F418238

General Info

Members Datasets Scaffolds Average Seq Length
350 235 700 196

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10010672|Ga0157370_100106729
Length 193
Sequence MRVTVKPLTPDNWADVETVFNARGCSVARGCWCMYYRRSGARGPLPPGMTHAKANRADLKALARNAGLPPGLIGYRGRTPVGWISLGPRKDFAKLQRSPVMKAVDDMPVWSIICFVVPAEHRDQGVARALLDASIAWARKRGVRLLEAYPVDRSDRASDDAMWFGTKSMFDDAGFHEVARRKPRRPVVRLALR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.14
Nodule 0
Rhizoplane 3.14
Rhizosphere 74
Stem 0
Stem Tuber 0
Unclassified 21.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10010672 3300013104 Bacteria 9663
2 JGI25152J39213_1006684 3300002773 Bacteria 3085
3 JGI25159J45721_1000402 3300002987 Bacteria 20189
4 JGI25159J45721_1000474 3300002987 Bacteria 18495
5 JGI25153J46596_10001927 3300003215 Bacteria 12324
6 JGI25160J50197_1000117 3300003354 Bacteria 72240
7 JGI25161J50226_1000009 3300003374 Bacteria 224699
8 Ga0055526_1001234 3300003771 Bacteria 18348
9 Ga0055526_1006870 3300003771 Bacteria 6065
10 Ga0055526_1010171 3300003771 Bacteria 4412
11 Ga0055537_1000020 3300003773 Bacteria 117325
12 Ga0055524_1000047 3300003775 Bacteria 150887
13 Ga0055524_1000143 3300003775 Bacteria 84686
14 Ga0055536_1010641 3300003781 Bacteria 3622
15 Ga0055534_1000967 3300003784 Bacteria 12750
16 Ga0055528_1000812 3300003790 Bacteria 21450
17 Ga0055530_10000252 3300003791 Bacteria 48125
18 Ga0055530_10027709 3300003791 Bacteria 1542
19 Ga0055540_1000027 3300003792 Bacteria 187454
20 Ga0055531_10001053 3300003794 Bacteria 21751
21 Ga0055543_1001153 3300004625 Bacteria 11300
22 Ga0065165_1017978 3300005262 Bacteria 2580
23 Ga0065707_10489549 3300005295 Bacteria 766
24 Ga0070690_100107809 3300005330 Bacteria 1855
25 Ga0070690_100176827 3300005330 Unclassified 1473
26 Ga0068869_100072884 3300005334 Bacteria 2545
27 Ga0068869_100186869 3300005334 Bacteria 1627
28 Ga0070666_10024947 3300005335 Unclassified 3897
29 Ga0070680_100059592 3300005336 Bacteria 3124
30 Ga0068868_100802010 3300005338 Unclassified 849
31 Ga0070689_100158085 3300005340 Bacteria 1831
32 Ga0070689_100293497 3300005340 Bacteria 1352
33 Ga0070689_100663614 3300005340 Unclassified 908
34 Ga0070661_100009810 3300005344 Bacteria 6638
35 Ga0070668_100266479 3300005347 Bacteria 1426
36 Ga0070668_100502694 3300005347 Bacteria 1050
37 Ga0070669_100337587 3300005353 Unclassified 1220
38 Ga0070669_100470340 3300005353 Bacteria 1039
39 Ga0070669_100885521 3300005353 Bacteria 762
40 Ga0070675_100094743 3300005354 Bacteria 2506
41 Ga0070673_100075977 3300005364 Bacteria 2711
42 Ga0070673_100096099 3300005364 Bacteria 2431
43 Ga0070673_100300811 3300005364 Bacteria 1412
44 Ga0070688_100305266 3300005365 Bacteria 1152
45 Ga0070667_100073092 3300005367 Bacteria 2923
46 Ga0070667_100112213 3300005367 Bacteria 2365
47 Ga0070667_100221689 3300005367 Unclassified 1683
48 Ga0070703_10186811 3300005406 Bacteria 804
49 Ga0070709_10551716 3300005434 Unclassified 882
50 Ga0070710_10169116 3300005437 Unclassified 1361
51 Ga0070701_10025782 3300005438 Bacteria 2859
52 Ga0070711_100207500 3300005439 Unclassified 1515
53 Ga0070700_100781178 3300005441 Unclassified 767
54 Ga0070663_100040669 3300005455 Bacteria 3257
55 Ga0070678_100230225 3300005456 Unclassified 1545
56 Ga0070662_100048909 3300005457 Bacteria 3048
57 Ga0070662_100060880 3300005457 Bacteria 2754
58 Ga0070662_100570812 3300005457 Bacteria 949
59 Ga0068867_100159952 3300005459 Bacteria 1775
60 Ga0068867_100264558 3300005459 Bacteria 1403
61 Ga0070686_100517414 3300005544 Bacteria 928
62 Ga0070695_100401146 3300005545 Unclassified 1040
63 Ga0070665_100152378 3300005548 Bacteria 2314
64 Ga0070704_100132786 3300005549 Bacteria 1932
65 Ga0070664_100956508 3300005564 Unclassified 804
66 Ga0068857_100030907 3300005577 Bacteria 4731
67 Ga0068856_100518894 3300005614 Unclassified 1213
68 Ga0070702_100307283 3300005615 Unclassified 1100
69 Ga0068852_100654401 3300005616 Unclassified 1058
70 Ga0068859_100026910 3300005617 Bacteria 5769
71 Ga0068859_100236404 3300005617 Unclassified 1916
72 Ga0068859_101117673 3300005617 Bacteria 867
73 Ga0068861_100037928 3300005719 Bacteria 3584
74 Ga0068861_101105529 3300005719 Bacteria 762
75 Ga0068863_100116447 3300005841 Unclassified 2547
76 Ga0068863_100219341 3300005841 Bacteria 1832
77 Ga0068858_100107991 3300005842 Unclassified 2598
78 Ga0068862_100042432 3300005844 Bacteria 3875
79 Ga0068862_100923444 3300005844 Bacteria 859
80 Ga0075368_10019736 3300006042 Bacteria 2546
81 Ga0075368_10327746 3300006042 Bacteria 664
82 Ga0075363_100011486 3300006048 Bacteria 4242
83 Ga0075363_100087909 3300006048 Bacteria 1708
84 Ga0070715_10006143 3300006163 Archaea 4065
85 Ga0070716_100006583 3300006173 Bacteria 5678
86 Ga0070716_100351976 3300006173 Bacteria 1043
87 Ga0075367_10003340 3300006178 Bacteria 7625
88 Ga0075367_10493252 3300006178 Bacteria 777
89 Ga0075367_10572316 3300006178 Bacteria 718
90 Ga0075369_10013614 3300006186 Bacteria 3234
91 Ga0075366_10041018 3300006195 Bacteria 2739
92 Ga0075366_10051248 3300006195 Bacteria 2452
93 Ga0075366_10071884 3300006195 Bacteria 2061
94 Ga0075366_10096750 3300006195 Bacteria 1770
95 Ga0075366_10178258 3300006195 Unclassified 1290
96 Ga0097621_100054041 3300006237 Bacteria 3274
97 Ga0075370_10010542 3300006353 Bacteria 4836
98 Ga0075370_10027526 3300006353 Bacteria 3155
99 Ga0075370_10039911 3300006353 Bacteria 2646
100 Ga0075370_10064507 3300006353 Bacteria 2089
101 Ga0075370_10074024 3300006353 Bacteria 1952
102 Ga0075428_100183495 3300006844 Bacteria 2264
103 Ga0075428_100390201 3300006844 Bacteria 1492
104 Ga0075428_101138556 3300006844 Bacteria 823
105 Ga0075430_100160813 3300006846 Unclassified 1869
106 Ga0075431_100000050 3300006847 Bacteria 63805
107 Ga0075431_100026893 3300006847 Bacteria 5901
108 Ga0075431_100154541 3300006847 Unclassified 2361
109 Ga0075433_10770511 3300006852 Bacteria 841
110 Ga0075434_100195673 3300006871 Bacteria 2041
111 Ga0075429_100077327 3300006880 Bacteria 2899
112 Ga0075429_100136549 3300006880 Bacteria 2146
113 Ga0075429_100177135 3300006880 Unclassified 1868
114 Ga0068865_100133030 3300006881 Bacteria 1865
115 Ga0097620_100026910 3300006931 Bacteria 5769
116 Ga0097620_100236385 3300006931 Unclassified 1916
117 Ga0097620_101117837 3300006931 Bacteria 867
118 Ga0099794_10016035 3300007265 Bacteria 3316
119 Ga0105240_10130469 3300009093 Bacteria 3015
120 Ga0111539_10040804 3300009094 Bacteria 5585
121 Ga0111539_10058142 3300009094 Bacteria 4588
122 Ga0111539_10060976 3300009094 Unclassified 4470
123 Ga0111539_10108322 3300009094 Bacteria 3260
124 Ga0111539_10151420 3300009094 Unclassified 2715
125 Ga0111539_11339554 3300009094 Unclassified 831
126 Ga0105245_10121544 3300009098 Unclassified 2440
127 Ga0105245_10180795 3300009098 Bacteria 2015
128 Ga0114129_10308458 3300009147 Bacteria 2107
129 Ga0105243_10024169 3300009148 Bacteria 4634
130 Ga0105243_10173119 3300009148 Unclassified 1871
131 Ga0105241_10013067 3300009174 Bacteria 6088
132 Ga0105242_10168291 3300009176 Unclassified 1924
133 Ga0105248_10240014 3300009177 Unclassified 2040
134 Ga0105237_10044629 3300009545 Unclassified 4463
135 Ga0105237_10057642 3300009545 Bacteria 3887
136 Ga0105238_10831222 3300009551 Bacteria 940
137 Ga0105249_10012712 3300009553 Bacteria 7420
138 Ga0105249_10147507 3300009553 Bacteria 2262
139 Ga0105249_10527198 3300009553 Bacteria 1229
140 Ga0105249_10849730 3300009553 Unclassified 978
141 Ga0105239_10040126 3300010375 Bacteria 5129
142 Ga0163162_10896599 3300013306 Unclassified 1000
143 Ga0163162_11501547 3300013306 Unclassified 768
144 Ga0157375_10266421 3300013308 Unclassified 1875
145 Ga0157375_10503842 3300013308 Bacteria 1375
146 Ga0157375_10874104 3300013308 Unclassified 1044
147 Ga0163163_10403575 3300014325 Bacteria 1425
148 Ga0157380_10023884 3300014326 Bacteria 4618
149 Ga0157380_11065327 3300014326 Bacteria 846
150 Ga0157379_10927829 3300014968 Bacteria 827
151 Ga0157376_10003788 3300014969 Bacteria 10457
152 Ga0209436_105188 3300025208 Bacteria 3042
153 Ga0207425_1000336 3300025245 Bacteria 32559
154 Ga0209129_1000148 3300025258 Bacteria 114559
155 Ga0209130_1000014 3300025284 Bacteria 412039
156 Ga0209675_1074476 3300025291 Bacteria 640
157 Ga0209564_1000251 3300025295 Bacteria 114511
158 Ga0209564_1002255 3300025295 Bacteria 15800
159 Ga0209758_1000387 3300025297 Bacteria 76099
160 Ga0209050_1003213 3300025298 Bacteria 12363
161 Ga0207426_1000224 3300025302 Bacteria 130233
162 Ga0209051_1002768 3300025303 Bacteria 12107
163 Ga0207685_10051246 3300025905 Unclassified 1594
164 Ga0207645_10035186 3300025907 Bacteria 3216
165 Ga0207643_10007700 3300025908 Bacteria 5785
166 Ga0207671_10018695 3300025914 Bacteria 5310
167 Ga0207693_10002400 3300025915 Bacteria 16262
168 Ga0207663_10094508 3300025916 Unclassified 1992
169 Ga0207660_10347047 3300025917 Bacteria 1189
170 Ga0207646_10178006 3300025922 Bacteria 1921
171 Ga0207681_10205683 3300025923 Bacteria 1514
172 Ga0207681_10227928 3300025923 Unclassified 1445
173 Ga0207681_11145486 3300025923 Bacteria 653
174 Ga0207650_10624493 3300025925 Bacteria 907
175 Ga0207659_10268681 3300025926 Bacteria 1390
176 Ga0207687_10139537 3300025927 Bacteria 1837
177 Ga0207687_10808759 3300025927 Unclassified 800
178 Ga0207644_10490301 3300025931 Unclassified 1013
179 Ga0207706_10001080 3300025933 Bacteria 27682
180 Ga0207706_10140717 3300025933 Bacteria 2123
181 Ga0207709_10752260 3300025935 Unclassified 784
182 Ga0207670_10020315 3300025936 Bacteria 4079
183 Ga0207669_10022744 3300025937 Bacteria 3336
184 Ga0207669_10039263 3300025937 Bacteria 2733
185 Ga0207704_10096540 3300025938 Unclassified 1957
186 Ga0207704_10362333 3300025938 Bacteria 1132
187 Ga0207665_10014220 3300025939 Bacteria 5238
188 Ga0207691_10004546 3300025940 Bacteria 13429
189 Ga0207691_10006816 3300025940 Bacteria 11013
190 Ga0207711_10066628 3300025941 Bacteria 3114
191 Ga0207689_10055677 3300025942 Bacteria 3255
192 Ga0207689_10164711 3300025942 Bacteria 1827
193 Ga0207651_10181243 3300025960 Bacteria 1671
194 Ga0207668_10314729 3300025972 Unclassified 1297
195 Ga0207668_10476295 3300025972 Bacteria 1070
196 Ga0207658_10263501 3300025986 Bacteria 1470
197 Ga0207658_10271091 3300025986 Bacteria 1451
198 Ga0207658_10488454 3300025986 Bacteria 1095
199 Ga0207677_10432871 3300026023 Unclassified 1123
200 Ga0207639_10117882 3300026041 Bacteria 2176
201 Ga0207639_10143158 3300026041 Bacteria 1994
202 Ga0207678_10216998 3300026067 Bacteria 1637
203 Ga0207702_10316506 3300026078 Unclassified 1485
204 Ga0207641_11328996 3300026088 Unclassified 719
205 Ga0207648_10121092 3300026089 Bacteria 2301
206 Ga0207648_10217412 3300026089 Bacteria 1698
207 Ga0207674_10054186 3300026116 Bacteria 4084
208 Ga0207675_100011422 3300026118 Bacteria 8308
209 Ga0207683_10032031 3300026121 Unclassified 4565
210 Ga0207683_10078821 3300026121 Bacteria 2919
211 Ga0207698_10663938 3300026142 Unclassified 1034
212 Ga0209179_1019543 3300027512 Bacteria 1306
213 Ga0209983_1010829 3300027665 Bacteria 1863
214 Ga0207428_10068336 3300027907 Bacteria 2795
215 Ga0207428_10390998 3300027907 Bacteria 1019
216 Ga0207428_10701680 3300027907 Unclassified 724
217 Ga0268266_10347450 3300028379 Unclassified 1393
218 Ga0268266_10465214 3300028379 Unclassified 1204
219 Ga0268265_10399998 3300028380 Unclassified 1269
220 Ga0268264_10319062 3300028381 Unclassified 1468
221 Ga0268264_10430745 3300028381 Bacteria 1274
222 Ga0307517_10000590 3300028786 Bacteria 61880
223 Ga0307517_10117953 3300028786 Bacteria 1978
224 Ga0307513_10217539 3300031456 Bacteria 1735
225 Ga0316576_10688178 3300031727 Unclassified 742
226 Ga0307516_10022871 3300031730 Bacteria 6415
227 Ga0307516_10075955 3300031730 Bacteria 3213
228 Ga0373923_0157129 3300035111 Unclassified 1035
229 Ga0373943_0185109 3300035170 Unclassified 1146
230 Ga0373925_0092777 3300037068 Unclassified 2310
231 Ga0395905_0123606 3300037471 Bacteria 2433
232 Ga0395905_0130999 3300037471 Bacteria 2359
233 Ga0395905_0195314 3300037471 Bacteria 1897
234 Ga0395905_0727434 3300037471 Bacteria 895
235 Ga0451853_1061601 3300041512 Bacteria 2990
236 Ga0439441_041336 3300042001 Bacteria 925
237 Ga0450896_001370 3300042133 Bacteria 2978
238 Ga0439460_0021930 3300042461 Bacteria 1749
239 Ga0451576_1479425 3300045051 Bacteria 706
240 Ga0495590_0016077 3300046457 Bacteria 2706
241 Ga0495638_0176039 3300046460 Bacteria 1224
242 Ga0495580_0013793 3300046472 Bacteria 6153
243 Ga0495582_0234667 3300046473 Bacteria 1051
244 Ga0495605_0029015 3300046474 Bacteria 2852
245 Ga0495664_0321383 3300046477 Unclassified 933
246 Ga0495594_0447394 3300046499 Unclassified 734
247 Ga0495618_0043911 3300046514 Bacteria 2820
248 Ga0495631_0054785 3300046518 Bacteria 1738
249 Ga0495632_0003106 3300046519 Bacteria 12035
250 Ga0495642_0096973 3300046528 Bacteria 1252
251 Ga0495598_0002335 3300046537 Bacteria 3907
252 Ga0495597_0111934 3300046542 Bacteria 1144
253 Ga0495611_0067112 3300046648 Bacteria 1637
254 Ga0495625_0023869 3300046660 Bacteria 4665
255 Ga0495599_0365758 3300046678 Unclassified 863
256 Ga0495623_0309951 3300046679 Unclassified 870
257 Ga0495613_0167826 3300046689 Bacteria 1559
258 Ga0495649_0008052 3300046694 Bacteria 6366
259 Ga0495660_0043232 3300046810 Bacteria 2486
260 Ga0495687_001446 3300047443 Bacteria 21795
261 Ga0495687_005402 3300047443 Bacteria 8157
262 Ga0496100_0082736 3300048903 Unclassified 2171
263 Ga0496102_0233569 3300048905 Bacteria 1734
264 Ga0496105_0125272 3300048908 Bacteria 2118
265 Ga0496105_0408018 3300048908 Unclassified 1077
266 Ga0496106_0104189 3300048909 Bacteria 2203
267 Ga0496107_0076734 3300048910 Unclassified 2434
268 Ga0496109_0118462 3300048912 Unclassified 2465
269 Ga0496111_0036444 3300048914 Bacteria 3517
270 Ga0496112_0129185 3300048915 Unclassified 2498
271 Ga0496113_0171823 3300048916 Unclassified 1716
272 Ga0496114_0207999 3300048917 Unclassified 1715
273 Ga0501031_0036954 3300049568 Bacteria 3187
274 Ga0501031_0041600 3300049568 Bacteria 3000
275 Ga0501032_0116640 3300049569 Bacteria 1765
276 Ga0501033_0020746 3300049570 Bacteria 4964
277 Ga0501036_0007800 3300049572 Bacteria 8754
278 Ga0501036_0121458 3300049572 Bacteria 2206
279 Ga0501037_0004557 3300049573 Bacteria 10081
280 Ga0501038_0008115 3300049574 Bacteria 9665
281 Ga0501039_0053420 3300049575 Bacteria 3126
282 Ga0501039_0102120 3300049575 Bacteria 2238
283 Ga0501040_0019919 3300049576 Bacteria 4465
284 Ga0501040_0278584 3300049576 Bacteria 1194
285 Ga0501041_0011798 3300049577 Bacteria 5173
286 Ga0501042_0004141 3300049578 Bacteria 9220
287 Ga0501046_0004786 3300049580 Bacteria 12201
288 Ga0501048_0005723 3300049582 Bacteria 9447
289 Ga0501068_0157534 3300049584 Bacteria 1430
290 Ga0501070_0137127 3300049586 Bacteria 2020
291 Ga0501071_0026308 3300049587 Bacteria 4083
292 Ga0501072_0002282 3300049588 Bacteria 14340
293 Ga0501072_0350192 3300049588 Bacteria 1173
294 Ga0501073_0184320 3300049589 Bacteria 1445
295 Ga0501074_0012774 3300049590 Bacteria 6106
296 Ga0501075_0000824 3300049591 Bacteria 19486
297 Ga0501076_0026605 3300049592 Bacteria 4482
298 Ga0501079_0000199 3300049741 Bacteria 34700
299 Ga0501080_0128250 3300049742 Bacteria 2348
300 Ga0501081_0001150 3300049743 Bacteria 16010
301 Ga0501083_0045983 3300049744 Bacteria 2952
302 Ga0501035_0101304 3300049822 Bacteria 2527
303 Ga0501044_0218518 3300049823 Bacteria 1857
304 Ga0501045_0005984 3300049824 Bacteria 8414
305 nmdc:mga03683_58446_c1 3300050489 Bacteria 1625
306 nmdc:mga0k408_132218_c1 3300050493 Bacteria 1482
307 nmdc:mga0k408_3106_c1 3300050493 Bacteria 8801
308 nmdc:mga0k408_32094_c1 3300050493 Bacteria 3001
309 nmdc:mga0k408_51549_c1 3300050493 Bacteria 2384
310 nmdc:mga0k408_5235_c1 3300050493 Bacteria 6887
311 nmdc:mga06z11_113893_c1 3300050494 Bacteria 1501
312 nmdc:mga06z11_11937_c1 3300050494 Bacteria 2903
313 nmdc:mga04h51_52297_c1 3300050495 Bacteria 1375
314 nmdc:mga07m45_166093_c1 3300050496 Bacteria 1282
315 nmdc:mga07m45_183811_c1 3300050496 Bacteria 1216
316 nmdc:mga07m45_24243_c1 3300050496 Bacteria 3322
317 nmdc:mga07m45_282_c1 3300050496 Bacteria 20415
318 nmdc:mga07m45_31227_c1 3300050496 Bacteria 2952
319 nmdc:mga07m45_33444_c1 3300050496 Bacteria 2855
320 nmdc:mga05p37_361777_c1 3300050507 Bacteria 1705
321 nmdc:mga09592_111956_c1 3300050508 Bacteria 2342
322 nmdc:mga09592_196038_c1 3300050508 Unclassified 1748
323 nmdc:mga09592_5933_c1 3300050508 Bacteria 9957
324 nmdc:mga0qj67_191743_c1 3300050509 Bacteria 1661
325 nmdc:mga0qj67_419690_c1 3300050509 Bacteria 1079
326 nmdc:mga06r32_125348_c1 3300050510 Unclassified 2536
327 nmdc:mga06r32_362644_c1 3300050510 Bacteria 1433
328 nmdc:mga06r32_3671_c1 3300050510 Bacteria 13708
329 nmdc:mga06r32_571880_c1 3300050510 Unclassified 1103
330 nmdc:mga06r32_89721_c1 3300050510 Bacteria 3002
331 nmdc:mga08y16_26654_c1 3300050511 Bacteria 6091
332 nmdc:mga08y16_27732_c1 3300050511 Bacteria 5967
333 nmdc:mga08y16_351002_c1 3300050511 Bacteria 1515
334 nmdc:mga0n895_288751_c1 3300050512 Bacteria 1663
335 nmdc:mga0a205_302414_c1 3300050515 Bacteria 1472
336 nmdc:mga0a205_697568_c1 3300050515 Bacteria 865
337 nmdc:mga0sz30_294638_c1 3300050516 Bacteria 723
338 nmdc:mga0sz30_6858_c1 3300050516 Bacteria 4251
339 Ga0495601_0271669 3300053077 Unclassified 1106
340 Ga0495601_0684240 3300053077 Unclassified 655
341 Ga0500644_0002831 3300053088 Bacteria 4319
342 Ga0500641_0101149 3300053096 Bacteria 1236
343 Ga0500658_0002629 3300053134 Bacteria 6916
344 Ga0500568_0025639 3300053139 Bacteria 2484
345 Ga0500645_004977 3300053730 Bacteria 4982
346 Ga0500645_026441 3300053730 Bacteria 1766
347 Ga0500645_083340 3300053730 Bacteria 911
348 Ga0501084_0002215 3300054114 Bacteria 15599
349 Ga0501082_0003612 3300060353 Bacteria 13512
350 Ga0530510_0007618 3300061734 Bacteria 7541
351 Ga0157370_10010672
352 JGI25152J39213_1006684
353 JGI25159J45721_1000402
354 JGI25159J45721_1000474
355 JGI25153J46596_10001927
356 JGI25160J50197_1000117
357 JGI25161J50226_1000009
358 Ga0055526_1001234
359 Ga0055526_1006870
360 Ga0055526_1010171
361 Ga0055537_1000020
362 Ga0055524_1000047
363 Ga0055524_1000143
364 Ga0055536_1010641
365 Ga0055534_1000967
366 Ga0055528_1000812
367 Ga0055530_10000252
368 Ga0055530_10027709
369 Ga0055540_1000027
370 Ga0055531_10001053
371 Ga0055543_1001153
372 Ga0065165_1017978
373 Ga0065707_10489549
374 Ga0070690_100107809
375 Ga0070690_100176827
376 Ga0068869_100072884
377 Ga0068869_100186869
378 Ga0070666_10024947
379 Ga0070680_100059592
380 Ga0068868_100802010
381 Ga0070689_100158085
382 Ga0070689_100293497
383 Ga0070689_100663614
384 Ga0070661_100009810
385 Ga0070668_100266479
386 Ga0070668_100502694
387 Ga0070669_100337587
388 Ga0070669_100470340
389 Ga0070669_100885521
390 Ga0070675_100094743
391 Ga0070673_100075977
392 Ga0070673_100096099
393 Ga0070673_100300811
394 Ga0070688_100305266
395 Ga0070667_100073092
396 Ga0070667_100112213
397 Ga0070667_100221689
398 Ga0070703_10186811
399 Ga0070709_10551716
400 Ga0070710_10169116
401 Ga0070701_10025782
402 Ga0070711_100207500
403 Ga0070700_100781178
404 Ga0070663_100040669
405 Ga0070678_100230225
406 Ga0070662_100048909
407 Ga0070662_100060880
408 Ga0070662_100570812
409 Ga0068867_100159952
410 Ga0068867_100264558
411 Ga0070686_100517414
412 Ga0070695_100401146
413 Ga0070665_100152378
414 Ga0070704_100132786
415 Ga0070664_100956508
416 Ga0068857_100030907
417 Ga0068856_100518894
418 Ga0070702_100307283
419 Ga0068852_100654401
420 Ga0068859_100026910
421 Ga0068859_100236404
422 Ga0068859_101117673
423 Ga0068861_100037928
424 Ga0068861_101105529
425 Ga0068863_100116447
426 Ga0068863_100219341
427 Ga0068858_100107991
428 Ga0068862_100042432
429 Ga0068862_100923444
430 Ga0075368_10019736
431 Ga0075368_10327746
432 Ga0075363_100011486
433 Ga0075363_100087909
434 Ga0070715_10006143
435 Ga0070716_100006583
436 Ga0070716_100351976
437 Ga0075367_10003340
438 Ga0075367_10493252
439 Ga0075367_10572316
440 Ga0075369_10013614
441 Ga0075366_10041018
442 Ga0075366_10051248
443 Ga0075366_10071884
444 Ga0075366_10096750
445 Ga0075366_10178258
446 Ga0097621_100054041
447 Ga0075370_10010542
448 Ga0075370_10027526
449 Ga0075370_10039911
450 Ga0075370_10064507
451 Ga0075370_10074024
452 Ga0075428_100183495
453 Ga0075428_100390201
454 Ga0075428_101138556
455 Ga0075430_100160813
456 Ga0075431_100000050
457 Ga0075431_100026893
458 Ga0075431_100154541
459 Ga0075433_10770511
460 Ga0075434_100195673
461 Ga0075429_100077327
462 Ga0075429_100136549
463 Ga0075429_100177135
464 Ga0068865_100133030
465 Ga0097620_100026910
466 Ga0097620_100236385
467 Ga0097620_101117837
468 Ga0099794_10016035
469 Ga0105240_10130469
470 Ga0111539_10040804
471 Ga0111539_10058142
472 Ga0111539_10060976
473 Ga0111539_10108322
474 Ga0111539_10151420
475 Ga0111539_11339554
476 Ga0105245_10121544
477 Ga0105245_10180795
478 Ga0114129_10308458
479 Ga0105243_10024169
480 Ga0105243_10173119
481 Ga0105241_10013067
482 Ga0105242_10168291
483 Ga0105248_10240014
484 Ga0105237_10044629
485 Ga0105237_10057642
486 Ga0105238_10831222
487 Ga0105249_10012712
488 Ga0105249_10147507
489 Ga0105249_10527198
490 Ga0105249_10849730
491 Ga0105239_10040126
492 Ga0163162_10896599
493 Ga0163162_11501547
494 Ga0157375_10266421
495 Ga0157375_10503842
496 Ga0157375_10874104
497 Ga0163163_10403575
498 Ga0157380_10023884
499 Ga0157380_11065327
500 Ga0157379_10927829
501 Ga0157376_10003788
502 Ga0209436_105188
503 Ga0207425_1000336
504 Ga0209129_1000148
505 Ga0209130_1000014
506 Ga0209675_1074476
507 Ga0209564_1000251
508 Ga0209564_1002255
509 Ga0209758_1000387
510 Ga0209050_1003213
511 Ga0207426_1000224
512 Ga0209051_1002768
513 Ga0207685_10051246
514 Ga0207645_10035186
515 Ga0207643_10007700
516 Ga0207671_10018695
517 Ga0207693_10002400
518 Ga0207663_10094508
519 Ga0207660_10347047
520 Ga0207646_10178006
521 Ga0207681_10205683
522 Ga0207681_10227928
523 Ga0207681_11145486
524 Ga0207650_10624493
525 Ga0207659_10268681
526 Ga0207687_10139537
527 Ga0207687_10808759
528 Ga0207644_10490301
529 Ga0207706_10001080
530 Ga0207706_10140717
531 Ga0207709_10752260
532 Ga0207670_10020315
533 Ga0207669_10022744
534 Ga0207669_10039263
535 Ga0207704_10096540
536 Ga0207704_10362333
537 Ga0207665_10014220
538 Ga0207691_10004546
539 Ga0207691_10006816
540 Ga0207711_10066628
541 Ga0207689_10055677
542 Ga0207689_10164711
543 Ga0207651_10181243
544 Ga0207668_10314729
545 Ga0207668_10476295
546 Ga0207658_10263501
547 Ga0207658_10271091
548 Ga0207658_10488454
549 Ga0207677_10432871
550 Ga0207639_10117882
551 Ga0207639_10143158
552 Ga0207678_10216998
553 Ga0207702_10316506
554 Ga0207641_11328996
555 Ga0207648_10121092
556 Ga0207648_10217412
557 Ga0207674_10054186
558 Ga0207675_100011422
559 Ga0207683_10032031
560 Ga0207683_10078821
561 Ga0207698_10663938
562 Ga0209179_1019543
563 Ga0209983_1010829
564 Ga0207428_10068336
565 Ga0207428_10390998
566 Ga0207428_10701680
567 Ga0268266_10347450
568 Ga0268266_10465214
569 Ga0268265_10399998
570 Ga0268264_10319062
571 Ga0268264_10430745
572 Ga0307517_10000590
573 Ga0307517_10117953
574 Ga0307513_10217539
575 Ga0316576_10688178
576 Ga0307516_10022871
577 Ga0307516_10075955
578 Ga0373923_0157129
579 Ga0373943_0185109
580 Ga0373925_0092777
581 Ga0395905_0123606
582 Ga0395905_0130999
583 Ga0395905_0195314
584 Ga0395905_0727434
585 Ga0451853_1061601
586 Ga0439441_041336
587 Ga0450896_001370
588 Ga0439460_0021930
589 Ga0451576_1479425
590 Ga0495590_0016077
591 Ga0495638_0176039
592 Ga0495580_0013793
593 Ga0495582_0234667
594 Ga0495605_0029015
595 Ga0495664_0321383
596 Ga0495594_0447394
597 Ga0495618_0043911
598 Ga0495631_0054785
599 Ga0495632_0003106
600 Ga0495642_0096973
601 Ga0495598_0002335
602 Ga0495597_0111934
603 Ga0495611_0067112
604 Ga0495625_0023869
605 Ga0495599_0365758
606 Ga0495623_0309951
607 Ga0495613_0167826
608 Ga0495649_0008052
609 Ga0495660_0043232
610 Ga0495687_001446
611 Ga0495687_005402
612 Ga0496100_0082736
613 Ga0496102_0233569
614 Ga0496105_0125272
615 Ga0496105_0408018
616 Ga0496106_0104189
617 Ga0496107_0076734
618 Ga0496109_0118462
619 Ga0496111_0036444
620 Ga0496112_0129185
621 Ga0496113_0171823
622 Ga0496114_0207999
623 Ga0501031_0036954
624 Ga0501031_0041600
625 Ga0501032_0116640
626 Ga0501033_0020746
627 Ga0501036_0007800
628 Ga0501036_0121458
629 Ga0501037_0004557
630 Ga0501038_0008115
631 Ga0501039_0053420
632 Ga0501039_0102120
633 Ga0501040_0019919
634 Ga0501040_0278584
635 Ga0501041_0011798
636 Ga0501042_0004141
637 Ga0501046_0004786
638 Ga0501048_0005723
639 Ga0501068_0157534
640 Ga0501070_0137127
641 Ga0501071_0026308
642 Ga0501072_0002282
643 Ga0501072_0350192
644 Ga0501073_0184320
645 Ga0501074_0012774
646 Ga0501075_0000824
647 Ga0501076_0026605
648 Ga0501079_0000199
649 Ga0501080_0128250
650 Ga0501081_0001150
651 Ga0501083_0045983
652 Ga0501035_0101304
653 Ga0501044_0218518
654 Ga0501045_0005984
655 nmdc:mga03683_58446_c1
656 nmdc:mga0k408_132218_c1
657 nmdc:mga0k408_3106_c1
658 nmdc:mga0k408_32094_c1
659 nmdc:mga0k408_51549_c1
660 nmdc:mga0k408_5235_c1
661 nmdc:mga06z11_113893_c1
662 nmdc:mga06z11_11937_c1
663 nmdc:mga04h51_52297_c1
664 nmdc:mga07m45_166093_c1
665 nmdc:mga07m45_183811_c1
666 nmdc:mga07m45_24243_c1
667 nmdc:mga07m45_282_c1
668 nmdc:mga07m45_31227_c1
669 nmdc:mga07m45_33444_c1
670 nmdc:mga05p37_361777_c1
671 nmdc:mga09592_111956_c1
672 nmdc:mga09592_196038_c1
673 nmdc:mga09592_5933_c1
674 nmdc:mga0qj67_191743_c1
675 nmdc:mga0qj67_419690_c1
676 nmdc:mga06r32_125348_c1
677 nmdc:mga06r32_362644_c1
678 nmdc:mga06r32_3671_c1
679 nmdc:mga06r32_571880_c1
680 nmdc:mga06r32_89721_c1
681 nmdc:mga08y16_26654_c1
682 nmdc:mga08y16_27732_c1
683 nmdc:mga08y16_351002_c1
684 nmdc:mga0n895_288751_c1
685 nmdc:mga0a205_302414_c1
686 nmdc:mga0a205_697568_c1
687 nmdc:mga0sz30_294638_c1
688 nmdc:mga0sz30_6858_c1
689 Ga0495601_0271669
690 Ga0495601_0684240
691 Ga0500644_0002831
692 Ga0500641_0101149
693 Ga0500658_0002629
694 Ga0500568_0025639
695 Ga0500645_004977
696 Ga0500645_026441
697 Ga0500645_083340
698 Ga0501084_0002215
699 Ga0501082_0003612
700 Ga0530510_0007618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

37

162

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2evn-assembly1.cif.gz_A nmr solution structures of at1g77540 0.7859 81 145
7n1l-assembly4.cif.gz_F crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7531 2 141
2ozg-assembly1.cif.gz_A crystal structure of gcn5-related n-acetyltransferase (yp_325469.1) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.7476 2 178
7n1l-assembly4.cif.gz_J crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7434 2 141
4zbp-assembly2.cif.gz_C-2 crystal structure of the ampcpr-bound atnudt7 0.7433 102 192
ID Description Score Start End Superfamily
3frmF00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8102 3 133 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8051 79 140 3.40.630.30
af_Q2FWC9_161_285_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8039 70 192 3.40.630.30
af_Q9SJC4_7_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7931 127 192 3.40.630.30
af_P67553_1_236_2.40.160.190 Mainly Beta;Beta Barrel;Porin; 0.7929 70 86 2.40.160.190
ID Description Score Start End GO Terms
AF-A0A2V6NMR2-F1-model_v4 GNAT family N-acetyltransferase 0.9814 2 190 GO:0016747
AF-A0A2V9IRT4-F1-model_v4 GNAT family N-acetyltransferase 0.9814 82 192 GO:0016747
AF-A0A536TCU9-F1-model_v4 GNAT family N-acetyltransferase 0.9796 78 190 GO:0016747
AF-A0A536W269-F1-model_v4 GNAT family N-acetyltransferase 0.9777 1 190 GO:0004123
GO:0005737
GO:0016747
GO:0019343
GO:0019346
GO:0030170
AF-A0A521XH85-F1-model_v4 GNAT family N-acetyltransferase 0.9741 91 190 GO:0016747

Map