ga0207678_10146177
477 Ga0207702_12219192
478 Ga0207674_10374232
479 Ga0207674_10419012
480 Ga0207698_12597434
481 Ga0209813_10058398
482 Ga0265760_10114161
483 Ga0265330_10178559
484 Ga0265330_10247805
485 Ga0265330_10305852
486 Ga0265332_10268151
487 Ga0265325_10012865
488 Ga0265325_10131968
489 Ga0265325_10167115
490 Ga0265329_10021273
491 Ga0265329_10217996
492 Ga0265340_10000382
493 Ga0265339_10001051
494 Ga0265339_10004523
495 Ga0265339_10203564
496 Ga0265331_10019051
497 Ga0265331_10111510
498 Ga0265316_10120922
499 Ga0265316_10148330
500 Ga0265316_10329716
501 Ga0307508_10770646
502 Ga0265314_10038121
503 Ga0265314_10050315
504 Ga0265314_10055438
505 Ga0265314_10725679
506 Ga0265342_10000179
507 Ga0265342_10195850
508 Ga0265342_10208441
509 Ga0373923_0453780
510 Ga0373953_0319512
511 Ga0373931_0908407
512 Ga0373947_0659846
513 Ga0373937_2078713
514 Ga0395900_0138884
515 Ga0395900_0287510
516 Ga0395898_0006221
517 Ga0395898_1558439
518 Ga0436364_0100052
519 Ga0436364_0620402
520 Ga0436364_0631169
521 Ga0436364_0641947
522 Ga0395901_0107046
523 Ga0436365_1413221
524 Ga0436365_1515081
525 Ga0436360_0042619
526 Ga0436360_0113707
527 Ga0436360_0747026
528 Ga0436360_0952889
529 Ga0436360_0955411
530 Ga0436360_1339914
531 Ga0436361_0193461
532 Ga0436363_0420889
533 Ga0436363_1065912
534 Ga0436362_0462952
535 Ga0436362_0659264
536 Ga0436362_1132119
537 Ga0466966_0045467
538 Ga0466961_0159671
539 Ga0466971_0113744
540 Ga0466968_0237221
541 Ga0466959_0009215
542 Ga0466958_0065413
543 Ga0466967_0236578
544 Ga0495592_0700587
545 Ga0495639_0158978
546 Ga0495584_0107620
547 Ga0495652_0179777
548 Ga0495667_0493748
549 Ga0495599_0734683
550 Ga0495674_0955920
551 Ga0495684_0790356
552 Ga0495602_0238123
553 Ga0495602_0761987
554 Ga0495602_1035886
555 Ga0496100_0773406
556 Ga0496101_0481023
557 Ga0496101_0638675
558 Ga0496102_0473980
559 Ga0496102_1297361
560 Ga0496102_1652191
561 Ga0496104_0088203
562 Ga0496105_0098051
563 Ga0496106_0237808
564 Ga0496107_0230415
565 Ga0496107_0833536
566 Ga0496110_0133186
567 Ga0496114_0293866
568 Ga0496114_0427994
569 Ga0496114_1493889
570 Ga0496115_0018626
571 Ga0496115_0249437
572 Ga0496115_0670836
573 Ga0496115_1364262
574 Ga0496126_0053854
575 Ga0496126_0583805
576 Ga0501031_0035486
577 Ga0501031_0158328
578 Ga0501032_0237451
579 Ga0501032_0301102
580 Ga0501033_0007661
581 Ga0501033_0155767
582 Ga0501033_0660893
583 Ga0501033_0660915
584 Ga0501034_0029876
585 Ga0501034_0034234
586 Ga0501034_0170764
587 Ga0501034_0455658
588 Ga0501034_0759585
589 Ga0501036_0052372
590 Ga0501036_0071275
591 Ga0501036_0616353
592 Ga0501037_0024204
593 Ga0501037_0119968
594 Ga0501037_0154663
595 Ga0501037_0299330
596 Ga0501038_0073266
597 Ga0501038_0504566
598 Ga0501038_0527331
599 Ga0501039_0126755
600 Ga0501039_0170042
601 Ga0501040_0021329
602 Ga0501042_0030095
603 Ga0501043_0018518
604 Ga0501043_0027137
605 Ga0501043_0142813
606 Ga0501043_0213116
607 Ga0501043_0293201
608 Ga0501043_1233463
609 Ga0501046_0119848
610 Ga0501047_0008451
611 Ga0501047_0061109
612 Ga0501047_0106097
613 Ga0501047_0119434
614 Ga0501048_0052492
615 Ga0501067_0067534
616 Ga0501068_0007338
617 Ga0501069_0029012
618 Ga0501070_0055732
619 Ga0501070_0082409
620 Ga0501072_0008410
621 Ga0501072_0033728
622 Ga0501072_0678640
623 Ga0501073_0046445
624 Ga0501073_0072957
625 Ga0501073_0174441
626 Ga0501074_0015233
627 Ga0501075_0229301
628 Ga0501076_1118776
629 Ga0501077_0322188
630 Ga0501079_0066443
631 Ga0501080_0008473
632 Ga0501080_0100638
633 Ga0501080_0268113
634 Ga0501083_0092442
635 Ga0501083_0110420
636 Ga0501083_0448637
637 Ga0501083_0666613
638 Ga0501035_0049366
639 Ga0501035_0186835
640 Ga0501035_0207287
641 Ga0501044_0008204
642 Ga0501044_0063828
643 Ga0501044_0128509
644 Ga0501045_0020077
645 nmdc:mga03683_338961_c1
646 nmdc:mga03683_370559_c1
647 nmdc:mga00v17_23861_c1
648 nmdc:mga0k408_168872_c1
649 nmdc:mga0k408_256490_c1
650 nmdc:mga0k408_412743_c1
651 nmdc:mga0k408_76864_c1
652 nmdc:mga06z11_38156_c1
653 nmdc:mga06z11_394786_c1
654 nmdc:mga06z11_642489_c1
655 nmdc:mga04h51_297682_c1
656 nmdc:mga07m45_115929_c1
657 nmdc:mga06r32_1023303_c1
658 nmdc:mga08y16_1332661_c1
659 nmdc:mga08y16_1964221_c1
660 nmdc:mga0n895_1851516_c1
661 nmdc:mga0sz30_431890_c1
662 Ga0495601_0634439
663 Ga0495619_0259780
664 Ga0500568_0013383
665 Ga0500656_054149
666 Ga0501084_0013841
667 Ga0501084_1847489
668 Ga0501082_0000285
669 Ga0501082_0237144
670 Ga0501082_1441035
671 Ga0466962_0035385
672 2513655776
673 2513717452
674 2513856729
675 2513917311
676 2517895404
677 2524540495
678 2603857764
679 2643757305
680 2671122079
681 2728750863
682 2857527137
683 2876769081
684 2885378932
685 2893068085
686 2903759083
687 2904698745
688 2904710867
689 2906615987
690 2906639074
691 2906665219
692 2908759259
693 2922361431
694 2922388854
695 2922432047
696 3005476931
697 8006934489
698 8006974459
699 8019564194
700 8019574270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19606

DUF6111

Family of unknown function (DUF6111)

17

103

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fcm-assembly2.cif.gz_B crystal structure of a nudix hydrolase from clostridium perfringens 0.858 69 86
6ous-assembly1.cif.gz_D structure of fusion glycoprotein from human respiratory syncytial virus 0.4957 38 82
2d3o-assembly1.cif.gz_1 structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans 0.4795 45 82
7xqc-assembly1.cif.gz_C-2 crystal structure of n-terminal domain of rv2908c fused with maltose binding protein (mbp) 0.4528 48 87
4lg4-assembly6.cif.gz_F structural basis for autoactivation of human mst2 kinase and its regulation by rassf5 0.4477 49 81
ID Description Score Start End Superfamily
af_Q60365_1_132_2.40.30.30 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.5902 68 86 2.40.30.30
3wyoA02 Special;Helix non-globular;Helix Hairpins; 0.5883 12 66 6.10.140.2110
3wyoA02 Special;Helix non-globular;Helix Hairpins; 0.5678 12 66 6.10.140.2110
af_Q4DQ16_48_144_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5422 47 78 3.30.200.20
af_A4HZB4_16_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5364 44 81 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A537VQR1-F1-model_v4 Uncharacterized protein 0.8124 24 87 GO:0016020
AF-D1BST4-F1-model_v4 HipA N-terminal domain protein 0.7819 63 87 GO:0004674
GO:0005829
AF-A0A2M8ZXR1-F1-model_v4 deleted 0.6458 1 87
AF-A0A327KBN0-F1-model_v4 Uncharacterized protein 0.6444 1 87 GO:0016020
AF-A0A4R3MIB1-F1-model_v4 Phospholipase D-like protein 0.6417 1 87 GO:0016020

Map