F418203

General Info

Members Datasets Scaffolds Average Seq Length
350 148 700 124

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100142662|Ga0075434_1001426623
Length 146
Sequence MARVTKPCARAAPPTSRGGLAAPATKINIQIFGFKDCQDTRKAQRFFAERRIAVHFVDLDERPAARGELRRFAERFGPAALIDKEGARFKALGLRVAGDSPQRLLDRALTEPRLLRTPLVRNGGKVTVGHAAEEWQDWIAAEKRPP

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
83 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
84 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
85 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 98.29
Stem 0
Stem Tuber 0
Unclassified 10.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100142662 3300006871 Bacteria 2415
2 Ga0070680_100064001 3300005336 Bacteria 3014
3 Ga0068868_101610474 3300005338 Unclassified 610
4 Ga0070692_10481110 3300005345 Bacteria 801
5 Ga0070668_100085385 3300005347 Bacteria 2481
6 Ga0070668_101880957 3300005347 Bacteria 551
7 Ga0070669_100002243 3300005353 Bacteria 14008
8 Ga0070671_100688406 3300005355 Bacteria 886
9 Ga0070673_101495593 3300005364 Unclassified 637
10 Ga0070659_100789726 3300005366 Bacteria 825
11 Ga0070703_10190911 3300005406 Bacteria 798
12 Ga0070705_100010740 3300005440 Bacteria 4595
13 Ga0070700_100360288 3300005441 Bacteria 1081
14 Ga0070694_100009544 3300005444 Bacteria 5953
15 Ga0070708_100146706 3300005445 Unclassified 2192
16 Ga0070708_100254992 3300005445 Bacteria 1648
17 Ga0070708_101424898 3300005445 Bacteria 646
18 Ga0070681_10303225 3300005458 Bacteria 1507
19 Ga0068867_100110445 3300005459 Bacteria 2112
20 Ga0070706_100241588 3300005467 Bacteria 1686
21 Ga0070706_100351178 3300005467 Bacteria 1374
22 Ga0070707_100033126 3300005468 Bacteria 4926
23 Ga0070707_100552635 3300005468 Unclassified 1113
24 Ga0070698_100051083 3300005471 Bacteria 4212
25 Ga0070698_100438300 3300005471 Bacteria 1242
26 Ga0070699_100002834 3300005518 Bacteria 15470
27 Ga0070699_100011942 3300005518 Bacteria 7497
28 Ga0070699_100024692 3300005518 Bacteria 5181
29 Ga0070699_100314147 3300005518 Bacteria 1407
30 Ga0070697_100045353 3300005536 Unclassified 3563
31 Ga0070697_100051423 3300005536 Bacteria 3347
32 Ga0070697_100174297 3300005536 Bacteria 1821
33 Ga0070697_100523788 3300005536 Bacteria 1038
34 Ga0070672_100032026 3300005543 Bacteria 3964
35 Ga0070696_100034666 3300005546 Bacteria 3473
36 Ga0070696_100036300 3300005546 Bacteria 3398
37 Ga0070696_100236977 3300005546 Bacteria 1375
38 Ga0070696_100249760 3300005546 Bacteria 1341
39 Ga0070704_100045748 3300005549 Bacteria 3047
40 Ga0068854_101371541 3300005578 Unclassified 638
41 Ga0068859_100976461 3300005617 Bacteria 930
42 Ga0068866_10691240 3300005718 Unclassified 699
43 Ga0068858_100455098 3300005842 Bacteria 1234
44 Ga0068860_100039020 3300005843 Bacteria 4543
45 Ga0068860_100349495 3300005843 Bacteria 1455
46 Ga0068862_101347006 3300005844 Bacteria 716
47 Ga0068862_101760077 3300005844 Bacteria 628
48 Ga0075428_100000499 3300006844 Bacteria 39815
49 Ga0075428_100022701 3300006844 Bacteria 6945
50 Ga0075428_100025851 3300006844 Bacteria 6501
51 Ga0075428_100038734 3300006844 Bacteria 5246
52 Ga0075428_100237472 3300006844 Bacteria 1967
53 Ga0075428_100608556 3300006844 Unclassified 1167
54 Ga0075428_100970641 3300006844 Bacteria 900
55 Ga0075430_100000005 3300006846 Bacteria 108528
56 Ga0075430_100000053 3300006846 Bacteria 60652
57 Ga0075430_100000560 3300006846 Bacteria 28229
58 Ga0075430_100101173 3300006846 Bacteria 2407
59 Ga0075430_100106509 3300006846 Bacteria 2339
60 Ga0075430_100327986 3300006846 Unclassified 1265
61 Ga0075431_100000087 3300006847 Bacteria 56140
62 Ga0075431_100000823 3300006847 Bacteria 27067
63 Ga0075431_100002327 3300006847 Bacteria 18259
64 Ga0075431_100039349 3300006847 Bacteria 4871
65 Ga0075431_100103000 3300006847 Bacteria 2946
66 Ga0075431_100111147 3300006847 Bacteria 2828
67 Ga0075431_100564179 3300006847 Bacteria 1125
68 Ga0075431_100943117 3300006847 Bacteria 831
69 Ga0075433_10001903 3300006852 Bacteria 15703
70 Ga0075433_10012511 3300006852 Bacteria 6861
71 Ga0075433_10063420 3300006852 Bacteria 3237
72 Ga0075433_10099199 3300006852 Bacteria 2578
73 Ga0075433_10202129 3300006852 Bacteria 1766
74 Ga0075433_10357295 3300006852 Bacteria 1291
75 Ga0075433_10403941 3300006852 Bacteria 1205
76 Ga0075434_100002682 3300006871 Bacteria 15713
77 Ga0075434_100032943 3300006871 Bacteria 5111
78 Ga0075434_100085830 3300006871 Bacteria 3147
79 Ga0075434_100094461 3300006871 Bacteria 2995
80 Ga0075434_100134758 3300006871 Bacteria 2489
81 Ga0075434_100183697 3300006871 Bacteria 2112
82 Ga0075429_100000077 3300006880 Bacteria 49812
83 Ga0075429_100010369 3300006880 Bacteria 8064
84 Ga0075429_100013931 3300006880 Bacteria 6969
85 Ga0075429_100032502 3300006880 Bacteria 4535
86 Ga0075429_100063533 3300006880 Bacteria 3216
87 Ga0075429_100103624 3300006880 Bacteria 2485
88 Ga0075429_100335082 3300006880 Bacteria 1324
89 Ga0075436_100001664 3300006914 Bacteria 15178
90 Ga0075436_100123265 3300006914 Bacteria 1815
91 Ga0075436_100285756 3300006914 Bacteria 1180
92 Ga0075436_100595661 3300006914 Bacteria 814
93 Ga0097620_100976432 3300006931 Bacteria 930
94 Ga0075435_100006269 3300007076 Bacteria 8394
95 Ga0075435_100007906 3300007076 Bacteria 7611
96 Ga0075435_100015271 3300007076 Bacteria 5769
97 Ga0075435_100015533 3300007076 Bacteria 5726
98 Ga0075435_100028637 3300007076 Bacteria 4369
99 Ga0075435_100480098 3300007076 Bacteria 1073
100 Ga0111539_10000225 3300009094 Bacteria 67615
101 Ga0111539_10032641 3300009094 Bacteria 6321
102 Ga0111539_10039245 3300009094 Bacteria 5708
103 Ga0111539_10388091 3300009094 Bacteria 1626
104 Ga0111539_10781228 3300009094 Bacteria 1111
105 Ga0114129_10002277 3300009147 Bacteria 26562
106 Ga0114129_10003534 3300009147 Bacteria 21989
107 Ga0114129_10011754 3300009147 Bacteria 12459
108 Ga0114129_10012729 3300009147 Bacteria 11975
109 Ga0114129_10024504 3300009147 Bacteria 8550
110 Ga0114129_10028042 3300009147 Bacteria 7976
111 Ga0114129_10037378 3300009147 Bacteria 6855
112 Ga0114129_10053417 3300009147 Bacteria 5666
113 Ga0114129_10141374 3300009147 Bacteria 3299
114 Ga0114129_10157128 3300009147 Bacteria 3109
115 Ga0114129_10399723 3300009147 Bacteria 1811
116 Ga0114129_10522357 3300009147 Bacteria 1547
117 Ga0114129_12057260 3300009147 Unclassified 690
118 Ga0105241_10022228 3300009174 Bacteria 4696
119 Ga0105242_10328319 3300009176 Bacteria 1406
120 Ga0105237_12195001 3300009545 Unclassified 562
121 Ga0105249_10135335 3300009553 Bacteria 2357
122 Ga0105249_10986801 3300009553 Bacteria 911
123 Ga0157373_10146609 3300013100 Bacteria 1660
124 Ga0157378_11116663 3300013297 Bacteria 826
125 Ga0163162_10012981 3300013306 Bacteria 8128
126 Ga0163162_11012469 3300013306 Unclassified 939
127 Ga0163162_11986587 3300013306 Bacteria 666
128 Ga0157375_10584827 3300013308 Bacteria 1276
129 Ga0157380_10806135 3300014326 Bacteria 956
130 Ga0157380_10869153 3300014326 Bacteria 925
131 Ga0157379_10845535 3300014968 Bacteria 866
132 Ga0163161_10981137 3300017792 Bacteria 720
133 Ga0207642_10317293 3300025899 Bacteria 909
134 Ga0207684_10059144 3300025910 Bacteria 3253
135 Ga0207684_10194962 3300025910 Bacteria 1747
136 Ga0207684_10929641 3300025910 Bacteria 730
137 Ga0207654_10021625 3300025911 Bacteria 3423
138 Ga0207707_10275103 3300025912 Bacteria 1459
139 Ga0207671_11316613 3300025914 Unclassified 562
140 Ga0207660_10048077 3300025917 Bacteria 3019
141 Ga0207646_10075522 3300025922 Bacteria 3011
142 Ga0207646_10284356 3300025922 Bacteria 1495
143 Ga0207681_10073779 3300025923 Bacteria 2388
144 Ga0207690_10521720 3300025932 Bacteria 963
145 Ga0207706_10079416 3300025933 Bacteria 2885
146 Ga0207691_10139320 3300025940 Bacteria 2138
147 Ga0207651_11493677 3300025960 Bacteria 609
148 Ga0207712_10084157 3300025961 Bacteria 2323
149 Ga0207712_10652892 3300025961 Bacteria 914
150 Ga0207668_10106002 3300025972 Bacteria 2099
151 Ga0207703_10355066 3300026035 Bacteria 1351
152 Ga0207708_10071326 3300026075 Bacteria 2661
153 Ga0207648_10140181 3300026089 Bacteria 2131
154 Ga0207648_10707602 3300026089 Bacteria 934
155 Ga0207674_10448100 3300026116 Bacteria 1248
156 Ga0207675_100025951 3300026118 Bacteria 5453
157 Ga0207428_10000035 3300027907 Bacteria 229100
158 Ga0207428_10007068 3300027907 Bacteria 10276
159 Ga0207428_10078129 3300027907 Bacteria 2590
160 Ga0268265_10636214 3300028380 Bacteria 1024
161 Ga0268265_11680788 3300028380 Bacteria 640
162 Ga0268264_10019799 3300028381 Bacteria 5498
163 Ga0307408_100042883 3300031548 Bacteria 3217
164 Ga0307408_100103070 3300031548 Bacteria 2177
165 Ga0307408_100228464 3300031548 Bacteria 1522
166 Ga0307408_100539700 3300031548 Bacteria 1027
167 Ga0307408_100638766 3300031548 Bacteria 950
168 Ga0307408_100645872 3300031548 Bacteria 945
169 Ga0307406_10867567 3300031901 Bacteria 766
170 Ga0307407_10295606 3300031903 Bacteria 1127
171 Ga0307412_10203784 3300031911 Bacteria 1504
172 Ga0307412_11424847 3300031911 Bacteria 628
173 Ga0307409_101316112 3300031995 Bacteria 748
174 Ga0307416_100077155 3300032002 Bacteria 2797
175 Ga0307416_100273217 3300032002 Bacteria 1661
176 Ga0307416_101705034 3300032002 Unclassified 735
177 Ga0307411_10694879 3300032005 Bacteria 885
178 Ga0307411_11268041 3300032005 Bacteria 670
179 Ga0307415_101640203 3300032126 Bacteria 619
180 Ga0373930_0159314 3300034816 Bacteria 570
181 Ga0373948_0003006 3300034817 Bacteria 2551
182 Ga0373950_0013231 3300034818 Bacteria 1373
183 Ga0373928_0245711 3300035084 Unclassified 531
184 Ga0373940_0011279 3300035088 Bacteria 2120
185 Ga0373940_0018336 3300035088 Bacteria 1755
186 Ga0373932_0116320 3300035112 Bacteria 887
187 Ga0373939_0117396 3300035114 Bacteria 934
188 Ga0373960_0157340 3300035121 Bacteria 780
189 Ga0373960_0158759 3300035121 Bacteria 777
190 Ga0373961_0056161 3300035241 Unclassified 1182
191 Ga0373962_0202599 3300035242 Bacteria 672
192 Ga0373931_0013229 3300035691 Bacteria 4015
193 Ga0373931_0083281 3300035691 Bacteria 1769
194 Ga0373931_0441462 3300035691 Bacteria 831
195 Ga0395899_0102921 3300037312 Bacteria 2060
196 Ga0395900_0000746 3300037418 Bacteria 43291
197 Ga0395898_0016840 3300037466 Bacteria 7466
198 Ga0395905_0754189 3300037471 Bacteria 876
199 Ga0395905_0849622 3300037471 Bacteria 816
200 Ga0451577_0627739 3300042876 Unclassified 975
201 Ga0451577_0996087 3300042876 Bacteria 753
202 Ga0451577_1070725 3300042876 Bacteria 722
203 Ga0453684_0648296 3300044712 Bacteria 1153
204 Ga0451576_0088771 3300045051 Bacteria 3215
205 Ga0451576_0142819 3300045051 Bacteria 2496
206 Ga0451576_0885241 3300045051 Bacteria 937
207 Ga0451576_1002944 3300045051 Bacteria 875
208 Ga0451576_1618252 3300045051 Unclassified 671
209 Ga0495603_0016712 3300046455 Bacteria 4438
210 Ga0495580_0003674 3300046472 Bacteria 13009
211 Ga0495580_0288574 3300046472 Bacteria 1119
212 Ga0495584_0164172 3300046491 Bacteria 1129
213 Ga0495642_0032529 3300046528 Bacteria 2093
214 Ga0495642_0141769 3300046528 Bacteria 1038
215 Ga0495598_0014806 3300046537 Bacteria 1957
216 Ga0495656_0021398 3300046615 Bacteria 2518
217 Ga0495659_0132344 3300046664 Bacteria 990
218 Ga0495659_0212261 3300046664 Unclassified 797
219 Ga0495669_0563522 3300046684 Bacteria 554
220 Ga0495670_0355920 3300046691 Bacteria 788
221 Ga0495636_0590710 3300047318 Bacteria 542
222 Ga0496101_0331842 3300048904 Bacteria 1194
223 Ga0496102_0007421 3300048905 Bacteria 9364
224 Ga0496103_0063228 3300048906 Bacteria 2305
225 Ga0496104_0944626 3300048907 Bacteria 767
226 Ga0496106_0373866 3300048909 Bacteria 1145
227 Ga0496107_0386939 3300048910 Bacteria 1040
228 Ga0501031_0327979 3300049568 Bacteria 991
229 Ga0501031_0538503 3300049568 Unclassified 752
230 Ga0501039_0190826 3300049575 Bacteria 1611
231 Ga0501040_0090589 3300049576 Bacteria 2126
232 Ga0501040_0297653 3300049576 Unclassified 1153
233 Ga0501040_0616655 3300049576 Bacteria 784
234 Ga0501042_0335597 3300049578 Bacteria 1093
235 Ga0501043_0247430 3300049579 Unclassified 1374
236 Ga0501043_0775543 3300049579 Bacteria 695
237 Ga0501046_0038186 3300049580 Bacteria 3856
238 Ga0501046_0471246 3300049580 Bacteria 902
239 Ga0501048_0191067 3300049582 Bacteria 1451
240 Ga0501048_0469951 3300049582 Unclassified 901
241 Ga0501069_0697931 3300049585 Unclassified 612
242 Ga0501071_0051956 3300049587 Bacteria 2955
243 Ga0501071_0152588 3300049587 Unclassified 1724
244 Ga0501071_0914983 3300049587 Unclassified 677
245 Ga0501071_1456514 3300049587 Bacteria 529
246 Ga0501072_0014807 3300049588 Bacteria 5981
247 Ga0501072_0062054 3300049588 Bacteria 2948
248 Ga0501075_0036944 3300049591 Bacteria 3646
249 Ga0501075_0163253 3300049591 Bacteria 1700
250 Ga0501075_0355816 3300049591 Bacteria 1116
251 Ga0501075_0678187 3300049591 Unclassified 785
252 Ga0501075_0710057 3300049591 Bacteria 766
253 Ga0501076_0009030 3300049592 Bacteria 7340
254 Ga0501076_0285644 3300049592 Bacteria 1352
255 Ga0501077_0145726 3300049593 Bacteria 1502
256 Ga0501077_0942696 3300049593 Bacteria 555
257 Ga0501079_0166800 3300049741 Bacteria 1717
258 Ga0501079_0944060 3300049741 Bacteria 679
259 Ga0501079_0946590 3300049741 Bacteria 678
260 Ga0501080_0921097 3300049742 Bacteria 761
261 Ga0501081_0137451 3300049743 Bacteria 1750
262 Ga0501081_0255109 3300049743 Bacteria 1281
263 Ga0501081_0439001 3300049743 Bacteria 969
264 Ga0501044_1146467 3300049823 Unclassified 646
265 Ga0501045_0042399 3300049824 Bacteria 3312
266 Ga0501045_0116128 3300049824 Bacteria 1986
267 Ga0501045_0173179 3300049824 Bacteria 1608
268 Ga0501045_0413893 3300049824 Unclassified 1003
269 nmdc:mga05p37_1007203_c1 3300050507 Unclassified 884
270 nmdc:mga05p37_239_c1 3300050507 Bacteria 56085
271 nmdc:mga05p37_27299_c1 3300050507 Bacteria 6951
272 nmdc:mga05p37_276511_c1 3300050507 Bacteria 2005
273 nmdc:mga05p37_28452_c1 3300050507 Bacteria 6814
274 nmdc:mga05p37_31846_c1 3300050507 Bacteria 6445
275 nmdc:mga05p37_34007_c1 3300050507 Bacteria 6244
276 nmdc:mga05p37_37841_c1 3300050507 Bacteria 5362
277 nmdc:mga05p37_382551_c1 3300050507 Bacteria 1649
278 nmdc:mga05p37_51500_c1 3300050507 Bacteria 5063
279 nmdc:mga05p37_684234_c1 3300050507 Bacteria 1143
280 nmdc:mga05p37_78246_c1 3300050507 Bacteria 4072
281 nmdc:mga09592_10964_c1 3300050508 Bacteria 7373
282 nmdc:mga09592_1108521_c1 3300050508 Bacteria 658
283 nmdc:mga09592_16148_c1 3300050508 Bacteria 6102
284 nmdc:mga09592_213128_c1 3300050508 Bacteria 1674
285 nmdc:mga09592_229060_c1 3300050508 Bacteria 1610
286 nmdc:mga09592_427_c1 3300050508 Bacteria 31032
287 nmdc:mga09592_61883_c1 3300050508 Bacteria 3166
288 nmdc:mga09592_7840_c1 3300050508 Bacteria 8680
289 nmdc:mga09592_79006_c1 3300050508 Bacteria 2800
290 nmdc:mga09592_991184_c1 3300050508 Unclassified 703
291 nmdc:mga0qj67_2186_c1 3300050509 Bacteria 13902
292 nmdc:mga0qj67_513163_c1 3300050509 Unclassified 963
293 nmdc:mga0qj67_525575_c1 3300050509 Bacteria 950
294 nmdc:mga0qj67_5601_c1 3300050509 Bacteria 9177
295 nmdc:mga0qj67_639_c1 3300050509 Bacteria 24147
296 nmdc:mga0qj67_91850_c1 3300050509 Bacteria 2440
297 nmdc:mga06r32_127994_c1 3300050510 Bacteria 2509
298 nmdc:mga06r32_229108_c1 3300050510 Bacteria 1846
299 nmdc:mga06r32_234_c1 3300050510 Bacteria 45187
300 nmdc:mga06r32_26146_c1 3300050510 Bacteria 5438
301 nmdc:mga06r32_315705_c1 3300050510 Unclassified 1548
302 nmdc:mga06r32_3181_c1 3300050510 Bacteria 14712
303 nmdc:mga06r32_451717_c1 3300050510 Unclassified 1265
304 nmdc:mga06r32_46112_c1 3300050510 Bacteria 4159
305 nmdc:mga06r32_677918_c1 3300050510 Bacteria 998
306 nmdc:mga06r32_915571_c1 3300050510 Bacteria 833
307 nmdc:mga08y16_1476_c1 3300050511 Bacteria 23611
308 nmdc:mga08y16_2622_c1 3300050511 Bacteria 18479
309 nmdc:mga08y16_305122_c1 3300050511 Bacteria 1640
310 nmdc:mga08y16_311469_c1 3300050511 Bacteria 1621
311 nmdc:mga08y16_74310_c1 3300050511 Bacteria 3542
312 nmdc:mga0n895_1153_c1 3300050512 Bacteria 19349
313 nmdc:mga0n895_22312_c1 3300050512 Bacteria 5935
314 nmdc:mga0n895_25996_c1 3300050512 Bacteria 5537
315 nmdc:mga0n895_465934_c1 3300050512 Bacteria 1275
316 nmdc:mga0n895_54265_c1 3300050512 Bacteria 3942
317 nmdc:mga0n895_760167_c1 3300050512 Bacteria 962
318 nmdc:mga0n895_8353_c1 3300050512 Bacteria 8961
319 nmdc:mga0n895_95862_c1 3300050512 Bacteria 2972
320 nmdc:mga0rr50_20553_c1 3300050513 Bacteria 4489
321 nmdc:mga0rr50_322833_c1 3300050513 Bacteria 1295
322 nmdc:mga0rr50_3735_c1 3300050513 Bacteria 8822
323 nmdc:mga0rr50_391613_c1 3300050513 Bacteria 1173
324 nmdc:mga0rr50_60436_c1 3300050513 Bacteria 2851
325 nmdc:mga0rr50_869044_c1 3300050513 Bacteria 769
326 nmdc:mga08x19_147680_c1 3300050514 Bacteria 1591
327 nmdc:mga08x19_203406_c1 3300050514 Bacteria 1358
328 nmdc:mga08x19_382_c1 3300050514 Bacteria 31074
329 nmdc:mga0a205_104387_c1 3300050515 Bacteria 2733
330 nmdc:mga0a205_129786_c1 3300050515 Bacteria 2421
331 nmdc:mga0a205_15238_c1 3300050515 Bacteria 7183
332 nmdc:mga0a205_178_c1 3300050515 Bacteria 43234
333 nmdc:mga0a205_4157_c1 3300050515 Bacteria 12968
334 nmdc:mga0a205_484533_c1 3300050515 Bacteria 1095
335 nmdc:mga0a205_48513_c1 3300050515 Bacteria 4098
336 nmdc:mga0a205_50933_c1 3300050515 Bacteria 3997
337 nmdc:mga0a205_52083_c1 3300050515 Bacteria 3951
338 nmdc:mga0a205_87632_c1 3300050515 Bacteria 3007
339 Ga0501084_0248796 3300054114 Bacteria 1501
340 Ga0501084_0458580 3300054114 Bacteria 1077
341 Ga0501084_1562242 3300054114 Bacteria 552
342 Ga0590071_016254 3300059421 Bacteria 1746
343 Ga0590074_086481 3300059423 Unclassified 602
344 Ga0590075_035488 3300059424 Bacteria 1271
345 Ga0501082_0112812 3300060353 Bacteria 2354
346 Ga0501082_0201257 3300060353 Unclassified 1733
347 Ga0501082_1120483 3300060353 Bacteria 688
348 Ga0530510_0343138 3300061734 Bacteria 1121
349 Ga0530510_0552885 3300061734 Bacteria 874
350 Ga0530510_0653093 3300061734 Unclassified 801
351 Ga0075434_100142662
352 Ga0070680_100064001
353 Ga0068868_101610474
354 Ga0070692_10481110
355 Ga0070668_100085385
356 Ga0070668_101880957
357 Ga0070669_100002243
358 Ga0070671_100688406
359 Ga0070673_101495593
360 Ga0070659_100789726
361 Ga0070703_10190911
362 Ga0070705_100010740
363 Ga0070700_100360288
364 Ga0070694_100009544
365 Ga0070708_100146706
366 Ga0070708_100254992
367 Ga0070708_101424898
368 Ga0070681_10303225
369 Ga0068867_100110445
370 Ga0070706_100241588
371 Ga0070706_100351178
372 Ga0070707_100033126
373 Ga0070707_100552635
374 Ga0070698_100051083
375 Ga0070698_100438300
376 Ga0070699_100002834
377 Ga0070699_100011942
378 Ga0070699_100024692
379 Ga0070699_100314147
380 Ga0070697_100045353
381 Ga0070697_100051423
382 Ga0070697_100174297
383 Ga0070697_100523788
384 Ga0070672_100032026
385 Ga0070696_100034666
386 Ga0070696_100036300
387 Ga0070696_100236977
388 Ga0070696_100249760
389 Ga0070704_100045748
390 Ga0068854_101371541
391 Ga0068859_100976461
392 Ga0068866_10691240
393 Ga0068858_100455098
394 Ga0068860_100039020
395 Ga0068860_100349495
396 Ga0068862_101347006
397 Ga0068862_101760077
398 Ga0075428_100000499
399 Ga0075428_100022701
400 Ga0075428_100025851
401 Ga0075428_100038734
402 Ga0075428_100237472
403 Ga0075428_100608556
404 Ga0075428_100970641
405 Ga0075430_100000005
406 Ga0075430_100000053
407 Ga0075430_100000560
408 Ga0075430_100101173
409 Ga0075430_100106509
410 Ga0075430_100327986
411 Ga0075431_100000087
412 Ga0075431_100000823
413 Ga0075431_100002327
414 Ga0075431_100039349
415 Ga0075431_100103000
416 Ga0075431_100111147
417 Ga0075431_100564179
418 Ga0075431_100943117
419 Ga0075433_10001903
420 Ga0075433_10012511
421 Ga0075433_10063420
422 Ga0075433_10099199
423 Ga0075433_10202129
424 Ga0075433_10357295
425 Ga0075433_10403941
426 Ga0075434_100002682
427 Ga0075434_100032943
428 Ga0075434_100085830
429 Ga0075434_100094461
430 Ga0075434_100134758
431 Ga0075434_100183697
432 Ga0075429_100000077
433 Ga0075429_100010369
434 Ga0075429_100013931
435 Ga0075429_100032502
436 Ga0075429_100063533
437 Ga0075429_100103624
438 Ga0075429_100335082
439 Ga0075436_100001664
440 Ga0075436_100123265
441 Ga0075436_100285756
442 Ga0075436_100595661
443 Ga0097620_100976432
444 Ga0075435_100006269
445 Ga0075435_100007906
446 Ga0075435_100015271
447 Ga0075435_100015533
448 Ga0075435_100028637
449 Ga0075435_100480098
450 Ga0111539_10000225
451 Ga0111539_10032641
452 Ga0111539_10039245
453 Ga0111539_10388091
454 Ga0111539_10781228
455 Ga0114129_10002277
456 Ga0114129_10003534
457 Ga0114129_10011754
458 Ga0114129_10012729
459 Ga0114129_10024504
460 Ga0114129_10028042
461 Ga0114129_10037378
462 Ga0114129_10053417
463 Ga0114129_10141374
464 Ga0114129_10157128
465 Ga0114129_10399723
466 Ga0114129_10522357
467 Ga0114129_12057260
468 Ga0105241_10022228
469 Ga0105242_10328319
470 Ga0105237_12195001
471 Ga0105249_10135335
472 Ga0105249_10986801
473 Ga0157373_10146609
474 Ga0157378_11116663
475 Ga0163162_10012981
476 Ga0163162_11012469
477 Ga0163162_11986587
478 Ga0157375_10584827
479 Ga0157380_10806135
480 Ga0157380_10869153
481 Ga0157379_10845535
482 Ga0163161_10981137
483 Ga0207642_10317293
484 Ga0207684_10059144
485 Ga0207684_10194962
486 Ga0207684_10929641
487 Ga0207654_10021625
488 Ga0207707_10275103
489 Ga0207671_11316613
490 Ga0207660_10048077
491 Ga0207646_10075522
492 Ga0207646_10284356
493 Ga0207681_10073779
494 Ga0207690_10521720
495 Ga0207706_10079416
496 Ga0207691_10139320
497 Ga0207651_11493677
498 Ga0207712_10084157
499 Ga0207712_10652892
500 Ga0207668_10106002
501 Ga0207703_10355066
502 Ga0207708_10071326
503 Ga0207648_10140181
504 Ga0207648_10707602
505 Ga0207674_10448100
506 Ga0207675_100025951
507 Ga0207428_10000035
508 Ga0207428_10007068
509 Ga0207428_10078129
510 Ga0268265_10636214
511 Ga0268265_11680788
512 Ga0268264_10019799
513 Ga0307408_100042883
514 Ga0307408_100103070
515 Ga0307408_100228464
516 Ga0307408_100539700
517 Ga0307408_100638766
518 Ga0307408_100645872
519 Ga0307406_10867567
520 Ga0307407_10295606
521 Ga0307412_10203784
522 Ga0307412_11424847
523 Ga0307409_101316112
524 Ga0307416_100077155
525 Ga0307416_100273217
526 Ga0307416_101705034
527 Ga0307411_10694879
528 Ga0307411_11268041
529 Ga0307415_101640203
530 Ga0373930_0159314
531 Ga0373948_0003006
532 Ga0373950_0013231
533 Ga0373928_0245711
534 Ga0373940_0011279
535 Ga0373940_0018336
536 Ga0373932_0116320
537 Ga0373939_0117396
538 Ga0373960_0157340
539 Ga0373960_0158759
540 Ga0373961_0056161
541 Ga0373962_0202599
542 Ga0373931_0013229
543 Ga0373931_0083281
544 Ga0373931_0441462
545 Ga0395899_0102921
546 Ga0395900_0000746
547 Ga0395898_0016840
548 Ga0395905_0754189
549 Ga0395905_0849622
550 Ga0451577_0627739
551 Ga0451577_0996087
552 Ga0451577_1070725
553 Ga0453684_0648296
554 Ga0451576_0088771
555 Ga0451576_0142819
556 Ga0451576_0885241
557 Ga0451576_1002944
558 Ga0451576_1618252
559 Ga0495603_0016712
560 Ga0495580_0003674
561 Ga0495580_0288574
562 Ga0495584_0164172
563 Ga0495642_0032529
564 Ga0495642_0141769
565 Ga0495598_0014806
566 Ga0495656_0021398
567 Ga0495659_0132344
568 Ga0495659_0212261
569 Ga0495669_0563522
570 Ga0495670_0355920
571 Ga0495636_0590710
572 Ga0496101_0331842
573 Ga0496102_0007421
574 Ga0496103_0063228
575 Ga0496104_0944626
576 Ga0496106_0373866
577 Ga0496107_0386939
578 Ga0501031_0327979
579 Ga0501031_0538503
580 Ga0501039_0190826
581 Ga0501040_0090589
582 Ga0501040_0297653
583 Ga0501040_0616655
584 Ga0501042_0335597
585 Ga0501043_0247430
586 Ga0501043_0775543
587 Ga0501046_0038186
588 Ga0501046_0471246
589 Ga0501048_0191067
590 Ga0501048_0469951
591 Ga0501069_0697931
592 Ga0501071_0051956
593 Ga0501071_0152588
594 Ga0501071_0914983
595 Ga0501071_1456514
596 Ga0501072_0014807
597 Ga0501072_0062054
598 Ga0501075_0036944
599 Ga0501075_0163253
600 Ga0501075_0355816
601 Ga0501075_0678187
602 Ga0501075_0710057
603 Ga0501076_0009030
604 Ga0501076_0285644
605 Ga0501077_0145726
606 Ga0501077_0942696
607 Ga0501079_0166800
608 Ga0501079_0944060
609 Ga0501079_0946590
610 Ga0501080_0921097
611 Ga0501081_0137451
612 Ga0501081_0255109
613 Ga0501081_0439001
614 Ga0501044_1146467
615 Ga0501045_0042399
616 Ga0501045_0116128
617 Ga0501045_0173179
618 Ga0501045_0413893
619 nmdc:mga05p37_1007203_c1
620 nmdc:mga05p37_239_c1
621 nmdc:mga05p37_27299_c1
622 nmdc:mga05p37_276511_c1
623 nmdc:mga05p37_28452_c1
624 nmdc:mga05p37_31846_c1
625 nmdc:mga05p37_34007_c1
626 nmdc:mga05p37_37841_c1
627 nmdc:mga05p37_382551_c1
628 nmdc:mga05p37_51500_c1
629 nmdc:mga05p37_684234_c1
630 nmdc:mga05p37_78246_c1
631 nmdc:mga09592_10964_c1
632 nmdc:mga09592_1108521_c1
633 nmdc:mga09592_16148_c1
634 nmdc:mga09592_213128_c1
635 nmdc:mga09592_229060_c1
636 nmdc:mga09592_427_c1
637 nmdc:mga09592_61883_c1
638 nmdc:mga09592_7840_c1
639 nmdc:mga09592_79006_c1
640 nmdc:mga09592_991184_c1
641 nmdc:mga0qj67_2186_c1
642 nmdc:mga0qj67_513163_c1
643 nmdc:mga0qj67_525575_c1
644 nmdc:mga0qj67_5601_c1
645 nmdc:mga0qj67_639_c1
646 nmdc:mga0qj67_91850_c1
647 nmdc:mga06r32_127994_c1
648 nmdc:mga06r32_229108_c1
649 nmdc:mga06r32_234_c1
650 nmdc:mga06r32_26146_c1
651 nmdc:mga06r32_315705_c1
652 nmdc:mga06r32_3181_c1
653 nmdc:mga06r32_451717_c1
654 nmdc:mga06r32_46112_c1
655 nmdc:mga06r32_677918_c1
656 nmdc:mga06r32_915571_c1
657 nmdc:mga08y16_1476_c1
658 nmdc:mga08y16_2622_c1
659 nmdc:mga08y16_305122_c1
660 nmdc:mga08y16_311469_c1
661 nmdc:mga08y16_74310_c1
662 nmdc:mga0n895_1153_c1
663 nmdc:mga0n895_22312_c1
664 nmdc:mga0n895_25996_c1
665 nmdc:mga0n895_465934_c1
666 nmdc:mga0n895_54265_c1
667 nmdc:mga0n895_760167_c1
668 nmdc:mga0n895_8353_c1
669 nmdc:mga0n895_95862_c1
670 nmdc:mga0rr50_20553_c1
671 nmdc:mga0rr50_322833_c1
672 nmdc:mga0rr50_3735_c1
673 nmdc:mga0rr50_391613_c1
674 nmdc:mga0rr50_60436_c1
675 nmdc:mga0rr50_869044_c1
676 nmdc:mga08x19_147680_c1
677 nmdc:mga08x19_203406_c1
678 nmdc:mga08x19_382_c1
679 nmdc:mga0a205_104387_c1
680 nmdc:mga0a205_129786_c1
681 nmdc:mga0a205_15238_c1
682 nmdc:mga0a205_178_c1
683 nmdc:mga0a205_4157_c1
684 nmdc:mga0a205_484533_c1
685 nmdc:mga0a205_48513_c1
686 nmdc:mga0a205_50933_c1
687 nmdc:mga0a205_52083_c1
688 nmdc:mga0a205_87632_c1
689 Ga0501084_0248796
690 Ga0501084_0458580
691 Ga0501084_1562242
692 Ga0590071_016254
693 Ga0590074_086481
694 Ga0590075_035488
695 Ga0501082_0112812
696 Ga0501082_0201257
697 Ga0501082_1120483
698 Ga0530510_0343138
699 Ga0530510_0552885
700 Ga0530510_0653093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

32

138

0.95

PF00462

Glutaredoxin

Glutaredoxin

29

85

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zb7-assembly2.cif.gz_C phanerochaete chrysosporium ure2p6 in apo form. 0.9358 2 33
8a4j-assembly1.cif.gz_A human gdap1, a247v mutant 0.9078 2 33
6uih-assembly1.cif.gz_A crystal structure of the core domain from the gst-like protein gdap1 0.9069 1 33
6ghf-assembly1.cif.gz_B crystal structure of a gst variant 0.9061 1 31
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.8935 2 111
ID Description Score Start End Superfamily
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9834 4 32 3.40.30.10
3r2qA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9646 4 32 3.40.30.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9374 3 31 3.40.30.10
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9279 3 31 3.40.30.10
af_Q9VSL2_5_102_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9277 2 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V6NVY9-F1-model_v4 Arsenate reductase 0.9874 2 116
AF-A0A2V7AGI2-F1-model_v4 Arsenate reductase 0.9868 2 118
AF-A0A1Q7FWX6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9867 1 118 GO:0016787
AF-A0A2V6PNB4-F1-model_v4 Arsenate reductase 0.9859 1 117
AF-A0A3N5IA82-F1-model_v4 Arsenate reductase 0.9717 2 119

Map