F418280

General Info

Members Datasets Scaffolds Average Seq Length
350 268 700 270

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10256519|Ga0207658_102565192
Length 314
Sequence LIDRTHRLPITRQAQLLGIFRANVYYKPVAASAEDLRQMRRIDELHLELPFAGARMLRDLLVLEGFRIGRKHVGTLMRIMGIEAIYRRKNTSKPHPDHTVFRYLLRKLVIDRPNQVWAADISYIPMARGFLYLIAIIDCFSRQVLAWRLSNSMAADFCVEALEEAVTRFGTPEIFNTDQGAQFTCTEFISVLKAHQIRISMDGKGRWRDNVFVERLWRSVKYEEVYLHAYESVTAARNGIGRYMNFFNTRRPHTALDRQTLDARLLRFAAARGGSITRRAPLIGTAKTVSFCGATSLAPGRDRSDSTLQQAGCS

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
190 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
191 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
192 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
210 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
211 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
216 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
217 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
220 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
221 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
227 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
228 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
229 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
246 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
247 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
248 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
254 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
255 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
256 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
257 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
258 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
259 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
260 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
261 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
262 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
263 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
264 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
265 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
266 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
267 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
268 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.71
Metatranscriptomes 0
Isolates 6.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 5.14
Rhizoplane 4.86
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10256519 3300025986 Bacteria 1488
2 JGI24739J22299_10056008 3300001989 Bacteria 1259
3 JGI24750J21931_1017140 3300002070 Bacteria 988
4 JGI24738J21930_10024091 3300002075 Bacteria 1253
5 JGI24749J21850_1010763 3300002076 Bacteria 1284
6 JGI24744J21845_10021372 3300002077 Bacteria 1273
7 JGI24742J22300_10015661 3300002244 Bacteria 1276
8 JGI25406J46586_10076198 3300003203 Bacteria 1039
9 Ga0065165_1009369 3300005262 Bacteria 4402
10 Ga0065712_10108043 3300005290 Bacteria 1883
11 Ga0068869_100108862 3300005334 Bacteria 2105
12 Ga0070680_100005289 3300005336 Bacteria 9762
13 Ga0070680_100271579 3300005336 Bacteria 1436
14 Ga0070682_100101161 3300005337 Bacteria 1903
15 Ga0070660_100132212 3300005339 Bacteria 1997
16 Ga0070691_10033470 3300005341 Bacteria 2418
17 Ga0070692_10302128 3300005345 Bacteria 977
18 Ga0070668_100390381 3300005347 Bacteria 1186
19 Ga0070669_100208467 3300005353 Bacteria 1541
20 Ga0070669_100440784 3300005353 Bacteria 1072
21 Ga0070673_100321416 3300005364 Bacteria 1367
22 Ga0070673_100342070 3300005364 Bacteria 1326
23 Ga0070703_10000639 3300005406 Bacteria 12271
24 Ga0070701_10035126 3300005438 Bacteria 2516
25 Ga0070705_100002089 3300005440 Bacteria 10191
26 Ga0070700_100007250 3300005441 Bacteria 5975
27 Ga0070694_100010621 3300005444 Bacteria 5688
28 Ga0070708_100015680 3300005445 Bacteria 6262
29 Ga0070663_100048222 3300005455 Bacteria 3019
30 Ga0070663_100214750 3300005455 Bacteria 1508
31 Ga0070681_10030199 3300005458 Bacteria 5437
32 Ga0070681_10404364 3300005458 Bacteria 1277
33 Ga0070706_100036804 3300005467 Bacteria 4520
34 Ga0070706_100296877 3300005467 Bacteria 1508
35 Ga0070707_100264049 3300005468 Bacteria 1674
36 Ga0070699_100020611 3300005518 Bacteria 5688
37 Ga0070679_100159623 3300005530 Bacteria 2229
38 Ga0070679_100406270 3300005530 Bacteria 1307
39 Ga0070684_100027593 3300005535 Bacteria 4794
40 Ga0070697_100048469 3300005536 Bacteria 3444
41 Ga0070697_100196679 3300005536 Bacteria 1713
42 Ga0070672_100210016 3300005543 Bacteria 1630
43 Ga0070695_100006458 3300005545 Bacteria 6934
44 Ga0070696_100012552 3300005546 Bacteria 5688
45 Ga0070665_100215394 3300005548 Bacteria 1921
46 Ga0070665_100670373 3300005548 Bacteria 1050
47 Ga0070704_100010321 3300005549 Bacteria 5681
48 Ga0068857_100013777 3300005577 Bacteria 7045
49 Ga0068857_100359759 3300005577 Bacteria 1349
50 Ga0068854_100226032 3300005578 Bacteria 1483
51 Ga0068859_100027750 3300005617 Bacteria 5678
52 Ga0068859_100560897 3300005617 Bacteria 1236
53 Ga0068864_100054786 3300005618 Bacteria 3442
54 Ga0068861_100140811 3300005719 Bacteria 1968
55 Ga0068858_100211306 3300005842 Bacteria 1836
56 Ga0068860_100019448 3300005843 Bacteria 6585
57 Ga0081540_1073864 3300005983 Bacteria 1565
58 Ga0081539_10055347 3300005985 Bacteria 2208
59 Ga0081539_10089948 3300005985 Bacteria 1589
60 Ga0097621_100183280 3300006237 Bacteria 1810
61 Ga0097621_100186097 3300006237 Bacteria 1796
62 Ga0068871_100139144 3300006358 Bacteria 2063
63 Ga0068871_100193501 3300006358 Bacteria 1753
64 Ga0097620_100027750 3300006931 Bacteria 5678
65 Ga0097620_100560938 3300006931 Bacteria 1236
66 Ga0099794_10088837 3300007265 Bacteria 1532
67 Ga0105244_10103257 3300009036 Bacteria 1393
68 Ga0114129_10099094 3300009147 Bacteria 4034
69 Ga0105237_10187553 3300009545 Bacteria 2068
70 Ga0105237_10318427 3300009545 Bacteria 1559
71 Ga0105237_10439668 3300009545 Bacteria 1310
72 Ga0105238_10452734 3300009551 Bacteria 1281
73 Ga0105249_10007269 3300009553 Bacteria 9659
74 Ga0105249_10363916 3300009553 Bacteria 1468
75 Ga0105246_10074563 3300011119 Bacteria 2399
76 Ga0157369_10083890 3300013105 Bacteria 3407
77 Ga0157369_10243228 3300013105 Bacteria 1879
78 Ga0163162_10312921 3300013306 Bacteria 1703
79 Ga0157372_10455601 3300013307 Bacteria 1491
80 Ga0157375_10534991 3300013308 Bacteria 1334
81 Ga0163163_10277265 3300014325 Bacteria 1728
82 Ga0163163_10316297 3300014325 Bacteria 1615
83 Ga0157380_10146747 3300014326 Bacteria 2034
84 Ga0157380_10374321 3300014326 Bacteria 1342
85 Ga0157379_10219622 3300014968 Bacteria 1722
86 Ga0157376_10193895 3300014969 Bacteria 1865
87 Ga0163161_10106240 3300017792 Bacteria 2095
88 Ga0213875_10092724 3300021388 Bacteria 1408
89 Ga0207697_10081749 3300025315 Bacteria 1361
90 Ga0207653_10001217 3300025885 Bacteria 8419
91 Ga0207682_10040857 3300025893 Bacteria 1891
92 Ga0207680_10169623 3300025903 Bacteria 1469
93 Ga0207684_10402657 3300025910 Bacteria 1176
94 Ga0207707_10129636 3300025912 Bacteria 2206
95 Ga0207707_10311836 3300025912 Bacteria 1359
96 Ga0207671_10306872 3300025914 Bacteria 1254
97 Ga0207660_10005522 3300025917 Bacteria 8210
98 Ga0207660_10284521 3300025917 Bacteria 1313
99 Ga0207657_10045996 3300025919 Bacteria 3825
100 Ga0207652_10367425 3300025921 Bacteria 1299
101 Ga0207646_10212324 3300025922 Bacteria 1748
102 Ga0207694_10051241 3300025924 Bacteria 3199
103 Ga0207700_10216925 3300025928 Bacteria 1620
104 Ga0207690_10553789 3300025932 Bacteria 935
105 Ga0207706_10111221 3300025933 Bacteria 2410
106 Ga0207689_10054638 3300025942 Bacteria 3288
107 Ga0207651_10158012 3300025960 Bacteria 1774
108 Ga0207712_10003692 3300025961 Bacteria 9656
109 Ga0207712_10302193 3300025961 Bacteria 1314
110 Ga0207668_10027409 3300025972 Bacteria 3710
111 Ga0207668_10260239 3300025972 Bacteria 1413
112 Ga0207640_10435724 3300025981 Bacteria 1076
113 Ga0207703_10199292 3300026035 Bacteria 1778
114 Ga0207678_10039751 3300026067 Bacteria 4080
115 Ga0207708_10019125 3300026075 Bacteria 5159
116 Ga0207708_10226054 3300026075 Bacteria 1501
117 Ga0207648_10024891 3300026089 Bacteria 5338
118 Ga0207648_10468739 3300026089 Bacteria 1149
119 Ga0207676_10004713 3300026095 Bacteria 9663
120 Ga0207676_10288684 3300026095 Bacteria 1493
121 Ga0207675_100109211 3300026118 Bacteria 2609
122 Ga0207675_100196168 3300026118 Bacteria 1938
123 Ga0207683_10144115 3300026121 Bacteria 2147
124 Ga0209179_1015891 3300027512 Bacteria 1405
125 Ga0268266_10185116 3300028379 Bacteria 1898
126 Ga0268266_10643919 3300028379 Bacteria 1020
127 Ga0268264_10018832 3300028381 Bacteria 5646
128 Ga0307517_10116983 3300028786 Bacteria 1992
129 Ga0307513_10193657 3300031456 Bacteria 1881
130 Ga0307509_10231374 3300031507 Bacteria 1651
131 Ga0307408_100527133 3300031548 Bacteria 1038
132 Ga0307508_10150480 3300031616 Bacteria 1932
133 Ga0316575_10081974 3300031665 Bacteria 1301
134 Ga0307405_10106019 3300031731 Bacteria 1894
135 Ga0307413_10162488 3300031824 Bacteria 1570
136 Ga0307410_10244362 3300031852 Bacteria 1392
137 Ga0307412_10254872 3300031911 Bacteria 1364
138 Ga0307409_100069438 3300031995 Bacteria 2791
139 Ga0307411_10173278 3300032005 Bacteria 1629
140 Ga0307415_100552305 3300032126 Bacteria 1016
141 Ga0373926_0049620 3300035083 Bacteria 1511
142 Ga0373944_0050151 3300035089 Bacteria 1313
143 Ga0373936_0022633 3300035113 Bacteria 2446
144 Ga0373945_0067507 3300035116 Bacteria 1346
145 Ga0373943_0023416 3300035170 Bacteria 2871
146 Ga0373946_0050195 3300035171 Bacteria 1742
147 Ga0373946_0053527 3300035171 Bacteria 1695
148 Ga0373935_0110488 3300035692 Bacteria 1824
149 Ga0373935_0259088 3300035692 Bacteria 1219
150 Ga0373935_0260294 3300035692 Bacteria 1216
151 Ga0373927_0013416 3300035695 Bacteria 5445
152 Ga0373927_0101320 3300035695 Bacteria 1873
153 Ga0373933_0191602 3300035724 Bacteria 1306
154 Ga0373947_0129511 3300035725 Bacteria 1609
155 Ga0373947_0159436 3300035725 Bacteria 1458
156 Ga0373937_0227383 3300036401 Bacteria 1756
157 Ga0373925_0264379 3300037068 Bacteria 1382
158 Ga0373925_0266318 3300037068 Bacteria 1377
159 Ga0373925_0267953 3300037068 Bacteria 1373
160 Ga0436364_0025954 3300037853 Bacteria 1441
161 Ga0242419_002093 3300038698 Bacteria 1282
162 Ga0451798_0948837 3300041458 Bacteria 1104
163 Ga0450888_003772 3300042126 Bacteria 1552
164 Ga0439464_0031991 3300042439 Bacteria 1477
165 Ga0439460_0022610 3300042461 Bacteria 1726
166 Ga0450893_0011386 3300042532 Bacteria 1469
167 Ga0466961_0170518 3300044693 Bacteria 1353
168 Ga0466964_0089935 3300044706 Bacteria 1334
169 Ga0466959_0242189 3300045049 Bacteria 1245
170 Ga0466967_0007151 3300045976 Bacteria 8013
171 Ga0495603_0148424 3300046455 Bacteria 1362
172 Ga0495629_0192930 3300046459 Bacteria 1409
173 Ga0495641_0092068 3300046461 Bacteria 1354
174 Ga0495651_0174652 3300046462 Bacteria 1526
175 Ga0495582_0146092 3300046473 Bacteria 1341
176 Ga0495639_0086701 3300046475 Bacteria 1464
177 Ga0495639_0099557 3300046475 Bacteria 1371
178 Ga0495662_0053328 3300046476 Bacteria 1952
179 Ga0495664_0157363 3300046477 Bacteria 1378
180 Ga0495594_0068348 3300046499 Bacteria 1973
181 Ga0495606_0009112 3300046507 Bacteria 8452
182 Ga0495608_0161715 3300046511 Bacteria 1423
183 Ga0495618_0092712 3300046514 Bacteria 1931
184 Ga0495618_0284238 3300046514 Bacteria 1031
185 Ga0495628_0274299 3300046516 Bacteria 1254
186 Ga0495630_0194744 3300046517 Bacteria 1546
187 Ga0495630_0246308 3300046517 Bacteria 1365
188 Ga0495630_0290530 3300046517 Bacteria 1249
189 Ga0495632_0091892 3300046519 Bacteria 1438
190 Ga0495643_0160864 3300046522 Bacteria 1105
191 Ga0495666_0093108 3300046526 Bacteria 1421
192 Ga0495652_0198508 3300046529 Bacteria 1524
193 Ga0495652_0213824 3300046529 Bacteria 1453
194 Ga0495652_0241065 3300046529 Bacteria 1345
195 Ga0495665_0088987 3300046531 Bacteria 1622
196 Ga0495665_0103684 3300046531 Bacteria 1492
197 Ga0495640_0198604 3300046533 Bacteria 1272
198 Ga0495586_0133264 3300046535 Bacteria 1392
199 Ga0495587_0098701 3300046536 Bacteria 1683
200 Ga0495645_0205156 3300046543 Bacteria 1334
201 Ga0495667_0014380 3300046559 Bacteria 5346
202 Ga0495667_0163041 3300046559 Bacteria 1433
203 Ga0495634_0165999 3300046642 Bacteria 1389
204 Ga0495625_0209071 3300046660 Bacteria 1283
205 Ga0495635_0148860 3300046663 Bacteria 1593
206 Ga0495646_0153230 3300046680 Bacteria 1280
207 Ga0495647_0053995 3300046681 Bacteria 1568
208 Ga0495647_0094330 3300046681 Bacteria 1231
209 Ga0495658_0157728 3300046683 Bacteria 1397
210 Ga0495613_0149957 3300046689 Bacteria 1663
211 Ga0495613_0240598 3300046689 Bacteria 1266
212 Ga0495624_0043363 3300046690 Bacteria 2870
213 Ga0495600_0121652 3300046809 Bacteria 1697
214 Ga0495581_0084343 3300047315 Bacteria 1841
215 Ga0495581_0104317 3300047315 Bacteria 1647
216 Ga0495604_0125898 3300047317 Bacteria 1847
217 Ga0495604_0216194 3300047317 Bacteria 1322
218 Ga0495674_0185636 3300047319 Bacteria 1730
219 Ga0495674_0230237 3300047319 Bacteria 1529
220 Ga0495674_0239348 3300047319 Bacteria 1496
221 Ga0495674_0264806 3300047319 Bacteria 1411
222 Ga0495676_0107072 3300047321 Bacteria 2058
223 Ga0495676_0157546 3300047321 Bacteria 1609
224 Ga0495680_0148487 3300047322 Bacteria 1710
225 Ga0495684_0100289 3300047471 Bacteria 2189
226 Ga0495684_0225426 3300047471 Bacteria 1372
227 Ga0495593_0111817 3300047673 Bacteria 1394
228 Ga0495602_0164681 3300048088 Bacteria 1727
229 Ga0495602_0324997 3300048088 Bacteria 1118
230 Ga0496100_0113587 3300048903 Bacteria 1885
231 Ga0496100_0192858 3300048903 Bacteria 1480
232 Ga0496101_0154783 3300048904 Bacteria 1755
233 Ga0496102_0017028 3300048905 Bacteria 6361
234 Ga0496102_0031504 3300048905 Bacteria 4757
235 Ga0496102_0320094 3300048905 Bacteria 1461
236 Ga0496104_0441383 3300048907 Bacteria 1213
237 Ga0496106_0004035 3300048909 Bacteria 10966
238 Ga0496106_0158845 3300048909 Bacteria 1787
239 Ga0496106_0270461 3300048909 Bacteria 1360
240 Ga0496108_0163021 3300048911 Bacteria 1927
241 Ga0496109_0355832 3300048912 Bacteria 1383
242 Ga0496109_0380318 3300048912 Bacteria 1334
243 Ga0496110_0404469 3300048913 Bacteria 1244
244 Ga0496112_0020937 3300048915 Bacteria 6210
245 Ga0496115_0282475 3300048918 Bacteria 1362
246 Ga0496119_0091152 3300048922 Bacteria 1731
247 Ga0496121_0002416 3300048924 Bacteria 28627
248 Ga0496125_0040377 3300048928 Bacteria 4004
249 Ga0495678_111664 3300049459 Bacteria 931
250 Ga0501290_011287 3300049513 Bacteria 1149
251 Ga0501291_016152 3300049514 Bacteria 1137
252 Ga0501292_020346 3300049515 Bacteria 1068
253 Ga0501296_003321 3300049519 Bacteria 1712
254 Ga0501031_0181604 3300049568 Bacteria 1374
255 Ga0501032_0102084 3300049569 Bacteria 1900
256 Ga0501034_0014281 3300049571 Bacteria 8184
257 Ga0501034_0336359 3300049571 Bacteria 1440
258 Ga0501036_0136136 3300049572 Bacteria 2073
259 Ga0501037_0135268 3300049573 Bacteria 1765
260 Ga0501038_0129964 3300049574 Bacteria 2069
261 Ga0501038_0182083 3300049574 Bacteria 1695
262 Ga0501038_0202238 3300049574 Bacteria 1594
263 Ga0501038_0243711 3300049574 Bacteria 1426
264 Ga0501039_0282864 3300049575 Bacteria 1304
265 Ga0501039_0306108 3300049575 Bacteria 1249
266 Ga0501041_0176734 3300049577 Bacteria 1336
267 Ga0501042_0205942 3300049578 Bacteria 1418
268 Ga0501043_0045732 3300049579 Bacteria 3442
269 Ga0501048_0085081 3300049582 Bacteria 2230
270 Ga0501072_0472816 3300049588 Bacteria 992
271 Ga0501073_0033819 3300049589 Bacteria 3638
272 Ga0501074_0265603 3300049590 Bacteria 1220
273 Ga0501075_0047507 3300049591 Bacteria 3225
274 Ga0501077_0134766 3300049593 Bacteria 1566
275 Ga0501206_017739 3300049653 Bacteria 998
276 Ga0501216_012979 3300049660 Bacteria 1375
277 Ga0501217_039222 3300049661 Bacteria 1199
278 Ga0501223_018734 3300049663 Bacteria 1361
279 Ga0501224_015962 3300049664 Bacteria 1114
280 Ga0501227_056304 3300049665 Bacteria 1000
281 Ga0501239_002587 3300049672 Bacteria 1654
282 Ga0501239_003927 3300049672 Bacteria 1437
283 Ga0501240_006305 3300049673 Bacteria 1455
284 Ga0501247_011030 3300049677 Bacteria 1085
285 Ga0501249_018561 3300049679 Bacteria 1505
286 Ga0501253_010244 3300049683 Bacteria 1405
287 Ga0501256_006810 3300049685 Bacteria 1040
288 Ga0501259_010900 3300049688 Bacteria 1494
289 Ga0501079_0183989 3300049741 Bacteria 1631
290 Ga0501080_0244962 3300049742 Bacteria 1635
291 Ga0501083_0427851 3300049744 Bacteria 861
292 Ga0501268_022010 3300049765 Bacteria 1097
293 Ga0501270_006913 3300049767 Bacteria 1383
294 Ga0501272_011475 3300049769 Bacteria 998
295 Ga0501275_005373 3300049772 Bacteria 1228
296 Ga0501279_009351 3300049775 Bacteria 1312
297 Ga0501035_0186979 3300049822 Bacteria 1782
298 Ga0501044_0047293 3300049823 Bacteria 4450
299 Ga0501044_0193152 3300049823 Bacteria 1997
300 Ga0501045_0244256 3300049824 Bacteria 1336
301 nmdc:mga05p37_584825_c1 3300050507 Bacteria 1264
302 nmdc:mga09592_251404_c1 3300050508 Bacteria 1532
303 nmdc:mga09592_332368_c1 3300050508 Bacteria 1316
304 nmdc:mga0qj67_248850_c1 3300050509 Bacteria 1442
305 nmdc:mga06r32_114467_c1 3300050510 Bacteria 2656
306 Ga0495601_0131267 3300053077 Bacteria 1631
307 Ga0495601_0144297 3300053077 Bacteria 1553
308 Ga0495601_0162419 3300053077 Bacteria 1460
309 Ga0495601_0304945 3300053077 Bacteria 1037
310 Ga0495655_0018571 3300053083 Bacteria 1530
311 Ga0495595_0084732 3300053084 Bacteria 1514
312 Ga0495619_0165167 3300053085 Bacteria 1530
313 Ga0495619_0193815 3300053085 Bacteria 1406
314 Ga0495619_0213477 3300053085 Bacteria 1336
315 Ga0500644_0060202 3300053088 Bacteria 1334
316 Ga0500651_0221698 3300053093 Bacteria 1108
317 Ga0500623_079558 3300053127 Bacteria 1563
318 Ga0500658_0090863 3300053134 Bacteria 1320
319 Ga0500573_0130794 3300053140 Bacteria 1390
320 Ga0500577_0095436 3300053142 Bacteria 1208
321 Ga0500579_109172 3300053143 Bacteria 1401
322 Ga0500589_072758 3300053147 Bacteria 1551
323 Ga0500604_0053726 3300053151 Bacteria 1249
324 Ga0501084_0085156 3300054114 Bacteria 2654
325 Ga0501082_0279025 3300060353 Bacteria 1454
326 Ga0501082_0296344 3300060353 Bacteria 1408
327 Ga0530510_0415662 3300061734 Bacteria 1015
328 Ga0530510_0551497 3300061734 Bacteria 875
329 2511498388 2511231052 Bacteria 6974333
330 2517564924 2517487022 Bacteria 7227575
331 2517565017 2517487022 Bacteria 7227575
332 2517568203 2517487022 Bacteria 7227575
333 2517568222 2517487022 Bacteria 7227575
334 2517568225 2517487022 Bacteria 7227575
335 2517568256 2517487022 Bacteria 7227575
336 2753767668 2751185897 Bacteria 5322941
337 2838679330 2838675328 Bacteria 4909118
338 2838719588 2838714209 Bacteria 5525906
339 2838724968 2838719591 Bacteria 5523910
340 2838729008 2838724970 Bacteria 4908691
341 2842134232 2842130223 Bacteria 4909145
342 2842156228 2842152218 Bacteria 4908957
343 2842175834 2842170452 Bacteria 5525737
344 2842179678 2842175837 Bacteria 4908771
345 2842192693 2842187318 Bacteria 5524014
346 2842217008 2842211629 Bacteria 5523832
347 2842229729 2842224351 Bacteria 5524473
348 2933010078 2933006813 Bacteria 4912075
349 639651202 639633055 Bacteria 7751309
350 639651212 639633055 Bacteria 7751309
351 Ga0207658_10256519
352 JGI24739J22299_10056008
353 JGI24750J21931_1017140
354 JGI24738J21930_10024091
355 JGI24749J21850_1010763
356 JGI24744J21845_10021372
357 JGI24742J22300_10015661
358 JGI25406J46586_10076198
359 Ga0065165_1009369
360 Ga0065712_10108043
361 Ga0068869_100108862
362 Ga0070680_100005289
363 Ga0070680_100271579
364 Ga0070682_100101161
365 Ga0070660_100132212
366 Ga0070691_10033470
367 Ga0070692_10302128
368 Ga0070668_100390381
369 Ga0070669_100208467
370 Ga0070669_100440784
371 Ga0070673_100321416
372 Ga0070673_100342070
373 Ga0070703_10000639
374 Ga0070701_10035126
375 Ga0070705_100002089
376 Ga0070700_100007250
377 Ga0070694_100010621
378 Ga0070708_100015680
379 Ga0070663_100048222
380 Ga0070663_100214750
381 Ga0070681_10030199
382 Ga0070681_10404364
383 Ga0070706_100036804
384 Ga0070706_100296877
385 Ga0070707_100264049
386 Ga0070699_100020611
387 Ga0070679_100159623
388 Ga0070679_100406270
389 Ga0070684_100027593
390 Ga0070697_100048469
391 Ga0070697_100196679
392 Ga0070672_100210016
393 Ga0070695_100006458
394 Ga0070696_100012552
395 Ga0070665_100215394
396 Ga0070665_100670373
397 Ga0070704_100010321
398 Ga0068857_100013777
399 Ga0068857_100359759
400 Ga0068854_100226032
401 Ga0068859_100027750
402 Ga0068859_100560897
403 Ga0068864_100054786
404 Ga0068861_100140811
405 Ga0068858_100211306
406 Ga0068860_100019448
407 Ga0081540_1073864
408 Ga0081539_10055347
409 Ga0081539_10089948
410 Ga0097621_100183280
411 Ga0097621_100186097
412 Ga0068871_100139144
413 Ga0068871_100193501
414 Ga0097620_100027750
415 Ga0097620_100560938
416 Ga0099794_10088837
417 Ga0105244_10103257
418 Ga0114129_10099094
419 Ga0105237_10187553
420 Ga0105237_10318427
421 Ga0105237_10439668
422 Ga0105238_10452734
423 Ga0105249_10007269
424 Ga0105249_10363916
425 Ga0105246_10074563
426 Ga0157369_10083890
427 Ga0157369_10243228
428 Ga0163162_10312921
429 Ga0157372_10455601
430 Ga0157375_10534991
431 Ga0163163_10277265
432 Ga0163163_10316297
433 Ga0157380_10146747
434 Ga0157380_10374321
435 Ga0157379_10219622
436 Ga0157376_10193895
437 Ga0163161_10106240
438 Ga0213875_10092724
439 Ga0207697_10081749
440 Ga0207653_10001217
441 Ga0207682_10040857
442 Ga0207680_10169623
443 Ga0207684_10402657
444 Ga0207707_10129636
445 Ga0207707_10311836
446 Ga0207671_10306872
447 Ga0207660_10005522
448 Ga0207660_10284521
449 Ga0207657_10045996
450 Ga0207652_10367425
451 Ga0207646_10212324
452 Ga0207694_10051241
453 Ga0207700_10216925
454 Ga0207690_10553789
455 Ga0207706_10111221
456 Ga0207689_10054638
457 Ga0207651_10158012
458 Ga0207712_10003692
459 Ga0207712_10302193
460 Ga0207668_10027409
461 Ga0207668_10260239
462 Ga0207640_10435724
463 Ga0207703_10199292
464 Ga0207678_10039751
465 Ga0207708_10019125
466 Ga0207708_10226054
467 Ga0207648_10024891
468 Ga0207648_10468739
469 Ga0207676_10004713
470 Ga0207676_10288684
471 Ga0207675_100109211
472 Ga0207675_100196168
473 Ga0207683_10144115
474 Ga0209179_1015891
475 Ga0268266_10185116
476 Ga0268266_10643919
477 Ga0268264_10018832
478 Ga0307517_10116983
479 Ga0307513_10193657
480 Ga0307509_10231374
481 Ga0307408_100527133
482 Ga0307508_10150480
483 Ga0316575_10081974
484 Ga0307405_10106019
485 Ga0307413_10162488
486 Ga0307410_10244362
487 Ga0307412_10254872
488 Ga0307409_100069438
489 Ga0307411_10173278
490 Ga0307415_100552305
491 Ga0373926_0049620
492 Ga0373944_0050151
493 Ga0373936_0022633
494 Ga0373945_0067507
495 Ga0373943_0023416
496 Ga0373946_0050195
497 Ga0373946_0053527
498 Ga0373935_0110488
499 Ga0373935_0259088
500 Ga0373935_0260294
501 Ga0373927_0013416
502 Ga0373927_0101320
503 Ga0373933_0191602
504 Ga0373947_0129511
505 Ga0373947_0159436
506 Ga0373937_0227383
507 Ga0373925_0264379
508 Ga0373925_0266318
509 Ga0373925_0267953
510 Ga0436364_0025954
511 Ga0242419_002093
512 Ga0451798_0948837
513 Ga0450888_003772
514 Ga0439464_0031991
515 Ga0439460_0022610
516 Ga0450893_0011386
517 Ga0466961_0170518
518 Ga0466964_0089935
519 Ga0466959_0242189
520 Ga0466967_0007151
521 Ga0495603_0148424
522 Ga0495629_0192930
523 Ga0495641_0092068
524 Ga0495651_0174652
525 Ga0495582_0146092
526 Ga0495639_0086701
527 Ga0495639_0099557
528 Ga0495662_0053328
529 Ga0495664_0157363
530 Ga0495594_0068348
531 Ga0495606_0009112
532 Ga0495608_0161715
533 Ga0495618_0092712
534 Ga0495618_0284238
535 Ga0495628_0274299
536 Ga0495630_0194744
537 Ga0495630_0246308
538 Ga0495630_0290530
539 Ga0495632_0091892
540 Ga0495643_0160864
541 Ga0495666_0093108
542 Ga0495652_0198508
543 Ga0495652_0213824
544 Ga0495652_0241065
545 Ga0495665_0088987
546 Ga0495665_0103684
547 Ga0495640_0198604
548 Ga0495586_0133264
549 Ga0495587_0098701
550 Ga0495645_0205156
551 Ga0495667_0014380
552 Ga0495667_0163041
553 Ga0495634_0165999
554 Ga0495625_0209071
555 Ga0495635_0148860
556 Ga0495646_0153230
557 Ga0495647_0053995
558 Ga0495647_0094330
559 Ga0495658_0157728
560 Ga0495613_0149957
561 Ga0495613_0240598
562 Ga0495624_0043363
563 Ga0495600_0121652
564 Ga0495581_0084343
565 Ga0495581_0104317
566 Ga0495604_0125898
567 Ga0495604_0216194
568 Ga0495674_0185636
569 Ga0495674_0230237
570 Ga0495674_0239348
571 Ga0495674_0264806
572 Ga0495676_0107072
573 Ga0495676_0157546
574 Ga0495680_0148487
575 Ga0495684_0100289
576 Ga0495684_0225426
577 Ga0495593_0111817
578 Ga0495602_0164681
579 Ga0495602_0324997
580 Ga0496100_0113587
581 Ga0496100_0192858
582 Ga0496101_0154783
583 Ga0496102_0017028
584 Ga0496102_0031504
585 Ga0496102_0320094
586 Ga0496104_0441383
587 Ga0496106_0004035
588 Ga0496106_0158845
589 Ga0496106_0270461
590 Ga0496108_0163021
591 Ga0496109_0355832
592 Ga0496109_0380318
593 Ga0496110_0404469
594 Ga0496112_0020937
595 Ga0496115_0282475
596 Ga0496119_0091152
597 Ga0496121_0002416
598 Ga0496125_0040377
599 Ga0495678_111664
600 Ga0501290_011287
601 Ga0501291_016152
602 Ga0501292_020346
603 Ga0501296_003321
604 Ga0501031_0181604
605 Ga0501032_0102084
606 Ga0501034_0014281
607 Ga0501034_0336359
608 Ga0501036_0136136
609 Ga0501037_0135268
610 Ga0501038_0129964
611 Ga0501038_0182083
612 Ga0501038_0202238
613 Ga0501038_0243711
614 Ga0501039_0282864
615 Ga0501039_0306108
616 Ga0501041_0176734
617 Ga0501042_0205942
618 Ga0501043_0045732
619 Ga0501048_0085081
620 Ga0501072_0472816
621 Ga0501073_0033819
622 Ga0501074_0265603
623 Ga0501075_0047507
624 Ga0501077_0134766
625 Ga0501206_017739
626 Ga0501216_012979
627 Ga0501217_039222
628 Ga0501223_018734
629 Ga0501224_015962
630 Ga0501227_056304
631 Ga0501239_002587
632 Ga0501239_003927
633 Ga0501240_006305
634 Ga0501247_011030
635 Ga0501249_018561
636 Ga0501253_010244
637 Ga0501256_006810
638 Ga0501259_010900
639 Ga0501079_0183989
640 Ga0501080_0244962
641 Ga0501083_0427851
642 Ga0501268_022010
643 Ga0501270_006913
644 Ga0501272_011475
645 Ga0501275_005373
646 Ga0501279_009351
647 Ga0501035_0186979
648 Ga0501044_0047293
649 Ga0501044_0193152
650 Ga0501045_0244256
651 nmdc:mga05p37_584825_c1
652 nmdc:mga09592_251404_c1
653 nmdc:mga09592_332368_c1
654 nmdc:mga0qj67_248850_c1
655 nmdc:mga06r32_114467_c1
656 Ga0495601_0131267
657 Ga0495601_0144297
658 Ga0495601_0162419
659 Ga0495601_0304945
660 Ga0495655_0018571
661 Ga0495595_0084732
662 Ga0495619_0165167
663 Ga0495619_0193815
664 Ga0495619_0213477
665 Ga0500644_0060202
666 Ga0500651_0221698
667 Ga0500623_079558
668 Ga0500658_0090863
669 Ga0500573_0130794
670 Ga0500577_0095436
671 Ga0500579_109172
672 Ga0500589_072758
673 Ga0500604_0053726
674 Ga0501084_0085156
675 Ga0501082_0279025
676 Ga0501082_0296344
677 Ga0530510_0415662
678 Ga0530510_0551497
679 2511498388
680 2517564924
681 2517565017
682 2517568203
683 2517568222
684 2517568225
685 2517568256
686 2753767668
687 2838679330
688 2838719588
689 2838724968
690 2838729008
691 2842134232
692 2842156228
693 2842175834
694 2842179678
695 2842192693
696 2842217008
697 2842229729
698 2933010078
699 639651202
700 639651212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

195

260

0.98

PF00665

rve

Integrase core domain

110

206

0.95

PF13276

HTH_21

HTH-like domain

33

90

0.94

PF24764

108

239

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p5l-assembly2.cif.gz_H crystal structure of a dimer of n-terminal domains of ahrc in complex with an 18bp dna operator site 0.9076 35 81
3qdk-assembly2.cif.gz_C structural insight on mechanism and diverse substrate selection strategy of ribulokinase 0.8787 117 150
6qbt-assembly1.cif.gz_A structure of the htlv-2 integrase catalytic core domain in complex with magnesium (trimeric form) 0.8751 112 265
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8712 112 265
4mq3-assembly1.cif.gz_A the 1.1 angstrom structure of catalytic core domain of fiv integrase 0.8589 116 221
ID Description Score Start End Superfamily
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9445 109 264 3.30.420.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9381 113 261 3.30.420.10
af_Q99P84_1841_1995_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.9318 130 151 2.60.40.150
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9217 109 267 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9163 109 264 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1X4IEY1-F1-model_v4 Integrase catalytic domain-containing protein 0.9896 110 192 GO:0003676
GO:0015074
AF-A0A7X8K0X8-F1-model_v4 Transposase family protein 0.9819 111 203 GO:0003676
GO:0015074
AF-A0A1X4IEY1-F1-model_v4 Integrase catalytic domain-containing protein 0.978 110 192 GO:0003676
GO:0015074
AF-A0A3M8FIZ4-F1-model_v4 deleted 0.9737 141 265
AF-A0A1X0VBK2-F1-model_v4 Transposase 0.9734 132 251 GO:0003676
GO:0015074

Map