F418213

General Info

Members Datasets Scaffolds Average Seq Length
350 237 350 103

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10069186|Ga0105240_100691866
Length 126
Sequence LKNSECAWRGRFGRRVQCEEIAMKTSCSHLDGIREVTPSAAGCEECLKTGSPWVHLRICRSCGHVGCCDDSPGRHATKHYRATGHPIIEGYDPPEGWGWCYVDDFMFDLSDRKTPHPGPIPRYVDE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.43
Nodule 0.57
Rhizoplane 2
Rhizosphere 74.57
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007306 3300001979 Bacteria 4500
2 JGI24737J22298_10007751 3300001990 Bacteria 3619
3 JGI24737J22298_10028312 3300001990 Bacteria 1762
4 JGI24735J21928_10023587 3300002067 Bacteria 1865
5 JGI24735J21928_10027670 3300002067 Bacteria 1698
6 JGI25152J39213_1035790 3300002773 Bacteria 731
7 JGI25151J46595_10085003 3300003187 Bacteria 901
8 JGI25153J46596_10029618 3300003215 Bacteria 1876
9 Ga0006562J51391_1035571 3300003578 Bacteria 5130
10 Ga0006562J51391_1035572 3300003578 Bacteria 2707
11 Ga0055537_1000013 3300003773 Bacteria 133522
12 Ga0055537_1013231 3300003773 Bacteria 1561
13 Ga0055534_1000008 3300003784 Bacteria 211098
14 Ga0055528_1000170 3300003790 Bacteria 54883
15 Ga0055528_1012541 3300003790 Bacteria 3280
16 Ga0055540_1011063 3300003792 Bacteria 2946
17 Ga0065714_10430799 3300005288 Bacteria 566
18 Ga0070683_100294173 3300005329 Bacteria 1544
19 Ga0070666_10205627 3300005335 Bacteria 1386
20 Ga0070667_100001176 3300005367 Bacteria 23798
21 Ga0070667_100096157 3300005367 Bacteria 2554
22 Ga0070709_10584021 3300005434 Bacteria 858
23 Ga0070714_100071971 3300005435 Bacteria 2991
24 Ga0070713_100012550 3300005436 Bacteria 6219
25 Ga0070710_10005235 3300005437 Bacteria 6149
26 Ga0070710_10106850 3300005437 Bacteria 1675
27 Ga0070711_100019680 3300005439 Bacteria 4334
28 Ga0070711_101202605 3300005439 Bacteria 656
29 Ga0070662_100417209 3300005457 Bacteria 1110
30 Ga0070662_100959465 3300005457 Bacteria 731
31 Ga0070681_10335875 3300005458 Bacteria 1420
32 Ga0070684_100339252 3300005535 Bacteria 1381
33 Ga0068853_101215813 3300005539 Bacteria 728
34 Ga0070693_100283005 3300005547 Bacteria 1111
35 Ga0070665_100000304 3300005548 Bacteria 76931
36 Ga0070665_101256820 3300005548 Bacteria 751
37 Ga0068855_100021479 3300005563 Bacteria 7741
38 Ga0068855_100105642 3300005563 Bacteria 3237
39 Ga0068855_100341312 3300005563 Bacteria 1651
40 Ga0068855_101082137 3300005563 Bacteria 839
41 Ga0068857_100017669 3300005577 Bacteria 6254
42 Ga0068857_100477244 3300005577 Bacteria 1168
43 Ga0068854_100002904 3300005578 Bacteria 10640
44 Ga0068854_100064785 3300005578 Bacteria 2655
45 Ga0068854_100402915 3300005578 Bacteria 1132
46 Ga0068856_100256293 3300005614 Bacteria 1764
47 Ga0068856_100417658 3300005614 Bacteria 1361
48 Ga0068856_101045673 3300005614 Bacteria 834
49 Ga0068852_101817802 3300005616 Bacteria 632
50 Ga0068859_100054325 3300005617 Bacteria 4028
51 Ga0068851_10005429 3300005834 Bacteria 5784
52 Ga0068863_100056430 3300005841 Bacteria 3718
53 Ga0068863_100824796 3300005841 Bacteria 926
54 Ga0068858_100008510 3300005842 Bacteria 9859
55 Ga0068860_100002304 3300005843 Bacteria 20069
56 Ga0070717_10038985 3300006028 Bacteria 3864
57 Ga0075368_10139296 3300006042 Bacteria 1010
58 Ga0075368_10451960 3300006042 Bacteria 569
59 Ga0075363_100021219 3300006048 Bacteria 3268
60 Ga0075363_100616581 3300006048 Bacteria 651
61 Ga0075432_10009742 3300006058 Bacteria 3268
62 Ga0070712_100089250 3300006175 Bacteria 2254
63 Ga0070712_100094515 3300006175 Bacteria 2197
64 Ga0070712_100667153 3300006175 Bacteria 884
65 Ga0075367_10300402 3300006178 Bacteria 1010
66 Ga0075367_10383521 3300006178 Bacteria 888
67 Ga0075367_10686974 3300006178 Bacteria 651
68 Ga0075369_10011241 3300006186 Bacteria 3519
69 Ga0075369_10144504 3300006186 Bacteria 1086
70 Ga0075366_10063728 3300006195 Bacteria 2191
71 Ga0075366_10879281 3300006195 Bacteria 558
72 Ga0075370_10011563 3300006353 Bacteria 4641
73 Ga0075370_10107453 3300006353 Bacteria 1618
74 Ga0068871_100425984 3300006358 Bacteria 1186
75 Ga0097620_100054324 3300006931 Bacteria 4028
76 Ga0097620_101044538 3300006931 Bacteria 898
77 Ga0099826_10000134 3300006948 Bacteria 31806
78 Ga0105240_10026393 3300009093 Bacteria 7620
79 Ga0105240_10069186 3300009093 Bacteria 4370
80 Ga0105240_10079130 3300009093 Bacteria 4046
81 Ga0105240_10397359 3300009093 Bacteria 1553
82 Ga0105240_10614756 3300009093 Bacteria 1195
83 Ga0111539_10186468 3300009094 Bacteria 2422
84 Ga0105245_11328731 3300009098 Bacteria 768
85 Ga0105247_10008481 3300009101 Bacteria 6259
86 Ga0105243_10048256 3300009148 Bacteria 3356
87 Ga0105241_10283649 3300009174 Bacteria 1415
88 Ga0105241_10317764 3300009174 Bacteria 1342
89 Ga0105242_10019659 3300009176 Bacteria 5293
90 Ga0105248_10633819 3300009177 Bacteria 1206
91 Ga0105248_11957650 3300009177 Bacteria 665
92 Ga0105237_10000543 3300009545 Bacteria 53109
93 Ga0105237_10139623 3300009545 Bacteria 2417
94 Ga0105237_10430633 3300009545 Bacteria 1325
95 Ga0105238_10058790 3300009551 Bacteria 3853
96 Ga0105238_10124595 3300009551 Bacteria 2556
97 Ga0105238_10848094 3300009551 Bacteria 931
98 Ga0105249_10194582 3300009553 Bacteria 1981
99 Ga0099796_10008085 3300010159 Bacteria 2787
100 Ga0105239_10042866 3300010375 Bacteria 4959
101 Ga0105239_10168315 3300010375 Bacteria 2450
102 Ga0105239_11722820 3300010375 Bacteria 726
103 Ga0105239_12259355 3300010375 Bacteria 633
104 Ga0157345_1046538 3300012498 Bacteria 539
105 Ga0157373_10063600 3300013100 Bacteria 2612
106 Ga0157370_10515672 3300013104 Bacteria 1097
107 Ga0157369_10251054 3300013105 Bacteria 1846
108 Ga0157369_10263466 3300013105 Bacteria 1797
109 Ga0157374_11900066 3300013296 Bacteria 621
110 Ga0157372_11055911 3300013307 Bacteria 940
111 Ga0157372_12292402 3300013307 Bacteria 620
112 Ga0163163_11054577 3300014325 Bacteria 876
113 Ga0157380_10281397 3300014326 Bacteria 1522
114 Ga0182008_10000316 3300014497 Bacteria 37971
115 Ga0157376_10907035 3300014969 Unclassified 900
116 Ga0182005_1159258 3300015265 Bacteria 661
117 Ga0163161_10006196 3300017792 Bacteria 8288
118 Ga0206356_11611485 3300020070 Bacteria 623
119 Ga0206353_11539362 3300020082 Bacteria 3361
120 Ga0206353_12036297 3300020082 Bacteria 723
121 Ga0213876_10000204 3300021384 Bacteria 60563
122 Ga0209129_1001261 3300025258 Bacteria 14508
123 Ga0209565_1000042 3300025263 Bacteria 239712
124 Ga0209673_1000071 3300025273 Bacteria 239966
125 Ga0209675_1000041 3300025291 Bacteria 239712
126 Ga0209676_1071879 3300025292 Bacteria 819
127 Ga0209025_1009189 3300025294 Bacteria 6939
128 Ga0209025_1160709 3300025294 Bacteria 606
129 Ga0209758_1000644 3300025297 Bacteria 53122
130 Ga0209256_1008310 3300025299 Bacteria 4843
131 Ga0209051_1000362 3300025303 Bacteria 66692
132 Ga0207656_10149694 3300025321 Bacteria 1104
133 Ga0207710_10011257 3300025900 Bacteria 3766
134 Ga0207680_10123861 3300025903 Bacteria 1694
135 Ga0207647_10009507 3300025904 Bacteria 6904
136 Ga0207647_10089072 3300025904 Bacteria 1842
137 Ga0207647_10176632 3300025904 Bacteria 1242
138 Ga0207699_10076752 3300025906 Bacteria 2059
139 Ga0207699_10733008 3300025906 Bacteria 724
140 Ga0207654_10751299 3300025911 Bacteria 703
141 Ga0207707_10220105 3300025912 Bacteria 1653
142 Ga0207707_10616230 3300025912 Bacteria 917
143 Ga0207695_10009427 3300025913 Bacteria 12076
144 Ga0207695_10019726 3300025913 Bacteria 7752
145 Ga0207695_10149799 3300025913 Bacteria 2273
146 Ga0207695_10230114 3300025913 Bacteria 1758
147 Ga0207671_10000038 3300025914 Bacteria 227066
148 Ga0207671_10271993 3300025914 Bacteria 1335
149 Ga0207693_10196031 3300025915 Bacteria 1589
150 Ga0207693_10265915 3300025915 Bacteria 1344
151 Ga0207663_10013251 3300025916 Bacteria 4479
152 Ga0207663_10521233 3300025916 Bacteria 926
153 Ga0207694_10394516 3300025924 Bacteria 1150
154 Ga0207650_10454093 3300025925 Bacteria 1067
155 Ga0207700_10038520 3300025928 Bacteria 3470
156 Ga0207700_10103646 3300025928 Bacteria 2275
157 Ga0207700_10717380 3300025928 Viruses 893
158 Ga0207664_10953368 3300025929 Bacteria 769
159 Ga0207706_10092280 3300025933 Bacteria 2662
160 Ga0207686_10080006 3300025934 Bacteria 2129
161 Ga0207709_10033247 3300025935 Bacteria 3026
162 Ga0207665_10061192 3300025939 Bacteria 2551
163 Ga0207667_10000693 3300025949 Bacteria 43651
164 Ga0207667_10008397 3300025949 Bacteria 12273
165 Ga0207667_10405689 3300025949 Unclassified 1387
166 Ga0207712_11555508 3300025961 Bacteria 593
167 Ga0207640_10003374 3300025981 Bacteria 8603
168 Ga0207640_10040992 3300025981 Bacteria 2942
169 Ga0207658_10037500 3300025986 Bacteria 3484
170 Ga0207658_11486955 3300025986 Bacteria 619
171 Ga0207703_10005459 3300026035 Bacteria 10224
172 Ga0207703_10218592 3300026035 Bacteria 1702
173 Ga0207639_10170051 3300026041 Bacteria 1845
174 Ga0207678_10032172 3300026067 Bacteria 4572
175 Ga0207678_10312627 3300026067 Bacteria 1351
176 Ga0207702_10051708 3300026078 Bacteria 3474
177 Ga0207641_10000083 3300026088 Bacteria 134703
178 Ga0207674_10472329 3300026116 Bacteria 1212
179 Ga0207683_10437764 3300026121 Bacteria 1205
180 Ga0207698_10347768 3300026142 Bacteria 1399
181 Ga0207698_12226326 3300026142 Bacteria 561
182 Ga0209179_1002470 3300027512 Bacteria 2504
183 Ga0209282_1000514 3300027666 Bacteria 18748
184 Ga0209813_10111708 3300027866 Bacteria 942
185 Ga0268264_10000122 3300028381 Bacteria 189690
186 Ga0265338_10064096 3300028800 Bacteria 3199
187 Ga0265338_10717389 3300028800 Bacteria 689
188 Ga0265330_10340988 3300031235 Bacteria 633
189 Ga0265332_10445172 3300031238 Bacteria 535
190 Ga0265325_10000030 3300031241 Bacteria 103532
191 Ga0265325_10034241 3300031241 Bacteria 2704
192 Ga0265339_10196496 3300031249 Bacteria 997
193 Ga0265327_10004610 3300031251 Bacteria 12113
194 Ga0307408_101302507 3300031548 Bacteria 681
195 Ga0265313_10017739 3300031595 Bacteria 4027
196 Ga0265314_10005259 3300031711 Bacteria 11717
197 Ga0265314_10044559 3300031711 Bacteria 3144
198 Ga0265314_10482674 3300031711 Bacteria 655
199 Ga0307413_11019049 3300031824 Bacteria 711
200 Ga0307412_10194026 3300031911 Bacteria 1537
201 Ga0307510_10000013 3300033180 Bacteria 274569
202 Ga0373926_0007868 3300035083 Bacteria 3552
203 Ga0373934_0062626 3300035086 Bacteria 1483
204 Ga0373936_0118724 3300035113 Bacteria 1128
205 Ga0373936_0187510 3300035113 Bacteria 909
206 Ga0373953_0022621 3300035117 Bacteria 2372
207 Ga0373954_0357257 3300035118 Bacteria 721
208 Ga0373956_0029322 3300035119 Bacteria 2399
209 Ga0373956_0141694 3300035119 Bacteria 1129
210 Ga0373957_0106914 3300035120 Bacteria 1124
211 Ga0373943_0000764 3300035170 Bacteria 14012
212 Ga0373943_0748852 3300035170 Bacteria 580
213 Ga0373946_0020709 3300035171 Bacteria 2544
214 Ga0373955_0003514 3300035172 Bacteria 6895
215 Ga0373931_0003342 3300035691 Bacteria 7185
216 Ga0373935_0132432 3300035692 Bacteria 1676
217 Ga0373935_0310608 3300035692 Bacteria 1116
218 Ga0373935_0946118 3300035692 Bacteria 639
219 Ga0373927_0196140 3300035695 Bacteria 1325
220 Ga0373927_0735171 3300035695 Bacteria 652
221 Ga0373933_0012375 3300035724 Bacteria 4712
222 Ga0373933_1168003 3300035724 Bacteria 507
223 Ga0373947_0028591 3300035725 Bacteria 3270
224 Ga0373947_0030247 3300035725 Bacteria 3181
225 Ga0373937_0008716 3300036401 Bacteria 8810
226 Ga0373937_0022521 3300036401 Bacteria 5666
227 Ga0373937_0175576 3300036401 Bacteria 2011
228 Ga0373937_0685647 3300036401 Bacteria 971
229 Ga0373925_0002172 3300037068 Bacteria 15983
230 Ga0373925_0038515 3300037068 Bacteria 3535
231 Ga0395899_0000004 3300037312 Bacteria 874267
232 Ga0395898_0282317 3300037466 Bacteria 1584
233 Ga0395901_0323176 3300038443 Bacteria 1596
234 Ga0436365_0902712 3300039437 Bacteria 60533
235 Ga0436361_0709558 3300039447 Bacteria 3015
236 Ga0451841_0671770 3300041498 Bacteria 1841
237 Ga0451843_0192486 3300041509 Bacteria 966
238 Ga0439460_0111452 3300042461 Bacteria 888
239 Ga0495592_0003543 3300046454 Bacteria 11210
240 Ga0495592_0081935 3300046454 Bacteria 2333
241 Ga0495651_0003380 3300046462 Bacteria 12248
242 Ga0495653_0344159 3300046463 Bacteria 960
243 Ga0495580_0525609 3300046472 Bacteria 788
244 Ga0495585_0018219 3300046492 Bacteria 4052
245 Ga0495606_0161628 3300046507 Bacteria 1306
246 Ga0495608_0088390 3300046511 Bacteria 2006
247 Ga0495618_0067653 3300046514 Bacteria 2272
248 Ga0495628_0009916 3300046516 Bacteria 8109
249 Ga0495628_0305757 3300046516 Bacteria 1176
250 Ga0495630_0510830 3300046517 Bacteria 921
251 Ga0495632_0146598 3300046519 Bacteria 1093
252 Ga0495632_0396780 3300046519 Bacteria 603
253 Ga0495654_0175245 3300046530 Bacteria 932
254 Ga0495640_0127262 3300046533 Bacteria 1651
255 Ga0495640_0182347 3300046533 Bacteria 1337
256 Ga0495587_0006045 3300046536 Bacteria 7893
257 Ga0495597_0213418 3300046542 Bacteria 769
258 Ga0495645_0007968 3300046543 Bacteria 7374
259 Ga0495622_0014193 3300046557 Bacteria 3699
260 Ga0495633_0076751 3300046558 Bacteria 1556
261 Ga0495667_0010344 3300046559 Bacteria 6312
262 Ga0495667_0150833 3300046559 Bacteria 1497
263 Ga0495668_0805860 3300046616 Bacteria 520
264 Ga0495625_0604660 3300046660 Bacteria 658
265 Ga0495635_0024350 3300046663 Bacteria 4219
266 Ga0495635_0040933 3300046663 Bacteria 3201
267 Ga0495657_0027902 3300046675 Bacteria 3976
268 Ga0495599_0048893 3300046678 Bacteria 2651
269 Ga0495623_0012615 3300046679 Bacteria 5470
270 Ga0495646_0236915 3300046680 Bacteria 982
271 Ga0495646_0377630 3300046680 Bacteria 739
272 Ga0495647_0451189 3300046681 Bacteria 595
273 Ga0495658_0225820 3300046683 Bacteria 1173
274 Ga0495624_0191212 3300046690 Bacteria 1245
275 Ga0495649_0570063 3300046694 Bacteria 560
276 Ga0495600_0007504 3300046809 Bacteria 6675
277 Ga0495600_0311970 3300046809 Bacteria 990
278 Ga0495604_0037126 3300047317 Bacteria 3839
279 Ga0495674_0013179 3300047319 Bacteria 7773
280 Ga0495674_0064407 3300047319 Bacteria 3187
281 Ga0495674_0159603 3300047319 Bacteria 1887
282 Ga0495672_0005420 3300047320 Bacteria 10126
283 Ga0495672_0258657 3300047320 Bacteria 841
284 Ga0495680_0005585 3300047322 Bacteria 11795
285 Ga0495680_0018422 3300047322 Bacteria 5930
286 Ga0495675_0063043 3300047444 Bacteria 2346
287 Ga0495684_0288487 3300047471 Bacteria 1182
288 Ga0495602_0006367 3300048088 Bacteria 12384
289 Ga0495602_0549218 3300048088 Bacteria 801
290 Ga0496102_0029228 3300048905 Bacteria 4930
291 Ga0496102_0285021 3300048905 Bacteria 1557
292 Ga0496102_0730916 3300048905 Bacteria 913
293 Ga0496104_0000065 3300048907 Bacteria 108770
294 Ga0496105_0000338 3300048908 Bacteria 30721
295 Ga0496114_0023768 3300048917 Bacteria 5002
296 Ga0496115_0505239 3300048918 Bacteria 971
297 Ga0496117_0000220 3300048920 Bacteria 109644
298 Ga0496118_0000028 3300048921 Bacteria 366490
299 Ga0496118_0285374 3300048921 Bacteria 916
300 Ga0496118_0491469 3300048921 Bacteria 613
301 Ga0496119_0013406 3300048922 Bacteria 6534
302 Ga0496119_0016237 3300048922 Bacteria 5682
303 Ga0496119_0056806 3300048922 Bacteria 2369
304 Ga0496120_0000115 3300048923 Bacteria 136364
305 Ga0496120_0005063 3300048923 Bacteria 10674
306 Ga0496121_0023909 3300048924 Bacteria 5860
307 Ga0496123_0195695 3300048926 Bacteria 1041
308 Ga0496124_0011508 3300048927 Bacteria 8836
309 Ga0496124_0136436 3300048927 Bacteria 1942
310 Ga0496125_0000348 3300048928 Bacteria 87672
311 Ga0496125_0002893 3300048928 Bacteria 21630
312 Ga0496125_0010340 3300048928 Bacteria 9439
313 Ga0496125_0132307 3300048928 Bacteria 1753
314 Ga0496125_0458426 3300048928 Bacteria 728
315 Ga0496126_0035400 3300048929 Bacteria 4680
316 Ga0495678_059003 3300049459 Bacteria 1448
317 Ga0501067_0200971 3300049583 Bacteria 1110
318 Ga0501257_004731 3300049686 Bacteria 2977
319 Ga0501083_0467085 3300049744 Bacteria 821
320 nmdc:mga03n38_132591_c1 3300050490 Bacteria 1236
321 nmdc:mga00v17_993235_c1 3300050491 Bacteria 529
322 nmdc:mga0yw44_130479_c1 3300050492 Bacteria 1627
323 nmdc:mga0k408_724714_c1 3300050493 Bacteria 582
324 nmdc:mga0k408_839065_c1 3300050493 Bacteria 535
325 nmdc:mga06z11_220768_c1 3300050494 Bacteria 1108
326 nmdc:mga04h51_131216_c1 3300050495 Bacteria 942
327 nmdc:mga04h51_277742_c1 3300050495 Bacteria 678
328 nmdc:mga07m45_90623_c1 3300050496 Bacteria 1751
329 nmdc:mga08y16_153998_c1 3300050511 Bacteria 2389
330 nmdc:mga0sz30_565764_c1 3300050516 Bacteria 513
331 nmdc:mga0sz30_579408_c1 3300050516 Bacteria 507
332 Ga0495601_0000111 3300053077 Bacteria 44773
333 Ga0495601_0000347 3300053077 Bacteria 24383
334 Ga0495612_0002231 3300053078 Bacteria 7962
335 Ga0495612_0088604 3300053078 Bacteria 1307
336 Ga0495595_0000587 3300053084 Bacteria 13888
337 Ga0495619_0000083 3300053085 Bacteria 70312
338 Ga0495619_0000296 3300053085 Bacteria 35155
339 Ga0500646_0033855 3300053090 Bacteria 1415
340 Ga0500642_0178048 3300053130 Bacteria 994
341 Ga0500658_0008537 3300053134 Bacteria 3784
342 Ga0500658_0523721 3300053134 Bacteria 535
343 Ga0500559_0086209 3300053136 Bacteria 1433
344 Ga0500568_0001046 3300053139 Bacteria 18905
345 Ga0500588_0001208 3300053146 Bacteria 4782
346 Ga0500616_0174174 3300053153 Bacteria 974
347 Ga0500611_078349 3300053727 Bacteria 820
348 Ga0500596_019187 3300053735 Bacteria 1027
349 Ga0501084_0001152 3300054114 Bacteria 20593
350 Ga0466962_0223320 3300061719 Bacteria 923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003773 Ga0055537_1013231 Ga0055537_10132312 101
2 3300003790 Ga0055528_1012541 Ga0055528_10125413 101
3 3300005329 Ga0070683_100294173 Ga0070683_1002941732 101
4 3300005367 Ga0070667_100001176 Ga0070667_10000117610 101
5 3300005434 Ga0070709_10584021 Ga0070709_105840212 101
6 3300005435 Ga0070714_100071971 Ga0070714_1000719712 101
7 3300005437 Ga0070710_10106850 Ga0070710_101068503 101
8 3300005458 Ga0070681_10335875 Ga0070681_103358752 101
9 3300005535 Ga0070684_100339252 Ga0070684_1003392521 101
10 3300005539 Ga0068853_101215813 Ga0068853_1012158132 101
11 3300005548 Ga0070665_100000304 Ga0070665_10000030451 101
12 3300005563 Ga0068855_100341312 Ga0068855_1003413123 101
13 3300005614 Ga0068856_100417658 Ga0068856_1004176582 101
14 3300006175 Ga0070712_100089250 Ga0070712_1000892503 101
15 3300009093 Ga0105240_10397359 Ga0105240_103973592 101
16 3300009177 Ga0105248_10633819 Ga0105248_106338193 101
17 3300009545 Ga0105237_10430633 Ga0105237_104306332 101
18 3300009551 Ga0105238_10058790 Ga0105238_100587902 101
19 3300009553 Ga0105249_10194582 Ga0105249_101945822 101
20 3300010375 Ga0105239_11722820 Ga0105239_117228202 101
21 3300013100 Ga0157373_10063600 Ga0157373_100636002 101
22 3300013104 Ga0157370_10515672 Ga0157370_105156722 101
23 3300013307 Ga0157372_12292402 Ga0157372_122924021 101
24 3300046530 Ga0495654_0175245 Ga0495654_0175245_582_890 101
25 3300046542 Ga0495597_0213418 Ga0495597_0213418_372_680 101
26 3300046557 Ga0495622_0014193 Ga0495622_0014193_459_767 101
27 3300046558 Ga0495633_0076751 Ga0495633_0076751_371_679 101
28 3300003187 JGI25151J46595_10085003 JGI25151J46595_100850031 102
29 3300003773 Ga0055537_1000013 Ga0055537_100001383 102
30 3300003784 Ga0055534_1000008 Ga0055534_1000008117 102
31 3300003790 Ga0055528_1000170 Ga0055528_100017027 102
32 3300005288 Ga0065714_10430799 Ga0065714_104307991 102
33 3300005335 Ga0070666_10205627 Ga0070666_102056272 102
34 3300005367 Ga0070667_100096157 Ga0070667_1000961573 102
35 3300005436 Ga0070713_100012550 Ga0070713_1000125506 102
36 3300005437 Ga0070710_10005235 Ga0070710_100052354 102
37 3300005439 Ga0070711_100019680 Ga0070711_1000196802 102
38 3300005457 Ga0070662_100959465 Ga0070662_1009594652 102
39 3300005547 Ga0070693_100283005 Ga0070693_1002830053 102
40 3300005548 Ga0070665_101256820 Ga0070665_1012568202 102
41 3300005577 Ga0068857_100477244 Ga0068857_1004772442 102
42 3300005578 Ga0068854_100402915 Ga0068854_1004029152 102
43 3300005614 Ga0068856_100256293 Ga0068856_1002562934 102
44 3300005614 Ga0068856_101045673 Ga0068856_1010456732 102
45 3300005616 Ga0068852_101817802 Ga0068852_1018178021 102
46 3300005617 Ga0068859_100054325 Ga0068859_1000543252 102
47 3300005841 Ga0068863_100056430 Ga0068863_1000564302 102
48 3300005841 Ga0068863_100824796 Ga0068863_1008247962 102
49 3300005842 Ga0068858_100008510 Ga0068858_1000085104 102
50 3300005843 Ga0068860_100002304 Ga0068860_10000230414 102
51 3300006028 Ga0070717_10038985 Ga0070717_100389853 102
52 3300006042 Ga0075368_10139296 Ga0075368_101392963 102
53 3300006042 Ga0075368_10451960 Ga0075368_104519602 102
54 3300006048 Ga0075363_100021219 Ga0075363_1000212191 102
55 3300006048 Ga0075363_100616581 Ga0075363_1006165812 102
56 3300006058 Ga0075432_10009742 Ga0075432_100097422 102
57 3300006175 Ga0070712_100094515 Ga0070712_1000945152 102
58 3300006175 Ga0070712_100667153 Ga0070712_1006671532 102
59 3300006178 Ga0075367_10300402 Ga0075367_103004021 102
60 3300006178 Ga0075367_10383521 Ga0075367_103835212 102
61 3300006178 Ga0075367_10686974 Ga0075367_106869742 102
62 3300006186 Ga0075369_10011241 Ga0075369_100112416 102
63 3300006186 Ga0075369_10144504 Ga0075369_101445041 102
64 3300006195 Ga0075366_10063728 Ga0075366_100637284 102
65 3300006195 Ga0075366_10879281 Ga0075366_108792811 102
66 3300006353 Ga0075370_10011563 Ga0075370_100115634 102
67 3300006353 Ga0075370_10107453 Ga0075370_101074533 102
68 3300006358 Ga0068871_100425984 Ga0068871_1004259842 102
69 3300006931 Ga0097620_100054324 Ga0097620_1000543242 102
70 3300006931 Ga0097620_101044538 Ga0097620_1010445382 102
71 3300006948 Ga0099826_10000134 Ga0099826_1000013416 102
72 3300009093 Ga0105240_10079130 Ga0105240_100791304 102
73 3300009094 Ga0111539_10186468 Ga0111539_101864682 102
74 3300009098 Ga0105245_11328731 Ga0105245_113287312 102
75 3300009101 Ga0105247_10008481 Ga0105247_100084814 102
76 3300009174 Ga0105241_10283649 Ga0105241_102836492 102
77 3300009174 Ga0105241_10317764 Ga0105241_103177642 102
78 3300009176 Ga0105242_10019659 Ga0105242_100196595 102
79 3300009177 Ga0105248_11957650 Ga0105248_119576502 102
80 3300009545 Ga0105237_10139623 Ga0105237_101396233 102
81 3300009551 Ga0105238_10124595 Ga0105238_101245953 102
82 3300009551 Ga0105238_10848094 Ga0105238_108480942 102
83 3300010375 Ga0105239_10168315 Ga0105239_101683152 102
84 3300010375 Ga0105239_12259355 Ga0105239_122593551 102
85 3300013296 Ga0157374_11900066 Ga0157374_119000662 102
86 3300014325 Ga0163163_11054577 Ga0163163_110545772 102
87 3300014326 Ga0157380_10281397 Ga0157380_102813972 102
88 3300014497 Ga0182008_10000316 Ga0182008_100003164 102
89 3300014969 Ga0157376_10907035 Ga0157376_109070352 102
90 3300017792 Ga0163161_10006196 Ga0163161_100061965 102
91 3300020082 Ga0206353_11539362 Ga0206353_115393625 102
92 3300021384 Ga0213876_10000204 Ga0213876_1000020436 102
93 3300025263 Ga0209565_1000042 Ga0209565_1000042116 102
94 3300025273 Ga0209673_1000071 Ga0209673_1000071112 102
95 3300025291 Ga0209675_1000041 Ga0209675_1000041111 102
96 3300025292 Ga0209676_1071879 Ga0209676_10718791 102
97 3300025294 Ga0209025_1009189 Ga0209025_10091897 102
98 3300025299 Ga0209256_1008310 Ga0209256_10083102 102
99 3300025900 Ga0207710_10011257 Ga0207710_100112574 102
100 3300025903 Ga0207680_10123861 Ga0207680_101238612 102
101 3300025904 Ga0207647_10176632 Ga0207647_101766322 102
102 3300025906 Ga0207699_10076752 Ga0207699_100767522 102
103 3300025911 Ga0207654_10751299 Ga0207654_107512992 102
104 3300025912 Ga0207707_10616230 Ga0207707_106162303 102
105 3300025913 Ga0207695_10149799 Ga0207695_101497991 102
106 3300025914 Ga0207671_10271993 Ga0207671_102719932 102
107 3300025915 Ga0207693_10196031 Ga0207693_101960312 102
108 3300025915 Ga0207693_10265915 Ga0207693_102659152 102
109 3300025916 Ga0207663_10013251 Ga0207663_100132516 102
110 3300025924 Ga0207694_10394516 Ga0207694_103945162 102
111 3300025925 Ga0207650_10454093 Ga0207650_104540932 102
112 3300025928 Ga0207700_10038520 Ga0207700_100385202 102
113 3300025928 Ga0207700_10717380 Ga0207700_107173802 102
114 3300025929 Ga0207664_10953368 Ga0207664_109533682 102
115 3300025933 Ga0207706_10092280 Ga0207706_100922802 102
116 3300025934 Ga0207686_10080006 Ga0207686_100800062 102
117 3300025939 Ga0207665_10061192 Ga0207665_100611922 102
118 3300025949 Ga0207667_10405689 Ga0207667_104056892 102
119 3300025961 Ga0207712_11555508 Ga0207712_115555081 102
120 3300025986 Ga0207658_10037500 Ga0207658_100375003 102
121 3300025986 Ga0207658_11486955 Ga0207658_114869551 102
122 3300026035 Ga0207703_10005459 Ga0207703_100054596 102
123 3300026041 Ga0207639_10170051 Ga0207639_101700513 102
124 3300026067 Ga0207678_10032172 Ga0207678_100321726 102
125 3300026078 Ga0207702_10051708 Ga0207702_100517083 102
126 3300026088 Ga0207641_10000083 Ga0207641_1000008348 102
127 3300026116 Ga0207674_10472329 Ga0207674_104723292 102
128 3300026121 Ga0207683_10437764 Ga0207683_104377641 102
129 3300026142 Ga0207698_10347768 Ga0207698_103477682 102
130 3300027666 Ga0209282_1000514 Ga0209282_10005148 102
131 3300027866 Ga0209813_10111708 Ga0209813_101117082 102
132 3300028381 Ga0268264_10000122 Ga0268264_10000122146 102
133 3300028800 Ga0265338_10064096 Ga0265338_100640962 102
134 3300028800 Ga0265338_10717389 Ga0265338_107173892 102
135 3300031235 Ga0265330_10340988 Ga0265330_103409881 102
136 3300031238 Ga0265332_10445172 Ga0265332_104451722 102
137 3300031241 Ga0265325_10000030 Ga0265325_1000003074 102
138 3300031241 Ga0265325_10034241 Ga0265325_100342412 102
139 3300031249 Ga0265339_10196496 Ga0265339_101964962 102
140 3300031251 Ga0265327_10004610 Ga0265327_100046107 102
141 3300031548 Ga0307408_101302507 Ga0307408_1013025072 102
142 3300031595 Ga0265313_10017739 Ga0265313_100177393 102
143 3300031711 Ga0265314_10005259 Ga0265314_1000525911 102
144 3300031711 Ga0265314_10044559 Ga0265314_100445592 102
145 3300031711 Ga0265314_10482674 Ga0265314_104826742 102
146 3300031824 Ga0307413_11019049 Ga0307413_110190492 102
147 3300031911 Ga0307412_10194026 Ga0307412_101940262 102
148 3300033180 Ga0307510_10000013 Ga0307510_1000001336 102
149 3300035083 Ga0373926_0007868 Ga0373926_0007868_2880_3188 102
150 3300035086 Ga0373934_0062626 Ga0373934_0062626_873_1181 102
151 3300035113 Ga0373936_0118724 Ga0373936_0118724_574_882 102
152 3300035113 Ga0373936_0187510 Ga0373936_0187510_509_817 102
153 3300035117 Ga0373953_0022621 Ga0373953_0022621_1600_1908 102
154 3300035118 Ga0373954_0357257 Ga0373954_0357257_214_522 102
155 3300035119 Ga0373956_0029322 Ga0373956_0029322_1730_2038 102
156 3300035119 Ga0373956_0141694 Ga0373956_0141694_374_682 102
157 3300035120 Ga0373957_0106914 Ga0373957_0106914_652_960 102
158 3300035170 Ga0373943_0000764 Ga0373943_0000764_13041_13349 102
159 3300035170 Ga0373943_0748852 Ga0373943_0748852_259_567 102
160 3300035171 Ga0373946_0020709 Ga0373946_0020709_542_850 102
161 3300035172 Ga0373955_0003514 Ga0373955_0003514_5667_5975 102
162 3300035692 Ga0373935_0132432 Ga0373935_0132432_524_832 102
163 3300035692 Ga0373935_0310608 Ga0373935_0310608_734_1042 102
164 3300035692 Ga0373935_0946118 Ga0373935_0946118_295_603 102
165 3300035695 Ga0373927_0196140 Ga0373927_0196140_961_1269 102
166 3300035695 Ga0373927_0735171 Ga0373927_0735171_190_498 102
167 3300035724 Ga0373933_0012375 Ga0373933_0012375_3910_4218 102
168 3300035724 Ga0373933_1168003 Ga0373933_1168003_161_469 102
169 3300035725 Ga0373947_0028591 Ga0373947_0028591_1012_1320 102
170 3300035725 Ga0373947_0030247 Ga0373947_0030247_151_459 102
171 3300036401 Ga0373937_0008716 Ga0373937_0008716_5250_5558 102
172 3300036401 Ga0373937_0022521 Ga0373937_0022521_2479_2787 102
173 3300036401 Ga0373937_0175576 Ga0373937_0175576_1570_1878 102
174 3300036401 Ga0373937_0685647 Ga0373937_0685647_414_722 102
175 3300037068 Ga0373925_0002172 Ga0373925_0002172_14631_14939 102
176 3300037068 Ga0373925_0038515 Ga0373925_0038515_31_339 102
177 3300037312 Ga0395899_0000004 Ga0395899_0000004_774193_774528 102
178 3300039437 Ga0436365_0902712 Ga0436365_0902712_16535_16843 102
179 3300039447 Ga0436361_0709558 Ga0436361_0709558_2157_2465 102
180 3300041498 Ga0451841_0671770 Ga0451841_0671770_1053_1367 102
181 3300041509 Ga0451843_0192486 Ga0451843_0192486_45_359 102
182 3300042461 Ga0439460_0111452 Ga0439460_0111452_432_740 102
183 3300046454 Ga0495592_0003543 Ga0495592_0003543_5735_6043 102
184 3300046454 Ga0495592_0081935 Ga0495592_0081935_1119_1427 102
185 3300046462 Ga0495651_0003380 Ga0495651_0003380_6583_6891 102
186 3300046463 Ga0495653_0344159 Ga0495653_0344159_437_745 102
187 3300046472 Ga0495580_0525609 Ga0495580_0525609_141_449 102
188 3300046511 Ga0495608_0088390 Ga0495608_0088390_741_1049 102
189 3300046514 Ga0495618_0067653 Ga0495618_0067653_751_1059 102
190 3300046516 Ga0495628_0009916 Ga0495628_0009916_5791_6099 102
191 3300046516 Ga0495628_0305757 Ga0495628_0305757_222_530 102
192 3300046517 Ga0495630_0510830 Ga0495630_0510830_202_510 102
193 3300046519 Ga0495632_0146598 Ga0495632_0146598_92_415 102
194 3300046519 Ga0495632_0396780 Ga0495632_0396780_220_531 102
195 3300046533 Ga0495640_0127262 Ga0495640_0127262_1144_1452 102
196 3300046533 Ga0495640_0182347 Ga0495640_0182347_1015_1323 102
197 3300046536 Ga0495587_0006045 Ga0495587_0006045_6243_6551 102
198 3300046543 Ga0495645_0007968 Ga0495645_0007968_1824_2132 102
199 3300046559 Ga0495667_0010344 Ga0495667_0010344_4426_4734 102
200 3300046559 Ga0495667_0150833 Ga0495667_0150833_949_1257 102
201 3300046660 Ga0495625_0604660 Ga0495625_0604660_162_470 102
202 3300046663 Ga0495635_0024350 Ga0495635_0024350_1886_2194 102
203 3300046663 Ga0495635_0040933 Ga0495635_0040933_268_576 102
204 3300046675 Ga0495657_0027902 Ga0495657_0027902_2894_3202 102
205 3300046678 Ga0495599_0048893 Ga0495599_0048893_1385_1693 102
206 3300046679 Ga0495623_0012615 Ga0495623_0012615_1442_1750 102
207 3300046680 Ga0495646_0236915 Ga0495646_0236915_119_427 102
208 3300046680 Ga0495646_0377630 Ga0495646_0377630_301_609 102
209 3300046681 Ga0495647_0451189 Ga0495647_0451189_77_385 102
210 3300046683 Ga0495658_0225820 Ga0495658_0225820_189_497 102
211 3300046690 Ga0495624_0191212 Ga0495624_0191212_271_579 102
212 3300046694 Ga0495649_0570063 Ga0495649_0570063_190_501 102
213 3300046809 Ga0495600_0007504 Ga0495600_0007504_1384_1692 102
214 3300046809 Ga0495600_0311970 Ga0495600_0311970_114_422 102
215 3300047317 Ga0495604_0037126 Ga0495604_0037126_2488_2796 102
216 3300047319 Ga0495674_0013179 Ga0495674_0013179_4467_4775 102
217 3300047319 Ga0495674_0064407 Ga0495674_0064407_2104_2412 102
218 3300047319 Ga0495674_0159603 Ga0495674_0159603_342_650 102
219 3300047320 Ga0495672_0005420 Ga0495672_0005420_7128_7436 102
220 3300047320 Ga0495672_0258657 Ga0495672_0258657_299_607 102
221 3300047322 Ga0495680_0005585 Ga0495680_0005585_4747_5055 102
222 3300047322 Ga0495680_0018422 Ga0495680_0018422_4908_5216 102
223 3300047444 Ga0495675_0063043 Ga0495675_0063043_1323_1631 102
224 3300047471 Ga0495684_0288487 Ga0495684_0288487_436_744 102
225 3300048088 Ga0495602_0006367 Ga0495602_0006367_5248_5556 102
226 3300048088 Ga0495602_0549218 Ga0495602_0549218_394_702 102
227 3300048905 Ga0496102_0029228 Ga0496102_0029228_2980_3291 102
228 3300048905 Ga0496102_0285021 Ga0496102_0285021_194_502 102
229 3300048905 Ga0496102_0730916 Ga0496102_0730916_312_635 102
230 3300048907 Ga0496104_0000065 Ga0496104_0000065_47279_47587 102
231 3300048908 Ga0496105_0000338 Ga0496105_0000338_18142_18450 102
232 3300048917 Ga0496114_0023768 Ga0496114_0023768_2620_2928 102
233 3300048918 Ga0496115_0505239 Ga0496115_0505239_510_821 102
234 3300048920 Ga0496117_0000220 Ga0496117_0000220_7773_8084 102
235 3300048921 Ga0496118_0000028 Ga0496118_0000028_264191_264502 102
236 3300048921 Ga0496118_0285374 Ga0496118_0285374_352_660 102
237 3300048921 Ga0496118_0491469 Ga0496118_0491469_50_373 102
238 3300048922 Ga0496119_0013406 Ga0496119_0013406_2915_3226 102
239 3300048922 Ga0496119_0016237 Ga0496119_0016237_1225_1536 102
240 3300048922 Ga0496119_0056806 Ga0496119_0056806_514_825 102
241 3300048923 Ga0496120_0000115 Ga0496120_0000115_128915_129226 102
242 3300048923 Ga0496120_0005063 Ga0496120_0005063_8698_9009 102
243 3300048924 Ga0496121_0023909 Ga0496121_0023909_3203_3514 102
244 3300048926 Ga0496123_0195695 Ga0496123_0195695_405_719 102
245 3300048927 Ga0496124_0011508 Ga0496124_0011508_5722_6033 102
246 3300048927 Ga0496124_0136436 Ga0496124_0136436_1397_1711 102
247 3300048928 Ga0496125_0002893 Ga0496125_0002893_14823_15146 102
248 3300048928 Ga0496125_0010340 Ga0496125_0010340_2584_2895 102
249 3300048928 Ga0496125_0132307 Ga0496125_0132307_31_342 102
250 3300048928 Ga0496125_0458426 Ga0496125_0458426_162_476 102
251 3300048929 Ga0496126_0035400 Ga0496126_0035400_1319_1630 102
252 3300049459 Ga0495678_059003 Ga0495678_059003_32_346 102
253 3300049583 Ga0501067_0200971 Ga0501067_0200971_185_493 102
254 3300049686 Ga0501257_004731 Ga0501257_004731_2614_2922 102
255 3300049744 Ga0501083_0467085 Ga0501083_0467085_108_416 102
256 3300050490 nmdc:mga03n38_132591_c1 nmdc:mga03n38_132591_c1_642_950 102
257 3300050491 nmdc:mga00v17_993235_c1 nmdc:mga00v17_993235_c1_60_368 102
258 3300050492 nmdc:mga0yw44_130479_c1 nmdc:mga0yw44_130479_c1_197_505 102
259 3300050493 nmdc:mga0k408_724714_c1 nmdc:mga0k408_724714_c1_177_485 102
260 3300050493 nmdc:mga0k408_839065_c1 nmdc:mga0k408_839065_c1_64_372 102
261 3300050494 nmdc:mga06z11_220768_c1 nmdc:mga06z11_220768_c1_45_353 102
262 3300050495 nmdc:mga04h51_131216_c1 nmdc:mga04h51_131216_c1_30_338 102
263 3300050495 nmdc:mga04h51_277742_c1 nmdc:mga04h51_277742_c1_310_618 102
264 3300050496 nmdc:mga07m45_90623_c1 nmdc:mga07m45_90623_c1_29_337 102
265 3300050511 nmdc:mga08y16_153998_c1 nmdc:mga08y16_153998_c1_564_875 102
266 3300050516 nmdc:mga0sz30_565764_c1 nmdc:mga0sz30_565764_c1_25_333 102
267 3300050516 nmdc:mga0sz30_579408_c1 nmdc:mga0sz30_579408_c1_91_399 102
268 3300053077 Ga0495601_0000111 Ga0495601_0000111_11234_11542 102
269 3300053077 Ga0495601_0000347 Ga0495601_0000347_1893_2201 102
270 3300053078 Ga0495612_0002231 Ga0495612_0002231_531_839 102
271 3300053078 Ga0495612_0088604 Ga0495612_0088604_574_882 102
272 3300053084 Ga0495595_0000587 Ga0495595_0000587_12050_12358 102
273 3300053085 Ga0495619_0000083 Ga0495619_0000083_22159_22467 102
274 3300053085 Ga0495619_0000296 Ga0495619_0000296_16874_17182 102
275 3300053090 Ga0500646_0033855 Ga0500646_0033855_216_524 102
276 3300053130 Ga0500642_0178048 Ga0500642_0178048_46_354 102
277 3300053134 Ga0500658_0008537 Ga0500658_0008537_2177_2485 102
278 3300053134 Ga0500658_0523721 Ga0500658_0523721_198_506 102
279 3300053136 Ga0500559_0086209 Ga0500559_0086209_1032_1340 102
280 3300053139 Ga0500568_0001046 Ga0500568_0001046_15094_15402 102
281 3300053146 Ga0500588_0001208 Ga0500588_0001208_1754_2062 102
282 3300053153 Ga0500616_0174174 Ga0500616_0174174_224_532 102
283 3300053727 Ga0500611_078349 Ga0500611_078349_402_710 102
284 3300053735 Ga0500596_019187 Ga0500596_019187_496_804 102
285 3300054114 Ga0501084_0001152 Ga0501084_0001152_7566_7874 102
286 3300003792 Ga0055540_1011063 Ga0055540_10110633 103
287 3300009148 Ga0105243_10048256 Ga0105243_100482562 103
288 3300025303 Ga0209051_1000362 Ga0209051_100036210 103
289 3300025935 Ga0207709_10033247 Ga0207709_100332473 103
290 3300035691 Ga0373931_0003342 Ga0373931_0003342_2384_2695 103
291 3300037466 Ga0395898_0282317 Ga0395898_0282317_193_504 103
292 3300038443 Ga0395901_0323176 Ga0395901_0323176_710_1021 103
293 3300046492 Ga0495585_0018219 Ga0495585_0018219_3016_3327 103
294 3300046507 Ga0495606_0161628 Ga0495606_0161628_615_926 103
295 3300046616 Ga0495668_0805860 Ga0495668_0805860_82_393 103
296 3300061719 Ga0466962_0223320 Ga0466962_0223320_63_380 103
297 3300001979 JGI24740J21852_10007306 JGI24740J21852_100073066 104
298 3300001990 JGI24737J22298_10007751 JGI24737J22298_100077515 104
299 3300001990 JGI24737J22298_10028312 JGI24737J22298_100283122 104
300 3300002067 JGI24735J21928_10023587 JGI24735J21928_100235873 104
301 3300002067 JGI24735J21928_10027670 JGI24735J21928_100276704 104
302 3300002773 JGI25152J39213_1035790 JGI25152J39213_10357901 104
303 3300003215 JGI25153J46596_10029618 JGI25153J46596_100296183 104
304 3300003578 Ga0006562J51391_1035571 Ga0006562J51391_10355715 104
305 3300003578 Ga0006562J51391_1035572 Ga0006562J51391_10355721 104
306 3300005439 Ga0070711_101202605 Ga0070711_1012026052 104
307 3300005457 Ga0070662_100417209 Ga0070662_1004172094 104
308 3300005563 Ga0068855_100021479 Ga0068855_1000214792 104
309 3300005563 Ga0068855_100105642 Ga0068855_1001056422 104
310 3300005563 Ga0068855_101082137 Ga0068855_1010821372 104
311 3300005577 Ga0068857_100017669 Ga0068857_1000176695 104
312 3300005578 Ga0068854_100002904 Ga0068854_1000029046 104
313 3300005578 Ga0068854_100064785 Ga0068854_1000647852 104
314 3300005834 Ga0068851_10005429 Ga0068851_100054296 104
315 3300009093 Ga0105240_10026393 Ga0105240_100263932 104
316 3300009093 Ga0105240_10069186 Ga0105240_100691866 104
317 3300009093 Ga0105240_10614756 Ga0105240_106147562 104
318 3300009545 Ga0105237_10000543 Ga0105237_1000054341 104
319 3300010159 Ga0099796_10008085 Ga0099796_100080852 104
320 3300010375 Ga0105239_10042866 Ga0105239_100428662 104
321 3300012498 Ga0157345_1046538 Ga0157345_10465381 104
322 3300013105 Ga0157369_10251054 Ga0157369_102510543 104
323 3300013105 Ga0157369_10263466 Ga0157369_102634663 104
324 3300013307 Ga0157372_11055911 Ga0157372_110559112 104
325 3300015265 Ga0182005_1159258 Ga0182005_11592582 104
326 3300020070 Ga0206356_11611485 Ga0206356_116114852 104
327 3300020082 Ga0206353_12036297 Ga0206353_120362972 104
328 3300025258 Ga0209129_1001261 Ga0209129_100126115 104
329 3300025294 Ga0209025_1160709 Ga0209025_11607091 104
330 3300025297 Ga0209758_1000644 Ga0209758_100064428 104
331 3300025321 Ga0207656_10149694 Ga0207656_101496942 104
332 3300025904 Ga0207647_10009507 Ga0207647_100095072 104
333 3300025904 Ga0207647_10089072 Ga0207647_100890722 104
334 3300025906 Ga0207699_10733008 Ga0207699_107330082 104
335 3300025912 Ga0207707_10220105 Ga0207707_102201052 104
336 3300025913 Ga0207695_10009427 Ga0207695_100094277 104
337 3300025913 Ga0207695_10019726 Ga0207695_100197262 104
338 3300025913 Ga0207695_10230114 Ga0207695_102301143 104
339 3300025914 Ga0207671_10000038 Ga0207671_1000003861 104
340 3300025916 Ga0207663_10521233 Ga0207663_105212333 104
341 3300025928 Ga0207700_10103646 Ga0207700_101036463 104
342 3300025949 Ga0207667_10000693 Ga0207667_100006938 104
343 3300025949 Ga0207667_10008397 Ga0207667_100083973 104
344 3300025981 Ga0207640_10003374 Ga0207640_1000337410 104
345 3300025981 Ga0207640_10040992 Ga0207640_100409923 104
346 3300026035 Ga0207703_10218592 Ga0207703_102185922 104
347 3300026067 Ga0207678_10312627 Ga0207678_103126271 104
348 3300026142 Ga0207698_12226326 Ga0207698_122263261 104
349 3300027512 Ga0209179_1002470 Ga0209179_10024702 104
350 3300048928 Ga0496125_0000348 Ga0496125_0000348_39761_40075 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

43

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9047 1 102
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8964 1 102
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.7757 3 84
6tbm-assembly1.cif.gz_Q structure of saga bound to tbp, including spt8 and dub 0.7626 18 84
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.7578 5 86
ID Description Score Start End Superfamily
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.932 33 85 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.911 33 85 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8993 1 87 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8803 1 87 3.30.40.10
af_Q0J492_27_131_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8676 33 87 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A529SVC8-F1-model_v4 UBP-type domain-containing protein 0.9894 33 102 GO:0008270
AF-A0A4V2SXT5-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9781 32 102 GO:0008270
GO:0016787
AF-A0A529SVC8-F1-model_v4 UBP-type domain-containing protein 0.9756 33 102 GO:0008270
AF-A0A536AU09-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9713 36 87 GO:0008270
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9654 32 85 GO:0008270
GO:0016787

Feature Viewer

pLDDT pTM Quality
82.51 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map