F418284

General Info

Members Datasets Scaffolds Average Seq Length
350 191 350 124

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_11313027|Ga0207639_113130272
Length 146
Sequence MAVAILREGDLLIASIESDLSDSEVIALRDDLTRMVGDHRIQGIVIDVAALDVIDSFVARALRAIVLTARLRGAETVIIGIQPDVAIAMVQFRLNLEPLRAALDLEAAKAILLRRTQGDADAGLRADEDDVDAPLGRPCEGWRGHG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 11.43
Rhizosphere 83.14
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10006153 3300003373 Bacteria 2980
2 Ga0070683_100103291 3300005329 Bacteria 2685
3 Ga0070683_100254408 3300005329 Bacteria 1670
4 Ga0070683_101038358 3300005329 Bacteria 787
5 Ga0070690_100007946 3300005330 Bacteria 6089
6 Ga0068869_100304519 3300005334 Bacteria 1288
7 Ga0068869_101512467 3300005334 Bacteria 596
8 Ga0070682_100968371 3300005337 Bacteria 704
9 Ga0068868_100017256 3300005338 Bacteria 5374
10 Ga0068868_101233009 3300005338 Bacteria 693
11 Ga0068868_101536347 3300005338 Bacteria 624
12 Ga0070660_100104893 3300005339 Bacteria 2243
13 Ga0070660_100898902 3300005339 Bacteria 747
14 Ga0070689_100183565 3300005340 Bacteria 1700
15 Ga0070689_100561513 3300005340 Bacteria 984
16 Ga0070687_100167739 3300005343 Bacteria 1304
17 Ga0070692_10033415 3300005345 Bacteria 2592
18 Ga0070668_101591191 3300005347 Unclassified 599
19 Ga0070668_101672547 3300005347 Bacteria 584
20 Ga0070669_101264145 3300005353 Unclassified 639
21 Ga0070669_101525486 3300005353 Unclassified 581
22 Ga0070675_100297664 3300005354 Bacteria 1421
23 Ga0070671_100112164 3300005355 Bacteria 2290
24 Ga0070688_100116919 3300005365 Bacteria 1781
25 Ga0070659_100143473 3300005366 Unclassified 1945
26 Ga0070701_10095443 3300005438 Bacteria 1638
27 Ga0070711_100132222 3300005439 Bacteria 1860
28 Ga0070711_101097588 3300005439 Unclassified 685
29 Ga0070700_100060961 3300005441 Bacteria 2379
30 Ga0070700_100159172 3300005441 Bacteria 1552
31 Ga0070694_101744908 3300005444 Viruses 530
32 Ga0070663_100139883 3300005455 Bacteria 1847
33 Ga0070662_100504195 3300005457 Bacteria 1010
34 Ga0068867_100040872 3300005459 Unclassified 3388
35 Ga0068867_100417475 3300005459 Bacteria 1136
36 Ga0070679_101106005 3300005530 Bacteria 737
37 Ga0070684_100556642 3300005535 Bacteria 1064
38 Ga0070684_101467646 3300005535 Bacteria 643
39 Ga0068853_100290416 3300005539 Bacteria 1509
40 Ga0070672_101114843 3300005543 Unclassified 701
41 Ga0070695_100284199 3300005545 Bacteria 1217
42 Ga0070693_101124938 3300005547 Bacteria 600
43 Ga0070665_100006780 3300005548 Bacteria 11641
44 Ga0070665_100167967 3300005548 Bacteria 2196
45 Ga0070664_100051755 3300005564 Bacteria 3477
46 Ga0068856_100709769 3300005614 Bacteria 1026
47 Ga0068856_101752794 3300005614 Bacteria 633
48 Ga0068856_101873448 3300005614 Unclassified 611
49 Ga0068856_102495617 3300005614 Unclassified 524
50 Ga0070702_100221397 3300005615 Bacteria 1265
51 Ga0068852_100116192 3300005616 Bacteria 2441
52 Ga0068852_100774316 3300005616 Bacteria 973
53 Ga0068859_100435915 3300005617 Bacteria 1407
54 Ga0068859_100826495 3300005617 Bacteria 1013
55 Ga0068864_100056238 3300005618 Bacteria 3399
56 Ga0068864_100417981 3300005618 Bacteria 1277
57 Ga0068861_100019053 3300005719 Bacteria 4899
58 Ga0068861_100042447 3300005719 Bacteria 3408
59 Ga0068861_100501929 3300005719 Bacteria 1097
60 Ga0068861_100693175 3300005719 Bacteria 946
61 Ga0068861_101072265 3300005719 Bacteria 773
62 Ga0068851_10527889 3300005834 Unclassified 711
63 Ga0068863_100039068 3300005841 Bacteria 4517
64 Ga0068863_100841589 3300005841 Bacteria 916
65 Ga0068858_100780604 3300005842 Bacteria 932
66 Ga0068860_100633125 3300005843 Unclassified 1077
67 Ga0068862_100313260 3300005844 Bacteria 1447
68 Ga0068862_100758450 3300005844 Bacteria 945
69 Ga0081538_10002507 3300005981 Bacteria 17877
70 Ga0081538_10017972 3300005981 Bacteria 5337
71 Ga0081538_10261763 3300005981 Bacteria 652
72 Ga0081538_10276731 3300005981 Unclassified 625
73 Ga0075432_10048115 3300006058 Bacteria 1500
74 Ga0075432_10073882 3300006058 Bacteria 1228
75 Ga0070712_100112624 3300006175 Bacteria 2033
76 Ga0070712_100143526 3300006175 Bacteria 1825
77 Ga0097621_101013945 3300006237 Bacteria 777
78 Ga0075428_100123939 3300006844 Bacteria 2813
79 Ga0075428_101202845 3300006844 Bacteria 799
80 Ga0075430_100028878 3300006846 Bacteria 4709
81 Ga0075430_100906730 3300006846 Bacteria 726
82 Ga0075431_100003238 3300006847 Bacteria 15768
83 Ga0075431_100040845 3300006847 Bacteria 4782
84 Ga0075431_100048324 3300006847 Bacteria 4388
85 Ga0075433_10734988 3300006852 Unclassified 864
86 Ga0075434_100703659 3300006871 Bacteria 1028
87 Ga0075429_100205165 3300006880 Bacteria 1727
88 Ga0068865_100213584 3300006881 Bacteria 1505
89 Ga0097620_100435907 3300006931 Bacteria 1407
90 Ga0097620_100826735 3300006931 Bacteria 1013
91 Ga0075435_100240890 3300007076 Bacteria 1538
92 Ga0105251_10102614 3300009011 Bacteria 1306
93 Ga0105240_11346956 3300009093 Bacteria 752
94 Ga0111539_10059192 3300009094 Bacteria 4544
95 Ga0111539_10663154 3300009094 Bacteria 1215
96 Ga0111539_10754209 3300009094 Bacteria 1133
97 Ga0111539_10917791 3300009094 Bacteria 1018
98 Ga0111539_11064690 3300009094 Unclassified 940
99 Ga0105245_10004446 3300009098 Bacteria 12392
100 Ga0105245_10106291 3300009098 Bacteria 2604
101 Ga0105245_10477113 3300009098 Archaea 1260
102 Ga0105245_10520882 3300009098 Bacteria 1207
103 Ga0105245_11950304 3300009098 Bacteria 640
104 Ga0105247_10036353 3300009101 Bacteria 3002
105 Ga0105247_10373921 3300009101 Bacteria 1008
106 Ga0114129_10069543 3300009147 Bacteria 4907
107 Ga0114129_11026765 3300009147 Bacteria 1037
108 Ga0114129_12404423 3300009147 Bacteria 631
109 Ga0105243_10053590 3300009148 Bacteria 3200
110 Ga0105243_10056409 3300009148 Bacteria 3124
111 Ga0105243_11864292 3300009148 Bacteria 633
112 Ga0105248_10117700 3300009177 Bacteria 2997
113 Ga0105237_10378089 3300009545 Bacteria 1421
114 Ga0105238_10694222 3300009551 Bacteria 1030
115 Ga0105249_10016136 3300009553 Bacteria 6622
116 Ga0105249_10051436 3300009553 Bacteria 3758
117 Ga0105249_12392881 3300009553 Bacteria 601
118 Ga0105239_10086079 3300010375 Bacteria 3464
119 Ga0105239_10142558 3300010375 Bacteria 2671
120 Ga0105239_10634886 3300010375 Bacteria 1219
121 Ga0105246_10387086 3300011119 Bacteria 1157
122 Ga0105246_10453057 3300011119 Bacteria 1079
123 Ga0157374_10400215 3300013296 Bacteria 1370
124 Ga0157378_10193919 3300013297 Bacteria 1918
125 Ga0157378_10229398 3300013297 Bacteria 1769
126 Ga0157378_10843264 3300013297 Bacteria 944
127 Ga0163162_10364538 3300013306 Bacteria 1578
128 Ga0163162_10852510 3300013306 Bacteria 1026
129 Ga0157372_11339572 3300013307 Bacteria 826
130 Ga0157372_11548106 3300013307 Bacteria 764
131 Ga0157375_10171282 3300013308 Bacteria 2319
132 Ga0157375_11552176 3300013308 Bacteria 782
133 Ga0157380_12563647 3300014326 Bacteria 576
134 Ga0157379_10221538 3300014968 Bacteria 1714
135 Ga0157379_11642459 3300014968 Bacteria 628
136 Ga0157379_12107330 3300014968 Bacteria 559
137 Ga0163161_10410754 3300017792 Unclassified 1087
138 Ga0163161_11532561 3300017792 Bacteria 586
139 Ga0213874_10014295 3300021377 Bacteria 2073
140 Ga0213876_10038300 3300021384 Bacteria 2530
141 Ga0213876_10062803 3300021384 Bacteria 1961
142 Ga0213876_10754113 3300021384 Unclassified 518
143 Ga0213875_10001260 3300021388 Bacteria 17022
144 Ga0213875_10051158 3300021388 Unclassified 1935
145 Ga0207713_1213619 3300025735 Bacteria 585
146 Ga0207642_10015531 3300025899 Bacteria 2840
147 Ga0207710_10016442 3300025900 Bacteria 3130
148 Ga0207688_10005206 3300025901 Bacteria 7068
149 Ga0207688_10261962 3300025901 Bacteria 1049
150 Ga0207643_10040242 3300025908 Bacteria 2631
151 Ga0207671_11553120 3300025914 Bacteria 510
152 Ga0207693_10208917 3300025915 Bacteria 1535
153 Ga0207663_10144808 3300025916 Bacteria 1660
154 Ga0207660_10794971 3300025917 Bacteria 772
155 Ga0207662_10073419 3300025918 Bacteria 2075
156 Ga0207657_10138072 3300025919 Bacteria 1993
157 Ga0207657_10707592 3300025919 Bacteria 782
158 Ga0207649_11070678 3300025920 Unclassified 636
159 Ga0207687_10026256 3300025927 Bacteria 3898
160 Ga0207687_10036833 3300025927 Bacteria 3334
161 Ga0207706_10284842 3300025933 Bacteria 1441
162 Ga0207706_10510279 3300025933 Bacteria 1037
163 Ga0207709_10066566 3300025935 Bacteria 2270
164 Ga0207709_10107631 3300025935 Bacteria 1857
165 Ga0207709_10957170 3300025935 Bacteria 698
166 Ga0207704_10035176 3300025938 Bacteria 2867
167 Ga0207704_10180363 3300025938 Bacteria 1525
168 Ga0207691_10126112 3300025940 Bacteria 2265
169 Ga0207711_10247196 3300025941 Bacteria 1637
170 Ga0207689_10040922 3300025942 Bacteria 3834
171 Ga0207661_10340527 3300025944 Bacteria 1351
172 Ga0207661_10629057 3300025944 Bacteria 986
173 Ga0207661_11083760 3300025944 Bacteria 738
174 Ga0207679_10301011 3300025945 Bacteria 1382
175 Ga0207679_11292090 3300025945 Bacteria 670
176 Ga0207679_12189748 3300025945 Bacteria 501
177 Ga0207667_10387011 3300025949 Unclassified 1425
178 Ga0207712_10025784 3300025961 Bacteria 3910
179 Ga0207712_10050104 3300025961 Bacteria 2914
180 Ga0207668_10153881 3300025972 Bacteria 1784
181 Ga0207668_10452301 3300025972 Bacteria 1096
182 Ga0207668_11636122 3300025972 Bacteria 581
183 Ga0207640_10173799 3300025981 Bacteria 1608
184 Ga0207640_10179751 3300025981 Bacteria 1585
185 Ga0207677_10260784 3300026023 Bacteria 1413
186 Ga0207677_11277767 3300026023 Bacteria 674
187 Ga0207703_11046567 3300026035 Bacteria 783
188 Ga0207639_11313027 3300026041 Bacteria 679
189 Ga0207639_11648878 3300026041 Unclassified 601
190 Ga0207639_11781424 3300026041 Bacteria 576
191 Ga0207678_10069242 3300026067 Bacteria 3025
192 Ga0207708_10100184 3300026075 Bacteria 2242
193 Ga0207708_10301068 3300026075 Bacteria 1304
194 Ga0207702_10306799 3300026078 Bacteria 1508
195 Ga0207702_10619502 3300026078 Bacteria 1063
196 Ga0207702_11147964 3300026078 Bacteria 771
197 Ga0207702_11506780 3300026078 Unclassified 666
198 Ga0207702_12034887 3300026078 Unclassified 564
199 Ga0207641_10098190 3300026088 Unclassified 2575
200 Ga0207641_10767774 3300026088 Bacteria 952
201 Ga0207648_10114256 3300026089 Bacteria 2372
202 Ga0207648_10183241 3300026089 Bacteria 1854
203 Ga0207676_10171386 3300026095 Bacteria 1891
204 Ga0207676_10432344 3300026095 Bacteria 1237
205 Ga0207675_100008644 3300026118 Bacteria 9574
206 Ga0207675_100312474 3300026118 Bacteria 1533
207 Ga0207675_100642805 3300026118 Bacteria 1066
208 Ga0207683_10227517 3300026121 Bacteria 1700
209 Ga0207698_10040741 3300026142 Bacteria 3455
210 Ga0207698_11320256 3300026142 Unclassified 736
211 Ga0207428_10029188 3300027907 Unclassified 4575
212 Ga0268266_10069177 3300028379 Bacteria 3058
213 Ga0268266_10375639 3300028379 Bacteria 1340
214 Ga0268265_10186574 3300028380 Bacteria 1787
215 Ga0268264_11550600 3300028381 Viruses 673
216 Ga0268264_11727967 3300028381 Unclassified 636
217 Ga0307508_10000001 3300031616 Bacteria 553635
218 Ga0307508_10030725 3300031616 Bacteria 4855
219 Ga0307405_10816566 3300031731 Bacteria 782
220 Ga0307405_12135404 3300031731 Bacteria 503
221 Ga0307413_10045336 3300031824 Bacteria 2606
222 Ga0307410_10057255 3300031852 Bacteria 2654
223 Ga0307410_10589393 3300031852 Bacteria 926
224 Ga0307406_10705951 3300031901 Bacteria 843
225 Ga0307407_10173138 3300031903 Bacteria 1424
226 Ga0307407_10515790 3300031903 Bacteria 878
227 Ga0307409_100003922 3300031995 Bacteria 8237
228 Ga0307409_100056487 3300031995 Bacteria 3036
229 Ga0307409_100394203 3300031995 Bacteria 1320
230 Ga0307409_101710214 3300031995 Unclassified 658
231 Ga0307416_100109863 3300032002 Bacteria 2426
232 Ga0307416_100528399 3300032002 Bacteria 1249
233 Ga0307414_10184192 3300032004 Bacteria 1683
234 Ga0307414_11352212 3300032004 Bacteria 661
235 Ga0307411_11606511 3300032005 Unclassified 600
236 Ga0307415_100051603 3300032126 Bacteria 2792
237 Ga0307415_100083278 3300032126 Bacteria 2291
238 Ga0307415_101355916 3300032126 Unclassified 676
239 Ga0373941_0240816 3300035115 Unclassified 703
240 Ga0373925_0135806 3300037068 Bacteria 1922
241 Ga0395900_0128630 3300037418 Bacteria 2596
242 Ga0395900_0271057 3300037418 Bacteria 1692
243 Ga0395900_0428864 3300037418 Bacteria 1282
244 Ga0395900_0824162 3300037418 Bacteria 855
245 Ga0395900_1493537 3300037418 Bacteria 588
246 Ga0395898_0256762 3300037466 Bacteria 1667
247 Ga0395898_0423752 3300037466 Bacteria 1268
248 Ga0395898_0478909 3300037466 Bacteria 1184
249 Ga0395905_0278395 3300037471 Bacteria 1559
250 Ga0436364_0072848 3300037853 Bacteria 133330
251 Ga0436364_0739461 3300037853 Bacteria 1293
252 Ga0436364_1255801 3300037853 Bacteria 25543
253 Ga0436364_1292961 3300037853 Unclassified 1295
254 Ga0395901_0082490 3300038443 Bacteria 3359
255 Ga0395901_0361701 3300038443 Bacteria 1496
256 Ga0395901_0660224 3300038443 Bacteria 1048
257 Ga0242420_055971 3300038996 Bacteria 779
258 Ga0436365_0348289 3300039437 Bacteria 6539
259 Ga0436365_0382065 3300039437 Bacteria 1349
260 Ga0436365_0746322 3300039437 Bacteria 4377
261 Ga0436363_0958512 3300039450 Bacteria 2735
262 Ga0436362_0089229 3300039453 Bacteria 1492
263 Ga0436362_1108335 3300039453 Unclassified 713
264 Ga0451845_0986775 3300041501 Bacteria 507
265 Ga0451853_1671783 3300041512 Bacteria 2123
266 Ga0439448_0157263 3300042005 Unclassified 790
267 Ga0439463_046431 3300042016 Bacteria 1106
268 Ga0439458_0070901 3300042157 Unclassified 880
269 Ga0439464_0223828 3300042439 Bacteria 604
270 Ga0439460_0205578 3300042461 Bacteria 672
271 Ga0466965_0309967 3300044683 Bacteria 858
272 Ga0466968_0221326 3300044735 Bacteria 892
273 Ga0466960_0117717 3300044901 Bacteria 1388
274 Ga0466960_0165168 3300044901 Bacteria 1191
275 Ga0466967_0052915 3300045976 Bacteria 3567
276 Ga0466967_0349142 3300045976 Bacteria 1432
277 Ga0466967_0417122 3300045976 Bacteria 1308
278 Ga0466967_0907012 3300045976 Bacteria 876
279 Ga0495641_0044194 3300046461 Bacteria 2057
280 Ga0495584_0156020 3300046491 Bacteria 1160
281 Ga0495596_0192721 3300046500 Bacteria 792
282 Ga0495656_0399050 3300046615 Bacteria 719
283 Ga0495658_0438224 3300046683 Bacteria 834
284 Ga0495671_0550986 3300046692 Bacteria 549
285 Ga0495589_0446502 3300046794 Bacteria 592
286 Ga0495672_0028137 3300047320 Bacteria 3562
287 Ga0495676_0385381 3300047321 Bacteria 932
288 Ga0496100_0025199 3300048903 Bacteria 3636
289 Ga0496100_0722170 3300048903 Bacteria 778
290 Ga0496101_0396719 3300048904 Bacteria 1086
291 Ga0496102_0216233 3300048905 Bacteria 1806
292 Ga0496103_0022892 3300048906 Bacteria 3765
293 Ga0496104_0416354 3300048907 Bacteria 1256
294 Ga0496104_0515920 3300048907 Bacteria 1106
295 Ga0496106_0234559 3300048909 Bacteria 1465
296 Ga0496106_0604957 3300048909 Bacteria 878
297 Ga0496106_1105789 3300048909 Bacteria 621
298 Ga0496107_0096534 3300048910 Bacteria 2163
299 Ga0496107_1116064 3300048910 Viruses 569
300 Ga0496108_0081407 3300048911 Bacteria 2744
301 Ga0496108_0171079 3300048911 Bacteria 1879
302 Ga0496108_0271023 3300048911 Bacteria 1477
303 Ga0496109_0030947 3300048912 Bacteria 4798
304 Ga0496109_0031941 3300048912 Bacteria 4729
305 Ga0496109_0158630 3300048912 Bacteria 2119
306 Ga0496109_1448399 3300048912 Bacteria 622
307 Ga0496110_0064826 3300048913 Bacteria 3229
308 Ga0496110_0360139 3300048913 Bacteria 1325
309 Ga0496110_0493943 3300048913 Bacteria 1114
310 Ga0496110_0785925 3300048913 Bacteria 856
311 Ga0496110_0971086 3300048913 Unclassified 757
312 Ga0496110_1146188 3300048913 Bacteria 686
313 Ga0496110_1525389 3300048913 Bacteria 578
314 Ga0496111_0019720 3300048914 Bacteria 4689
315 Ga0496111_0134844 3300048914 Bacteria 1828
316 Ga0496111_0933605 3300048914 Bacteria 624
317 Ga0496111_1067959 3300048914 Unclassified 576
318 Ga0496111_1218747 3300048914 Bacteria 533
319 Ga0496112_0063787 3300048915 Bacteria 3634
320 Ga0496112_0234353 3300048915 Bacteria 1790
321 Ga0496112_0554202 3300048915 Bacteria 1083
322 Ga0496112_1444193 3300048915 Bacteria 602
323 Ga0496112_1535658 3300048915 Unclassified 579
324 Ga0496113_0115066 3300048916 Bacteria 2098
325 Ga0496114_0028231 3300048917 Bacteria 4603
326 Ga0496114_0155311 3300048917 Bacteria 1987
327 Ga0496115_0043624 3300048918 Bacteria 3577
328 Ga0501034_0141915 3300049571 Bacteria 2381
329 Ga0501067_0482387 3300049583 Unclassified 693
330 Ga0501071_0678242 3300049587 Bacteria 793
331 nmdc:mga0yw44_617867_c1 3300050492 Bacteria 736
332 nmdc:mga05p37_106871_c1 3300050507 Bacteria 3443
333 nmdc:mga05p37_1773719_c1 3300050507 Bacteria 597
334 nmdc:mga09592_175396_c1 3300050508 Bacteria 1854
335 nmdc:mga0qj67_4673_c1 3300050509 Bacteria 9940
336 nmdc:mga06r32_11041_c1 3300050510 Bacteria 8130
337 nmdc:mga06r32_36765_c1 3300050510 Bacteria 4630
338 nmdc:mga06r32_66001_c1 3300050510 Bacteria 3492
339 nmdc:mga06r32_780950_c1 3300050510 Bacteria 917
340 nmdc:mga08y16_136241_c1 3300050511 Bacteria 2552
341 nmdc:mga08y16_1955987_c1 3300050511 Bacteria 536
342 nmdc:mga08y16_211325_c1 3300050511 Bacteria 2009
343 nmdc:mga0n895_1387834_c1 3300050512 Bacteria 671
344 nmdc:mga0n895_54279_c1 3300050512 Bacteria 3941
345 nmdc:mga0rr50_235453_c1 3300050513 Bacteria 1516
346 nmdc:mga0rr50_249364_c1 3300050513 Bacteria 1474
347 nmdc:mga08x19_771422_c1 3300050514 Bacteria 683
348 nmdc:mga08x19_949956_c1 3300050514 Unclassified 611
349 nmdc:mga0a205_49225_c1 3300050515 Bacteria 4067
350 Ga0530510_0563397 3300061734 Bacteria 866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025917 Ga0207660_10794971 Ga0207660_107949711 117
2 3300009093 Ga0105240_11346956 Ga0105240_113469561 118
3 3300037466 Ga0395898_0478909 Ga0395898_0478909_104_472 119
4 3300044683 Ga0466965_0309967 Ga0466965_0309967_205_564 119
5 3300044735 Ga0466968_0221326 Ga0466968_0221326_412_780 119
6 3300044901 Ga0466960_0165168 Ga0466960_0165168_820_1179 119
7 3300045976 Ga0466967_0052915 Ga0466967_0052915_1547_1906 119
8 3300045976 Ga0466967_0417122 Ga0466967_0417122_307_675 119
9 3300045976 Ga0466967_0907012 Ga0466967_0907012_446_805 119
10 3300048909 Ga0496106_1105789 Ga0496106_1105789_94_453 119
11 3300050512 nmdc:mga0n895_1387834_c1 nmdc:mga0n895_1387834_c1_57_416 119
12 3300005439 Ga0070711_101097588 Ga0070711_1010975881 120
13 3300026035 Ga0207703_11046567 Ga0207703_110465672 120
14 3300031995 Ga0307409_100394203 Ga0307409_1003942032 120
15 3300005614 Ga0068856_101752794 Ga0068856_1017527942 121
16 3300049571 Ga0501034_0141915 Ga0501034_0141915_1640_2008 121
17 3300005841 Ga0068863_100039068 Ga0068863_1000390686 122
18 3300011119 Ga0105246_10387086 Ga0105246_103870863 122
19 3300026088 Ga0207641_10098190 Ga0207641_100981902 122
20 3300031616 Ga0307508_10000001 Ga0307508_10000001426 122
21 3300031616 Ga0307508_10030725 Ga0307508_100307254 122
22 3300037418 Ga0395900_0271057 Ga0395900_0271057_381_755 122
23 3300038443 Ga0395901_0082490 Ga0395901_0082490_2681_3055 122
24 3300005329 Ga0070683_101038358 Ga0070683_1010383581 123
25 3300005334 Ga0068869_101512467 Ga0068869_1015124671 123
26 3300005337 Ga0070682_100968371 Ga0070682_1009683712 123
27 3300005617 Ga0068859_100826495 Ga0068859_1008264952 123
28 3300005618 Ga0068864_100417981 Ga0068864_1004179813 123
29 3300006931 Ga0097620_100826735 Ga0097620_1008267352 123
30 3300014968 Ga0157379_11642459 Ga0157379_116424592 123
31 3300025944 Ga0207661_10629057 Ga0207661_106290572 123
32 3300025945 Ga0207679_12189748 Ga0207679_121897482 123
33 3300026095 Ga0207676_10432344 Ga0207676_104323442 123
34 3300044901 Ga0466960_0117717 Ga0466960_0117717_173_547 123
35 3300048911 Ga0496108_0081407 Ga0496108_0081407_471_848 123
36 3300048912 Ga0496109_0158630 Ga0496109_0158630_576_953 123
37 3300048913 Ga0496110_0785925 Ga0496110_0785925_49_426 123
38 3300003373 JGI25407J50210_10006153 JGI25407J50210_100061533 124
39 3300005329 Ga0070683_100103291 Ga0070683_1001032914 124
40 3300005329 Ga0070683_100254408 Ga0070683_1002544084 124
41 3300005330 Ga0070690_100007946 Ga0070690_10000794610 124
42 3300005334 Ga0068869_100304519 Ga0068869_1003045192 124
43 3300005338 Ga0068868_100017256 Ga0068868_1000172563 124
44 3300005338 Ga0068868_101233009 Ga0068868_1012330092 124
45 3300005338 Ga0068868_101536347 Ga0068868_1015363472 124
46 3300005339 Ga0070660_100104893 Ga0070660_1001048932 124
47 3300005339 Ga0070660_100898902 Ga0070660_1008989022 124
48 3300005340 Ga0070689_100183565 Ga0070689_1001835652 124
49 3300005340 Ga0070689_100561513 Ga0070689_1005615131 124
50 3300005343 Ga0070687_100167739 Ga0070687_1001677392 124
51 3300005345 Ga0070692_10033415 Ga0070692_100334151 124
52 3300005347 Ga0070668_101591191 Ga0070668_1015911912 124
53 3300005347 Ga0070668_101672547 Ga0070668_1016725472 124
54 3300005353 Ga0070669_101264145 Ga0070669_1012641452 124
55 3300005353 Ga0070669_101525486 Ga0070669_1015254861 124
56 3300005354 Ga0070675_100297664 Ga0070675_1002976642 124
57 3300005355 Ga0070671_100112164 Ga0070671_1001121644 124
58 3300005365 Ga0070688_100116919 Ga0070688_1001169192 124
59 3300005366 Ga0070659_100143473 Ga0070659_1001434731 124
60 3300005438 Ga0070701_10095443 Ga0070701_100954432 124
61 3300005439 Ga0070711_100132222 Ga0070711_1001322222 124
62 3300005441 Ga0070700_100060961 Ga0070700_1000609613 124
63 3300005441 Ga0070700_100159172 Ga0070700_1001591723 124
64 3300005444 Ga0070694_101744908 Ga0070694_1017449081 124
65 3300005455 Ga0070663_100139883 Ga0070663_1001398833 124
66 3300005457 Ga0070662_100504195 Ga0070662_1005041952 124
67 3300005459 Ga0068867_100040872 Ga0068867_1000408722 124
68 3300005459 Ga0068867_100417475 Ga0068867_1004174752 124
69 3300005530 Ga0070679_101106005 Ga0070679_1011060052 124
70 3300005535 Ga0070684_100556642 Ga0070684_1005566423 124
71 3300005535 Ga0070684_101467646 Ga0070684_1014676461 124
72 3300005539 Ga0068853_100290416 Ga0068853_1002904161 124
73 3300005543 Ga0070672_101114843 Ga0070672_1011148432 124
74 3300005545 Ga0070695_100284199 Ga0070695_1002841992 124
75 3300005547 Ga0070693_101124938 Ga0070693_1011249382 124
76 3300005548 Ga0070665_100006780 Ga0070665_10000678011 124
77 3300005548 Ga0070665_100167967 Ga0070665_1001679672 124
78 3300005564 Ga0070664_100051755 Ga0070664_1000517554 124
79 3300005614 Ga0068856_100709769 Ga0068856_1007097692 124
80 3300005614 Ga0068856_101873448 Ga0068856_1018734481 124
81 3300005614 Ga0068856_102495617 Ga0068856_1024956171 124
82 3300005615 Ga0070702_100221397 Ga0070702_1002213972 124
83 3300005616 Ga0068852_100116192 Ga0068852_1001161924 124
84 3300005616 Ga0068852_100774316 Ga0068852_1007743162 124
85 3300005617 Ga0068859_100435915 Ga0068859_1004359152 124
86 3300005618 Ga0068864_100056238 Ga0068864_1000562382 124
87 3300005719 Ga0068861_100019053 Ga0068861_1000190532 124
88 3300005719 Ga0068861_100042447 Ga0068861_1000424472 124
89 3300005719 Ga0068861_100501929 Ga0068861_1005019292 124
90 3300005719 Ga0068861_100693175 Ga0068861_1006931752 124
91 3300005719 Ga0068861_101072265 Ga0068861_1010722652 124
92 3300005834 Ga0068851_10527889 Ga0068851_105278891 124
93 3300005841 Ga0068863_100841589 Ga0068863_1008415892 124
94 3300005842 Ga0068858_100780604 Ga0068858_1007806042 124
95 3300005843 Ga0068860_100633125 Ga0068860_1006331252 124
96 3300005844 Ga0068862_100313260 Ga0068862_1003132603 124
97 3300005844 Ga0068862_100758450 Ga0068862_1007584502 124
98 3300005981 Ga0081538_10002507 Ga0081538_100025078 124
99 3300005981 Ga0081538_10017972 Ga0081538_100179727 124
100 3300005981 Ga0081538_10261763 Ga0081538_102617632 124
101 3300005981 Ga0081538_10276731 Ga0081538_102767312 124
102 3300006058 Ga0075432_10048115 Ga0075432_100481152 124
103 3300006058 Ga0075432_10073882 Ga0075432_100738822 124
104 3300006175 Ga0070712_100112624 Ga0070712_1001126243 124
105 3300006175 Ga0070712_100143526 Ga0070712_1001435263 124
106 3300006237 Ga0097621_101013945 Ga0097621_1010139452 124
107 3300006844 Ga0075428_100123939 Ga0075428_1001239394 124
108 3300006844 Ga0075428_101202845 Ga0075428_1012028452 124
109 3300006846 Ga0075430_100028878 Ga0075430_1000288784 124
110 3300006846 Ga0075430_100906730 Ga0075430_1009067302 124
111 3300006847 Ga0075431_100003238 Ga0075431_1000032384 124
112 3300006847 Ga0075431_100040845 Ga0075431_1000408452 124
113 3300006847 Ga0075431_100048324 Ga0075431_1000483243 124
114 3300006852 Ga0075433_10734988 Ga0075433_107349882 124
115 3300006871 Ga0075434_100703659 Ga0075434_1007036592 124
116 3300006880 Ga0075429_100205165 Ga0075429_1002051651 124
117 3300006881 Ga0068865_100213584 Ga0068865_1002135841 124
118 3300006931 Ga0097620_100435907 Ga0097620_1004359072 124
119 3300007076 Ga0075435_100240890 Ga0075435_1002408902 124
120 3300009011 Ga0105251_10102614 Ga0105251_101026142 124
121 3300009094 Ga0111539_10059192 Ga0111539_100591921 124
122 3300009094 Ga0111539_10663154 Ga0111539_106631542 124
123 3300009094 Ga0111539_10754209 Ga0111539_107542092 124
124 3300009094 Ga0111539_10917791 Ga0111539_109177913 124
125 3300009094 Ga0111539_11064690 Ga0111539_110646902 124
126 3300009098 Ga0105245_10004446 Ga0105245_100044468 124
127 3300009098 Ga0105245_10106291 Ga0105245_101062913 124
128 3300009098 Ga0105245_10477113 Ga0105245_104771132 124
129 3300009098 Ga0105245_10520882 Ga0105245_105208822 124
130 3300009098 Ga0105245_11950304 Ga0105245_119503042 124
131 3300009101 Ga0105247_10036353 Ga0105247_100363534 124
132 3300009101 Ga0105247_10373921 Ga0105247_103739212 124
133 3300009147 Ga0114129_10069543 Ga0114129_100695434 124
134 3300009147 Ga0114129_11026765 Ga0114129_110267652 124
135 3300009147 Ga0114129_12404423 Ga0114129_124044231 124
136 3300009148 Ga0105243_10053590 Ga0105243_100535904 124
137 3300009148 Ga0105243_10056409 Ga0105243_100564094 124
138 3300009148 Ga0105243_11864292 Ga0105243_118642922 124
139 3300009177 Ga0105248_10117700 Ga0105248_101177004 124
140 3300009545 Ga0105237_10378089 Ga0105237_103780892 124
141 3300009551 Ga0105238_10694222 Ga0105238_106942222 124
142 3300009553 Ga0105249_10016136 Ga0105249_100161365 124
143 3300009553 Ga0105249_10051436 Ga0105249_100514365 124
144 3300009553 Ga0105249_12392881 Ga0105249_123928812 124
145 3300010375 Ga0105239_10086079 Ga0105239_100860794 124
146 3300010375 Ga0105239_10142558 Ga0105239_101425583 124
147 3300010375 Ga0105239_10634886 Ga0105239_106348863 124
148 3300011119 Ga0105246_10453057 Ga0105246_104530572 124
149 3300013296 Ga0157374_10400215 Ga0157374_104002152 124
150 3300013297 Ga0157378_10193919 Ga0157378_101939194 124
151 3300013297 Ga0157378_10229398 Ga0157378_102293982 124
152 3300013297 Ga0157378_10843264 Ga0157378_108432642 124
153 3300013306 Ga0163162_10364538 Ga0163162_103645383 124
154 3300013306 Ga0163162_10852510 Ga0163162_108525102 124
155 3300013307 Ga0157372_11339572 Ga0157372_113395722 124
156 3300013307 Ga0157372_11548106 Ga0157372_115481062 124
157 3300013308 Ga0157375_10171282 Ga0157375_101712823 124
158 3300013308 Ga0157375_11552176 Ga0157375_115521762 124
159 3300014326 Ga0157380_12563647 Ga0157380_125636471 124
160 3300014968 Ga0157379_10221538 Ga0157379_102215383 124
161 3300014968 Ga0157379_12107330 Ga0157379_121073301 124
162 3300017792 Ga0163161_10410754 Ga0163161_104107543 124
163 3300017792 Ga0163161_11532561 Ga0163161_115325611 124
164 3300021377 Ga0213874_10014295 Ga0213874_100142954 124
165 3300021384 Ga0213876_10038300 Ga0213876_100383004 124
166 3300021384 Ga0213876_10062803 Ga0213876_100628034 124
167 3300021384 Ga0213876_10754113 Ga0213876_107541131 124
168 3300021388 Ga0213875_10001260 Ga0213875_1000126017 124
169 3300021388 Ga0213875_10051158 Ga0213875_100511582 124
170 3300025735 Ga0207713_1213619 Ga0207713_12136192 124
171 3300025899 Ga0207642_10015531 Ga0207642_100155314 124
172 3300025900 Ga0207710_10016442 Ga0207710_100164423 124
173 3300025901 Ga0207688_10005206 Ga0207688_100052067 124
174 3300025901 Ga0207688_10261962 Ga0207688_102619622 124
175 3300025908 Ga0207643_10040242 Ga0207643_100402424 124
176 3300025914 Ga0207671_11553120 Ga0207671_115531201 124
177 3300025915 Ga0207693_10208917 Ga0207693_102089173 124
178 3300025916 Ga0207663_10144808 Ga0207663_101448082 124
179 3300025918 Ga0207662_10073419 Ga0207662_100734192 124
180 3300025919 Ga0207657_10138072 Ga0207657_101380722 124
181 3300025919 Ga0207657_10707592 Ga0207657_107075922 124
182 3300025920 Ga0207649_11070678 Ga0207649_110706782 124
183 3300025927 Ga0207687_10026256 Ga0207687_100262562 124
184 3300025927 Ga0207687_10036833 Ga0207687_100368332 124
185 3300025933 Ga0207706_10284842 Ga0207706_102848423 124
186 3300025933 Ga0207706_10510279 Ga0207706_105102792 124
187 3300025935 Ga0207709_10066566 Ga0207709_100665664 124
188 3300025935 Ga0207709_10107631 Ga0207709_101076313 124
189 3300025935 Ga0207709_10957170 Ga0207709_109571702 124
190 3300025938 Ga0207704_10035176 Ga0207704_100351762 124
191 3300025938 Ga0207704_10180363 Ga0207704_101803632 124
192 3300025940 Ga0207691_10126112 Ga0207691_101261124 124
193 3300025941 Ga0207711_10247196 Ga0207711_102471963 124
194 3300025942 Ga0207689_10040922 Ga0207689_100409225 124
195 3300025944 Ga0207661_10340527 Ga0207661_103405273 124
196 3300025944 Ga0207661_11083760 Ga0207661_110837602 124
197 3300025945 Ga0207679_10301011 Ga0207679_103010113 124
198 3300025945 Ga0207679_11292090 Ga0207679_112920901 124
199 3300025949 Ga0207667_10387011 Ga0207667_103870111 124
200 3300025961 Ga0207712_10025784 Ga0207712_100257845 124
201 3300025961 Ga0207712_10050104 Ga0207712_100501042 124
202 3300025972 Ga0207668_10153881 Ga0207668_101538812 124
203 3300025972 Ga0207668_10452301 Ga0207668_104523012 124
204 3300025972 Ga0207668_11636122 Ga0207668_116361222 124
205 3300025981 Ga0207640_10173799 Ga0207640_101737993 124
206 3300025981 Ga0207640_10179751 Ga0207640_101797512 124
207 3300026023 Ga0207677_10260784 Ga0207677_102607843 124
208 3300026023 Ga0207677_11277767 Ga0207677_112777672 124
209 3300026041 Ga0207639_11313027 Ga0207639_113130272 124
210 3300026041 Ga0207639_11648878 Ga0207639_116488782 124
211 3300026041 Ga0207639_11781424 Ga0207639_117814242 124
212 3300026067 Ga0207678_10069242 Ga0207678_100692422 124
213 3300026075 Ga0207708_10100184 Ga0207708_101001842 124
214 3300026075 Ga0207708_10301068 Ga0207708_103010681 124
215 3300026078 Ga0207702_10306799 Ga0207702_103067992 124
216 3300026078 Ga0207702_10619502 Ga0207702_106195022 124
217 3300026078 Ga0207702_11147964 Ga0207702_111479642 124
218 3300026078 Ga0207702_11506780 Ga0207702_115067802 124
219 3300026078 Ga0207702_12034887 Ga0207702_120348871 124
220 3300026088 Ga0207641_10767774 Ga0207641_107677742 124
221 3300026089 Ga0207648_10114256 Ga0207648_101142563 124
222 3300026089 Ga0207648_10183241 Ga0207648_101832413 124
223 3300026095 Ga0207676_10171386 Ga0207676_101713862 124
224 3300026118 Ga0207675_100008644 Ga0207675_1000086447 124
225 3300026118 Ga0207675_100312474 Ga0207675_1003124743 124
226 3300026118 Ga0207675_100642805 Ga0207675_1006428052 124
227 3300026121 Ga0207683_10227517 Ga0207683_102275172 124
228 3300026142 Ga0207698_10040741 Ga0207698_100407412 124
229 3300026142 Ga0207698_11320256 Ga0207698_113202562 124
230 3300027907 Ga0207428_10029188 Ga0207428_100291884 124
231 3300028379 Ga0268266_10069177 Ga0268266_100691774 124
232 3300028379 Ga0268266_10375639 Ga0268266_103756392 124
233 3300028380 Ga0268265_10186574 Ga0268265_101865743 124
234 3300028381 Ga0268264_11550600 Ga0268264_115506002 124
235 3300028381 Ga0268264_11727967 Ga0268264_117279671 124
236 3300031731 Ga0307405_10816566 Ga0307405_108165662 124
237 3300031731 Ga0307405_12135404 Ga0307405_121354042 124
238 3300031824 Ga0307413_10045336 Ga0307413_100453363 124
239 3300031852 Ga0307410_10057255 Ga0307410_100572553 124
240 3300031852 Ga0307410_10589393 Ga0307410_105893932 124
241 3300031901 Ga0307406_10705951 Ga0307406_107059512 124
242 3300031903 Ga0307407_10173138 Ga0307407_101731382 124
243 3300031903 Ga0307407_10515790 Ga0307407_105157902 124
244 3300031995 Ga0307409_100003922 Ga0307409_1000039224 124
245 3300031995 Ga0307409_100056487 Ga0307409_1000564874 124
246 3300031995 Ga0307409_101710214 Ga0307409_1017102141 124
247 3300032002 Ga0307416_100109863 Ga0307416_1001098634 124
248 3300032002 Ga0307416_100528399 Ga0307416_1005283993 124
249 3300032004 Ga0307414_10184192 Ga0307414_101841922 124
250 3300032004 Ga0307414_11352212 Ga0307414_113522122 124
251 3300032005 Ga0307411_11606511 Ga0307411_116065112 124
252 3300032126 Ga0307415_100051603 Ga0307415_1000516034 124
253 3300032126 Ga0307415_100083278 Ga0307415_1000832783 124
254 3300032126 Ga0307415_101355916 Ga0307415_1013559162 124
255 3300035115 Ga0373941_0240816 Ga0373941_0240816_49_423 124
256 3300037068 Ga0373925_0135806 Ga0373925_0135806_368_742 124
257 3300037418 Ga0395900_0128630 Ga0395900_0128630_1083_1457 124
258 3300037418 Ga0395900_0428864 Ga0395900_0428864_49_423 124
259 3300037418 Ga0395900_0824162 Ga0395900_0824162_376_750 124
260 3300037418 Ga0395900_1493537 Ga0395900_1493537_115_489 124
261 3300037466 Ga0395898_0256762 Ga0395898_0256762_1203_1577 124
262 3300037466 Ga0395898_0423752 Ga0395898_0423752_169_543 124
263 3300037471 Ga0395905_0278395 Ga0395905_0278395_632_1006 124
264 3300037853 Ga0436364_0072848 Ga0436364_0072848_98707_99081 124
265 3300037853 Ga0436364_0739461 Ga0436364_0739461_156_530 124
266 3300037853 Ga0436364_1255801 Ga0436364_1255801_14395_14769 124
267 3300037853 Ga0436364_1292961 Ga0436364_1292961_791_1165 124
268 3300038443 Ga0395901_0361701 Ga0395901_0361701_358_732 124
269 3300038443 Ga0395901_0660224 Ga0395901_0660224_555_929 124
270 3300038996 Ga0242420_055971 Ga0242420_055971_86_460 124
271 3300039437 Ga0436365_0348289 Ga0436365_0348289_4826_5200 124
272 3300039437 Ga0436365_0382065 Ga0436365_0382065_295_669 124
273 3300039437 Ga0436365_0746322 Ga0436365_0746322_3051_3425 124
274 3300039450 Ga0436363_0958512 Ga0436363_0958512_247_621 124
275 3300039453 Ga0436362_0089229 Ga0436362_0089229_779_1153 124
276 3300039453 Ga0436362_1108335 Ga0436362_1108335_125_499 124
277 3300041501 Ga0451845_0986775 Ga0451845_0986775_96_470 124
278 3300041512 Ga0451853_1671783 Ga0451853_1671783_702_1076 124
279 3300042005 Ga0439448_0157263 Ga0439448_0157263_256_630 124
280 3300042016 Ga0439463_046431 Ga0439463_046431_516_890 124
281 3300042157 Ga0439458_0070901 Ga0439458_0070901_258_632 124
282 3300042439 Ga0439464_0223828 Ga0439464_0223828_207_581 124
283 3300042461 Ga0439460_0205578 Ga0439460_0205578_10_384 124
284 3300045976 Ga0466967_0349142 Ga0466967_0349142_905_1279 124
285 3300046461 Ga0495641_0044194 Ga0495641_0044194_561_935 124
286 3300046491 Ga0495584_0156020 Ga0495584_0156020_98_472 124
287 3300046500 Ga0495596_0192721 Ga0495596_0192721_130_504 124
288 3300046615 Ga0495656_0399050 Ga0495656_0399050_276_650 124
289 3300046683 Ga0495658_0438224 Ga0495658_0438224_62_436 124
290 3300046692 Ga0495671_0550986 Ga0495671_0550986_138_512 124
291 3300046794 Ga0495589_0446502 Ga0495589_0446502_150_524 124
292 3300047320 Ga0495672_0028137 Ga0495672_0028137_199_573 124
293 3300047321 Ga0495676_0385381 Ga0495676_0385381_502_876 124
294 3300048903 Ga0496100_0025199 Ga0496100_0025199_1124_1498 124
295 3300048903 Ga0496100_0722170 Ga0496100_0722170_325_699 124
296 3300048904 Ga0496101_0396719 Ga0496101_0396719_167_541 124
297 3300048905 Ga0496102_0216233 Ga0496102_0216233_174_548 124
298 3300048906 Ga0496103_0022892 Ga0496103_0022892_1121_1495 124
299 3300048907 Ga0496104_0416354 Ga0496104_0416354_701_1075 124
300 3300048907 Ga0496104_0515920 Ga0496104_0515920_266_640 124
301 3300048909 Ga0496106_0234559 Ga0496106_0234559_399_773 124
302 3300048909 Ga0496106_0604957 Ga0496106_0604957_184_558 124
303 3300048910 Ga0496107_0096534 Ga0496107_0096534_1512_1886 124
304 3300048910 Ga0496107_1116064 Ga0496107_1116064_83_457 124
305 3300048911 Ga0496108_0171079 Ga0496108_0171079_11_385 124
306 3300048911 Ga0496108_0271023 Ga0496108_0271023_807_1181 124
307 3300048912 Ga0496109_0030947 Ga0496109_0030947_701_1075 124
308 3300048912 Ga0496109_0031941 Ga0496109_0031941_1250_1624 124
309 3300048912 Ga0496109_1448399 Ga0496109_1448399_132_506 124
310 3300048913 Ga0496110_0064826 Ga0496110_0064826_1213_1587 124
311 3300048913 Ga0496110_0360139 Ga0496110_0360139_22_396 124
312 3300048913 Ga0496110_0493943 Ga0496110_0493943_308_682 124
313 3300048913 Ga0496110_0971086 Ga0496110_0971086_205_579 124
314 3300048913 Ga0496110_1146188 Ga0496110_1146188_47_421 124
315 3300048913 Ga0496110_1525389 Ga0496110_1525389_109_483 124
316 3300048914 Ga0496111_0019720 Ga0496111_0019720_1898_2272 124
317 3300048914 Ga0496111_0134844 Ga0496111_0134844_1343_1717 124
318 3300048914 Ga0496111_0933605 Ga0496111_0933605_198_572 124
319 3300048914 Ga0496111_1067959 Ga0496111_1067959_185_559 124
320 3300048914 Ga0496111_1218747 Ga0496111_1218747_123_497 124
321 3300048915 Ga0496112_0063787 Ga0496112_0063787_1524_1898 124
322 3300048915 Ga0496112_0234353 Ga0496112_0234353_508_882 124
323 3300048915 Ga0496112_0554202 Ga0496112_0554202_298_672 124
324 3300048915 Ga0496112_1444193 Ga0496112_1444193_46_420 124
325 3300048915 Ga0496112_1535658 Ga0496112_1535658_110_484 124
326 3300048916 Ga0496113_0115066 Ga0496113_0115066_536_910 124
327 3300048917 Ga0496114_0028231 Ga0496114_0028231_2268_2642 124
328 3300048917 Ga0496114_0155311 Ga0496114_0155311_514_888 124
329 3300048918 Ga0496115_0043624 Ga0496115_0043624_1522_1896 124
330 3300049583 Ga0501067_0482387 Ga0501067_0482387_94_468 124
331 3300049587 Ga0501071_0678242 Ga0501071_0678242_51_425 124
332 3300050492 nmdc:mga0yw44_617867_c1 nmdc:mga0yw44_617867_c1_83_457 124
333 3300050507 nmdc:mga05p37_106871_c1 nmdc:mga05p37_106871_c1_1376_1750 124
334 3300050507 nmdc:mga05p37_1773719_c1 nmdc:mga05p37_1773719_c1_88_462 124
335 3300050508 nmdc:mga09592_175396_c1 nmdc:mga09592_175396_c1_203_577 124
336 3300050509 nmdc:mga0qj67_4673_c1 nmdc:mga0qj67_4673_c1_2165_2539 124
337 3300050510 nmdc:mga06r32_11041_c1 nmdc:mga06r32_11041_c1_4690_5064 124
338 3300050510 nmdc:mga06r32_36765_c1 nmdc:mga06r32_36765_c1_2188_2562 124
339 3300050510 nmdc:mga06r32_66001_c1 nmdc:mga06r32_66001_c1_3079_3453 124
340 3300050510 nmdc:mga06r32_780950_c1 nmdc:mga06r32_780950_c1_35_409 124
341 3300050511 nmdc:mga08y16_136241_c1 nmdc:mga08y16_136241_c1_386_760 124
342 3300050511 nmdc:mga08y16_1955987_c1 nmdc:mga08y16_1955987_c1_32_406 124
343 3300050511 nmdc:mga08y16_211325_c1 nmdc:mga08y16_211325_c1_875_1249 124
344 3300050512 nmdc:mga0n895_54279_c1 nmdc:mga0n895_54279_c1_3345_3719 124
345 3300050513 nmdc:mga0rr50_235453_c1 nmdc:mga0rr50_235453_c1_262_636 124
346 3300050513 nmdc:mga0rr50_249364_c1 nmdc:mga0rr50_249364_c1_269_643 124
347 3300050514 nmdc:mga08x19_771422_c1 nmdc:mga08x19_771422_c1_182_556 124
348 3300050514 nmdc:mga08x19_949956_c1 nmdc:mga08x19_949956_c1_154_528 124
349 3300050515 nmdc:mga0a205_49225_c1 nmdc:mga0a205_49225_c1_3648_4022 124
350 3300061734 Ga0530510_0563397 Ga0530510_0563397_129_503 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

2

108

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8726 1 115
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8588 1 115
6qcm-assembly1.cif.gz_I cryo em structure of the listeria stressosome 0.8461 1 115
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.8434 1 118
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.8308 1 118
ID Description Score Start End Superfamily
af_O59786_242_370_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8118 29 79 3.40.50.1400
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8026 4 116 3.30.750.24
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7948 2 85 3.30.750.24
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7942 28 74 3.40.50.1400
af_Q69TB1_279_409_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7905 29 79 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A2T1A8M4-F1-model_v4 RsbT antagonist protein RsbS 0.9552 1 112
AF-A0A2V7FHM0-F1-model_v4 STAS domain-containing protein 0.953 1 116
AF-A0A0Q2MF63-F1-model_v4 Anti-anti-sigma factor 0.9483 1 117
AF-A0A822J8V0-F1-model_v4 Partial RsbT antagonist protein RsbS 0.9449 1 79
AF-A0A1V2I0Y2-F1-model_v4 Sugar dehydratase 0.9446 3 113

Feature Viewer

pLDDT pTM Quality
89.15 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map