F418194

General Info

Members Datasets Scaffolds Average Seq Length
350 230 350 92

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101530726|Ga0070712_1015307262
Length 92
Sequence MSARVKLPTILRKHTDGVAVVEADGASVGEVLKDLESRHPGVTRTILTEDGAGLHRFVNVYVNGEDVRYGGGLDAPVADSDTISILPAVAGG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 2.86
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 2.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10004904 3300003373 Bacteria 3268
2 Ga0070658_10060177 3300005327 Bacteria 3093
3 Ga0070658_11546699 3300005327 Bacteria 575
4 Ga0070683_100597070 3300005329 Bacteria 1056
5 Ga0070690_100148234 3300005330 Bacteria 1598
6 Ga0070670_100369136 3300005331 Unclassified 1263
7 Ga0070670_102082970 3300005331 Bacteria 523
8 Ga0068869_101219786 3300005334 Bacteria 662
9 Ga0070666_10233670 3300005335 Bacteria 1299
10 Ga0070666_10396439 3300005335 Bacteria 992
11 Ga0070680_100172919 3300005336 Bacteria 1818
12 Ga0070682_100048296 3300005337 Bacteria 2649
13 Ga0070660_100084221 3300005339 Bacteria 2499
14 Ga0070689_100061290 3300005340 Bacteria 2926
15 Ga0070661_100768726 3300005344 Bacteria 789
16 Ga0070668_101212294 3300005347 Bacteria 684
17 Ga0070669_100324602 3300005353 Bacteria 1244
18 Ga0070669_101001820 3300005353 Bacteria 717
19 Ga0070669_101124869 3300005353 Bacteria 677
20 Ga0070675_100297227 3300005354 Bacteria 1422
21 Ga0070671_100450877 3300005355 Bacteria 1104
22 Ga0070671_100826594 3300005355 Bacteria 807
23 Ga0070674_100286163 3300005356 Bacteria 1308
24 Ga0070674_101400517 3300005356 Bacteria 626
25 Ga0070673_100182613 3300005364 Bacteria 1797
26 Ga0070673_100553116 3300005364 Bacteria 1046
27 Ga0070673_100612193 3300005364 Bacteria 994
28 Ga0070673_101015127 3300005364 Bacteria 773
29 Ga0070673_102058018 3300005364 Bacteria 542
30 Ga0070688_100575941 3300005365 Bacteria 859
31 Ga0070703_10482448 3300005406 Bacteria 555
32 Ga0070709_11094153 3300005434 Bacteria 637
33 Ga0070714_100001906 3300005435 Bacteria 15212
34 Ga0070714_100047079 3300005435 Bacteria 3662
35 Ga0070713_101537284 3300005436 Bacteria 646
36 Ga0070701_10029592 3300005438 Bacteria 2703
37 Ga0070701_10915777 3300005438 Bacteria 606
38 Ga0070700_100212984 3300005441 Bacteria 1364
39 Ga0070694_100164083 3300005444 Bacteria 1632
40 Ga0070685_10136307 3300005466 Bacteria 1540
41 Ga0070699_101264222 3300005518 Bacteria 677
42 Ga0070679_100376421 3300005530 Bacteria 1366
43 Ga0070679_100733681 3300005530 Bacteria 931
44 Ga0070684_100558628 3300005535 Unclassified 1062
45 Ga0070684_100809811 3300005535 Bacteria 876
46 Ga0070684_101181235 3300005535 Bacteria 720
47 Ga0068853_101448183 3300005539 Bacteria 665
48 Ga0070665_100841599 3300005548 Bacteria 930
49 Ga0070665_102230334 3300005548 Bacteria 551
50 Ga0070704_100041967 3300005549 Bacteria 3161
51 Ga0068855_100105558 3300005563 Unclassified 3239
52 Ga0070664_101315843 3300005564 Bacteria 683
53 Ga0068854_100339465 3300005578 Bacteria 1226
54 Ga0068854_100969528 3300005578 Bacteria 751
55 Ga0070702_100395936 3300005615 Bacteria 986
56 Ga0068859_102932418 3300005617 Unclassified 522
57 Ga0068864_100409789 3300005618 Bacteria 1289
58 Ga0068866_10055194 3300005718 Bacteria 2039
59 Ga0068861_100006918 3300005719 Bacteria 7744
60 Ga0068870_10353544 3300005840 Bacteria 943
61 Ga0068863_100575228 3300005841 Bacteria 1114
62 Ga0068863_101359322 3300005841 Bacteria 718
63 Ga0068863_102526692 3300005841 Bacteria 523
64 Ga0068858_100237538 3300005842 Bacteria 1728
65 Ga0068858_102141505 3300005842 Bacteria 553
66 Ga0068860_101332086 3300005843 Bacteria 739
67 Ga0068862_100663317 3300005844 Bacteria 1007
68 Ga0068862_100961143 3300005844 Bacteria 843
69 Ga0068862_102350884 3300005844 Bacteria 545
70 Ga0081538_10000279 3300005981 Bacteria 58452
71 Ga0070717_10644140 3300006028 Bacteria 962
72 Ga0075363_100816439 3300006048 Unclassified 568
73 Ga0070712_100000008 3300006175 Bacteria 149644
74 Ga0070712_101530726 3300006175 Bacteria 583
75 Ga0097621_102147743 3300006237 Bacteria 534
76 Ga0075430_101466859 3300006846 Bacteria 561
77 Ga0075433_10343470 3300006852 Bacteria 1319
78 Ga0097620_102932059 3300006931 Unclassified 522
79 Ga0075435_100645285 3300007076 Bacteria 919
80 Ga0075435_101170948 3300007076 Unclassified 672
81 Ga0105240_10181872 3300009093 Unclassified 2480
82 Ga0111539_10027975 3300009094 Bacteria 6885
83 Ga0111539_10184037 3300009094 Bacteria 2440
84 Ga0111539_10209172 3300009094 Bacteria 2273
85 Ga0111539_10473183 3300009094 Bacteria 1459
86 Ga0105245_10077307 3300009098 Bacteria 3034
87 Ga0114129_10003125 3300009147 Bacteria 23224
88 Ga0114129_11514497 3300009147 Bacteria 824
89 Ga0105243_11862039 3300009148 Bacteria 634
90 Ga0105241_11391259 3300009174 Bacteria 671
91 Ga0105241_11746975 3300009174 Bacteria 606
92 Ga0105242_10039176 3300009176 Bacteria 3813
93 Ga0105242_11567794 3300009176 Unclassified 691
94 Ga0105248_10195417 3300009177 Bacteria 2279
95 Ga0105248_10255787 3300009177 Bacteria 1971
96 Ga0105237_12543267 3300009545 Unclassified 522
97 Ga0105238_10268305 3300009551 Unclassified 1687
98 Ga0105238_11769007 3300009551 Bacteria 650
99 Ga0105249_10036123 3300009553 Bacteria 4482
100 Ga0105239_10100146 3300010375 Bacteria 3205
101 Ga0157313_1029190 3300012503 Bacteria 615
102 Ga0157371_11215268 3300013102 Bacteria 581
103 Ga0157370_10048494 3300013104 Bacteria 4068
104 Ga0157369_10141983 3300013105 Bacteria 2541
105 Ga0157369_10394527 3300013105 Bacteria 1436
106 Ga0157369_11047114 3300013105 Bacteria 835
107 Ga0157374_10574080 3300013296 Bacteria 1137
108 Ga0157374_10652351 3300013296 Unclassified 1064
109 Ga0157374_10749733 3300013296 Bacteria 991
110 Ga0157374_11695567 3300013296 Bacteria 657
111 Ga0157378_12121891 3300013297 Bacteria 613
112 Ga0163162_10134188 3300013306 Bacteria 2586
113 Ga0163162_10270040 3300013306 Bacteria 1832
114 Ga0157372_10169478 3300013307 Bacteria 2526
115 Ga0157372_11258929 3300013307 Bacteria 854
116 Ga0157372_12183196 3300013307 Unclassified 636
117 Ga0157372_12424201 3300013307 Unclassified 602
118 Ga0157372_12581419 3300013307 Bacteria 583
119 Ga0157372_12603839 3300013307 Unclassified 581
120 Ga0157375_11437707 3300013308 Bacteria 813
121 Ga0157375_12070966 3300013308 Bacteria 677
122 Ga0157375_12668214 3300013308 Unclassified 597
123 Ga0163163_11074554 3300014325 Unclassified 868
124 Ga0157380_11499270 3300014326 Bacteria 727
125 Ga0157380_11515490 3300014326 Bacteria 724
126 Ga0157377_10278337 3300014745 Bacteria 1096
127 Ga0157377_10940968 3300014745 Bacteria 649
128 Ga0157379_11173505 3300014968 Bacteria 738
129 Ga0157376_10773057 3300014969 Bacteria 971
130 Ga0157376_11560802 3300014969 Unclassified 694
131 Ga0163161_10450221 3300017792 Bacteria 1041
132 Ga0197907_10662592 3300020069 Bacteria 942
133 Ga0197907_10664560 3300020069 Bacteria 1222
134 Ga0206349_1620359 3300020075 Bacteria 838
135 Ga0206354_11360633 3300020081 Bacteria 523
136 Ga0213873_10007996 3300021358 Bacteria 2142
137 Ga0213875_10000050 3300021388 Bacteria 143822
138 Ga0224712_10541438 3300022467 Bacteria 565
139 Ga0207710_10436570 3300025900 Bacteria 675
140 Ga0207710_10638640 3300025900 Unclassified 557
141 Ga0207680_10761005 3300025903 Bacteria 694
142 Ga0207705_10257525 3300025909 Bacteria 1332
143 Ga0207705_11364339 3300025909 Bacteria 540
144 Ga0207695_10285352 3300025913 Unclassified 1544
145 Ga0207693_10000002 3300025915 Bacteria 304011
146 Ga0207660_10233488 3300025917 Bacteria 1447
147 Ga0207662_10102582 3300025918 Bacteria 1774
148 Ga0207657_10146651 3300025919 Bacteria 1924
149 Ga0207652_10166130 3300025921 Bacteria 1979
150 Ga0207652_10793809 3300025921 Bacteria 841
151 Ga0207650_10294751 3300025925 Unclassified 1323
152 Ga0207650_10359651 3300025925 Bacteria 1199
153 Ga0207664_10030891 3300025929 Bacteria 4094
154 Ga0207664_10089505 3300025929 Bacteria 2520
155 Ga0207644_10101660 3300025931 Bacteria 2161
156 Ga0207644_10493437 3300025931 Bacteria 1009
157 Ga0207644_11102614 3300025931 Bacteria 667
158 Ga0207706_10829646 3300025933 Bacteria 784
159 Ga0207686_10238903 3300025934 Bacteria 1321
160 Ga0207709_10965894 3300025935 Bacteria 695
161 Ga0207669_10370892 3300025937 Bacteria 1112
162 Ga0207669_10537846 3300025937 Bacteria 941
163 Ga0207669_11270775 3300025937 Bacteria 625
164 Ga0207711_10250540 3300025941 Bacteria 1626
165 Ga0207711_11459140 3300025941 Unclassified 627
166 Ga0207689_11795350 3300025942 Bacteria 506
167 Ga0207689_11798832 3300025942 Bacteria 506
168 Ga0207661_10068052 3300025944 Bacteria 2899
169 Ga0207661_12085973 3300025944 Bacteria 513
170 Ga0207679_11120391 3300025945 Bacteria 722
171 Ga0207667_10104194 3300025949 Unclassified 2926
172 Ga0207651_10070170 3300025960 Bacteria 2478
173 Ga0207651_10801244 3300025960 Bacteria 835
174 Ga0207651_11375571 3300025960 Bacteria 635
175 Ga0207651_11826283 3300025960 Bacteria 547
176 Ga0207651_12146071 3300025960 Bacteria 502
177 Ga0207668_10779735 3300025972 Unclassified 845
178 Ga0207640_10258311 3300025981 Bacteria 1356
179 Ga0207640_11165485 3300025981 Bacteria 684
180 Ga0207640_11385306 3300025981 Unclassified 630
181 Ga0207703_10371830 3300026035 Bacteria 1320
182 Ga0207703_11418468 3300026035 Bacteria 668
183 Ga0207639_11345096 3300026041 Bacteria 670
184 Ga0207641_10983126 3300026088 Bacteria 840
185 Ga0207641_11424504 3300026088 Bacteria 694
186 Ga0207676_11952906 3300026095 Bacteria 585
187 Ga0207674_11290141 3300026116 Bacteria 700
188 Ga0207675_100683776 3300026118 Bacteria 1034
189 Ga0207683_10202436 3300026121 Bacteria 1805
190 Ga0207683_11034158 3300026121 Bacteria 762
191 Ga0207428_11049664 3300027907 Bacteria 571
192 Ga0268265_10139262 3300028380 Bacteria 2029
193 Ga0268265_10634272 3300028380 Bacteria 1025
194 Ga0268265_11258506 3300028380 Bacteria 739
195 Ga0268264_12175220 3300028381 Bacteria 563
196 Ga0265326_10088075 3300028558 Bacteria 879
197 Ga0265319_1001259 3300028563 Bacteria 15436
198 Ga0265334_10100822 3300028573 Unclassified 1045
199 Ga0265318_10099091 3300028577 Bacteria 1072
200 Ga0265332_10116420 3300031238 Bacteria 1124
201 Ga0265320_10039041 3300031240 Bacteria 2376
202 Ga0265339_10084137 3300031249 Bacteria 1677
203 Ga0265316_10075901 3300031344 Bacteria 2584
204 Ga0307408_101468408 3300031548 Bacteria 644
205 Ga0265314_10036397 3300031711 Bacteria 3577
206 Ga0265342_10247026 3300031712 Bacteria 953
207 Ga0307405_10441673 3300031731 Bacteria 1029
208 Ga0307413_11984548 3300031824 Bacteria 524
209 Ga0307410_10066904 3300031852 Bacteria 2477
210 Ga0307410_10131364 3300031852 Bacteria 1840
211 Ga0307406_10551525 3300031901 Bacteria 943
212 Ga0307407_10450093 3300031903 Bacteria 934
213 Ga0307409_100503708 3300031995 Bacteria 1180
214 Ga0307409_101122545 3300031995 Bacteria 808
215 Ga0307409_102376770 3300031995 Bacteria 559
216 Ga0307416_101200859 3300032002 Bacteria 864
217 Ga0307411_11578172 3300032005 Bacteria 605
218 Ga0307415_100824972 3300032126 Bacteria 849
219 Ga0373948_0044978 3300034817 Bacteria 934
220 Ga0373938_0045801 3300034957 Bacteria 986
221 Ga0373929_0103661 3300035085 Bacteria 720
222 Ga0373952_0243528 3300035092 Bacteria 542
223 Ga0373932_0281751 3300035112 Bacteria 615
224 Ga0373955_0094840 3300035172 Bacteria 1706
225 Ga0373961_0052615 3300035241 Bacteria 1213
226 Ga0373931_0025368 3300035691 Bacteria 3011
227 Ga0373933_0203679 3300035724 Bacteria 1267
228 Ga0373937_0010709 3300036401 Bacteria 8022
229 Ga0265778_042238 3300036457 Bacteria 609
230 Ga0395899_0032604 3300037312 Bacteria 3914
231 Ga0395899_0934559 3300037312 Bacteria 527
232 Ga0395898_0520745 3300037466 Bacteria 1130
233 Ga0436364_0363596 3300037853 Bacteria 7972
234 Ga0436364_0532382 3300037853 Bacteria 57757
235 Ga0395901_0004943 3300038443 Bacteria 13457
236 Ga0395901_1629928 3300038443 Bacteria 598
237 Ga0395901_2063598 3300038443 Bacteria 516
238 Ga0436365_0532644 3300039437 Bacteria 2753
239 Ga0436365_1270888 3300039437 Bacteria 1611
240 Ga0436365_1704131 3300039437 Bacteria 7402
241 Ga0436363_0112801 3300039450 Bacteria 791
242 Ga0436362_0100819 3300039453 Bacteria 3570
243 Ga0451835_0858636 3300041492 Bacteria 578
244 Ga0466966_0069468 3300044684 Bacteria 2210
245 Ga0466966_0153253 3300044684 Bacteria 1405
246 Ga0466961_0003908 3300044693 Bacteria 9318
247 Ga0466963_0077043 3300044694 Bacteria 2252
248 Ga0466963_0415979 3300044694 Bacteria 948
249 Ga0466963_1243074 3300044694 Bacteria 523
250 Ga0466970_0652664 3300044765 Bacteria 612
251 Ga0466959_0104296 3300045049 Bacteria 2028
252 Ga0466959_0543425 3300045049 Bacteria 784
253 Ga0466959_0591218 3300045049 Bacteria 747
254 Ga0466958_0089340 3300045836 Bacteria 1905
255 Ga0466958_0108348 3300045836 Bacteria 1733
256 Ga0466967_0061214 3300045976 Bacteria 3339
257 Ga0466967_0081761 3300045976 Bacteria 2918
258 Ga0495653_0052458 3300046463 Bacteria 3125
259 Ga0495653_0431435 3300046463 Unclassified 832
260 Ga0495580_0841648 3300046472 Bacteria 593
261 Ga0495662_0316440 3300046476 Bacteria 768
262 Ga0495662_0342157 3300046476 Bacteria 735
263 Ga0495618_0074436 3300046514 Bacteria 2163
264 Ga0495618_0132347 3300046514 Bacteria 1596
265 Ga0495628_0410281 3300046516 Bacteria 988
266 Ga0495628_1251622 3300046516 Bacteria 502
267 Ga0495630_0423438 3300046517 Bacteria 1020
268 Ga0495630_1227198 3300046517 Bacteria 566
269 Ga0495652_0073699 3300046529 Bacteria 2842
270 Ga0495652_0166796 3300046529 Bacteria 1704
271 Ga0495640_0259653 3300046533 Bacteria 1086
272 Ga0495586_0761204 3300046535 Unclassified 559
273 Ga0495667_0208190 3300046559 Bacteria 1250
274 Ga0495634_0039203 3300046642 Bacteria 3227
275 Ga0495635_0132295 3300046663 Unclassified 1701
276 Ga0495588_0198690 3300046674 Bacteria 1059
277 Ga0495658_0970786 3300046683 Bacteria 543
278 Ga0495613_0153329 3300046689 Bacteria 1642
279 Ga0495613_0585575 3300046689 Unclassified 743
280 Ga0495624_0129778 3300046690 Bacteria 1546
281 Ga0495671_0123687 3300046692 Bacteria 1262
282 Ga0495589_0075315 3300046794 Bacteria 1646
283 Ga0495604_0197340 3300047317 Bacteria 1399
284 Ga0495674_0282608 3300047319 Bacteria 1359
285 Ga0495680_0354455 3300047322 Bacteria 1021
286 Ga0495680_0610741 3300047322 Unclassified 729
287 Ga0495683_0410357 3300047323 Bacteria 562
288 Ga0495675_0241337 3300047444 Bacteria 1088
289 Ga0495675_0767304 3300047444 Bacteria 536
290 Ga0495684_0560321 3300047471 Bacteria 777
291 Ga0495615_0327493 3300048090 Bacteria 502
292 Ga0496102_0097102 3300048905 Bacteria 2732
293 Ga0496104_0119680 3300048907 Bacteria 2528
294 Ga0496105_0021813 3300048908 Bacteria 5185
295 Ga0496106_0032168 3300048909 Bacteria 3910
296 Ga0496109_0165908 3300048912 Bacteria 2070
297 Ga0496110_0097347 3300048913 Bacteria 2636
298 Ga0496111_0032511 3300048914 Bacteria 3720
299 Ga0496111_0124566 3300048914 Bacteria 1905
300 Ga0496112_0092940 3300048915 Bacteria 2986
301 Ga0496112_1301582 3300048915 Bacteria 642
302 Ga0496122_0189723 3300048925 Bacteria 1215
303 Ga0501323_014405 3300049539 Bacteria 988
304 Ga0501032_1051789 3300049569 Unclassified 511
305 Ga0501033_0714583 3300049570 Bacteria 681
306 Ga0501040_0517405 3300049576 Bacteria 860
307 Ga0501040_0548644 3300049576 Bacteria 834
308 Ga0501040_1180916 3300049576 Bacteria 555
309 Ga0501040_1358823 3300049576 Bacteria 516
310 Ga0501042_0009329 3300049578 Bacteria 6535
311 Ga0501042_0737738 3300049578 Bacteria 716
312 Ga0501042_1223088 3300049578 Bacteria 548
313 Ga0501070_0148041 3300049586 Bacteria 1938
314 Ga0501070_0196613 3300049586 Bacteria 1656
315 Ga0501071_0440882 3300049587 Bacteria 996
316 Ga0501071_0672290 3300049587 Bacteria 797
317 Ga0501072_0526429 3300049588 Bacteria 934
318 Ga0501072_0678684 3300049588 Bacteria 810
319 Ga0501072_0828480 3300049588 Bacteria 724
320 Ga0501072_1140801 3300049588 Bacteria 606
321 Ga0501075_1229311 3300049591 Bacteria 568
322 Ga0501076_0827857 3300049592 Bacteria 764
323 Ga0501076_0838288 3300049592 Bacteria 758
324 Ga0501259_079305 3300049688 Bacteria 719
325 Ga0501079_1200053 3300049741 Bacteria 598
326 Ga0501083_0567182 3300049744 Bacteria 739
327 Ga0501045_0960296 3300049824 Bacteria 627
328 nmdc:mga03n38_359155_c1 3300050490 Unclassified 794
329 nmdc:mga05p37_1610760_c1 3300050507 Bacteria 639
330 nmdc:mga05p37_1685_c1 3300050507 Bacteria 25708
331 nmdc:mga09592_27705_c1 3300050508 Bacteria 4703
332 nmdc:mga0qj67_11680_c1 3300050509 Bacteria 6588
333 nmdc:mga0qj67_307274_c1 3300050509 Bacteria 1284
334 nmdc:mga0qj67_43226_c1 3300050509 Bacteria 3548
335 nmdc:mga06r32_1451555_c1 3300050510 Bacteria 627
336 nmdc:mga08y16_136835_c1 3300050511 Bacteria 2546
337 nmdc:mga08y16_206708_c1 3300050511 Bacteria 2034
338 nmdc:mga08y16_403160_c1 3300050511 Bacteria 1399
339 nmdc:mga08y16_534446_c1 3300050511 Bacteria 1188
340 nmdc:mga08x19_834477_c1 3300050514 Bacteria 655
341 Ga0495601_0081753 3300053077 Bacteria 2073
342 Ga0495612_0033941 3300053078 Bacteria 2065
343 Ga0495619_0403758 3300053085 Bacteria 943
344 Ga0501084_1205062 3300054114 Bacteria 635
345 Ga0501084_1634640 3300054114 Bacteria 538
346 Ga0590074_095788 3300059423 Bacteria 576
347 Ga0501082_1387531 3300060353 Bacteria 614
348 Ga0501082_1731330 3300060353 Bacteria 545
349 Ga0530510_0494165 3300061734 Bacteria 927
350 Ga0530510_0949410 3300061734 Bacteria 658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_1731330 Ga0501082_1731330_12_275 87
2 3300005327 Ga0070658_11546699 Ga0070658_115466991 90
3 3300005335 Ga0070666_10233670 Ga0070666_102336702 90
4 3300005355 Ga0070671_100450877 Ga0070671_1004508772 90
5 3300005355 Ga0070671_100826594 Ga0070671_1008265941 90
6 3300005364 Ga0070673_102058018 Ga0070673_1020580182 90
7 3300005434 Ga0070709_11094153 Ga0070709_110941532 90
8 3300005435 Ga0070714_100047079 Ga0070714_1000470795 90
9 3300005518 Ga0070699_101264222 Ga0070699_1012642222 90
10 3300005535 Ga0070684_100809811 Ga0070684_1008098112 90
11 3300005548 Ga0070665_102230334 Ga0070665_1022303341 90
12 3300005563 Ga0068855_100105558 Ga0068855_1001055585 90
13 3300005617 Ga0068859_102932418 Ga0068859_1029324182 90
14 3300005841 Ga0068863_100575228 Ga0068863_1005752282 90
15 3300005843 Ga0068860_101332086 Ga0068860_1013320862 90
16 3300006175 Ga0070712_100000008 Ga0070712_10000000861 90
17 3300006175 Ga0070712_101530726 Ga0070712_1015307262 90
18 3300006237 Ga0097621_102147743 Ga0097621_1021477431 90
19 3300006931 Ga0097620_102932059 Ga0097620_1029320592 90
20 3300007076 Ga0075435_100645285 Ga0075435_1006452853 90
21 3300007076 Ga0075435_101170948 Ga0075435_1011709482 90
22 3300009093 Ga0105240_10181872 Ga0105240_101818725 90
23 3300009094 Ga0111539_10184037 Ga0111539_101840372 90
24 3300009174 Ga0105241_11391259 Ga0105241_113912592 90
25 3300009176 Ga0105242_11567794 Ga0105242_115677941 90
26 3300009177 Ga0105248_10195417 Ga0105248_101954174 90
27 3300009177 Ga0105248_10255787 Ga0105248_102557872 90
28 3300009545 Ga0105237_12543267 Ga0105237_125432671 90
29 3300009551 Ga0105238_10268305 Ga0105238_102683053 90
30 3300013105 Ga0157369_10141983 Ga0157369_101419833 90
31 3300013105 Ga0157369_10394527 Ga0157369_103945272 90
32 3300013296 Ga0157374_10574080 Ga0157374_105740802 90
33 3300013296 Ga0157374_10749733 Ga0157374_107497332 90
34 3300013297 Ga0157378_12121891 Ga0157378_121218911 90
35 3300013306 Ga0163162_10134188 Ga0163162_101341883 90
36 3300013307 Ga0157372_10169478 Ga0157372_101694782 90
37 3300013307 Ga0157372_12183196 Ga0157372_121831961 90
38 3300013308 Ga0157375_11437707 Ga0157375_114377072 90
39 3300013308 Ga0157375_12070966 Ga0157375_120709662 90
40 3300013308 Ga0157375_12668214 Ga0157375_126682142 90
41 3300014969 Ga0157376_10773057 Ga0157376_107730572 90
42 3300014969 Ga0157376_11560802 Ga0157376_115608022 90
43 3300020069 Ga0197907_10662592 Ga0197907_106625921 90
44 3300020069 Ga0197907_10664560 Ga0197907_106645602 90
45 3300025909 Ga0207705_11364339 Ga0207705_113643392 90
46 3300025913 Ga0207695_10285352 Ga0207695_102853521 90
47 3300025915 Ga0207693_10000002 Ga0207693_10000002280 90
48 3300025921 Ga0207652_10793809 Ga0207652_107938091 90
49 3300025929 Ga0207664_10089505 Ga0207664_100895052 90
50 3300025931 Ga0207644_10101660 Ga0207644_101016603 90
51 3300025931 Ga0207644_11102614 Ga0207644_111026141 90
52 3300025941 Ga0207711_10250540 Ga0207711_102505401 90
53 3300025949 Ga0207667_10104194 Ga0207667_101041945 90
54 3300025960 Ga0207651_11375571 Ga0207651_113755712 90
55 3300025960 Ga0207651_12146071 Ga0207651_121460712 90
56 3300025981 Ga0207640_11385306 Ga0207640_113853062 90
57 3300026088 Ga0207641_11424504 Ga0207641_114245041 90
58 3300026118 Ga0207675_100683776 Ga0207675_1006837763 90
59 3300027907 Ga0207428_11049664 Ga0207428_110496641 90
60 3300028380 Ga0268265_11258506 Ga0268265_112585062 90
61 3300028381 Ga0268264_12175220 Ga0268264_121752202 90
62 3300031548 Ga0307408_101468408 Ga0307408_1014684081 90
63 3300031731 Ga0307405_10441673 Ga0307405_104416732 90
64 3300031824 Ga0307413_11984548 Ga0307413_119845481 90
65 3300031852 Ga0307410_10066904 Ga0307410_100669043 90
66 3300031901 Ga0307406_10551525 Ga0307406_105515252 90
67 3300031995 Ga0307409_101122545 Ga0307409_1011225451 90
68 3300031995 Ga0307409_102376770 Ga0307409_1023767702 90
69 3300032005 Ga0307411_11578172 Ga0307411_115781722 90
70 3300032126 Ga0307415_100824972 Ga0307415_1008249721 90
71 3300038443 Ga0395901_1629928 Ga0395901_1629928_91_366 90
72 3300041492 Ga0451835_0858636 Ga0451835_0858636_278_553 90
73 3300044684 Ga0466966_0153253 Ga0466966_0153253_1104_1376 90
74 3300044694 Ga0466963_0077043 Ga0466963_0077043_215_487 90
75 3300045976 Ga0466967_0081761 Ga0466967_0081761_873_1145 90
76 3300046472 Ga0495580_0841648 Ga0495580_0841648_79_354 90
77 3300046476 Ga0495662_0342157 Ga0495662_0342157_193_468 90
78 3300046514 Ga0495618_0132347 Ga0495618_0132347_491_766 90
79 3300046517 Ga0495630_0423438 Ga0495630_0423438_622_897 90
80 3300046517 Ga0495630_1227198 Ga0495630_1227198_215_493 90
81 3300046529 Ga0495652_0166796 Ga0495652_0166796_563_835 90
82 3300046535 Ga0495586_0761204 Ga0495586_0761204_106_381 90
83 3300046674 Ga0495588_0198690 Ga0495588_0198690_678_953 90
84 3300046683 Ga0495658_0970786 Ga0495658_0970786_181_456 90
85 3300046689 Ga0495613_0153329 Ga0495613_0153329_877_1155 90
86 3300046690 Ga0495624_0129778 Ga0495624_0129778_563_838 90
87 3300047322 Ga0495680_0610741 Ga0495680_0610741_53_328 90
88 3300047444 Ga0495675_0767304 Ga0495675_0767304_193_465 90
89 3300048090 Ga0495615_0327493 Ga0495615_0327493_154_426 90
90 3300048907 Ga0496104_0119680 Ga0496104_0119680_1062_1340 90
91 3300048908 Ga0496105_0021813 Ga0496105_0021813_3183_3461 90
92 3300048912 Ga0496109_0165908 Ga0496109_0165908_1293_1571 90
93 3300048913 Ga0496110_0097347 Ga0496110_0097347_709_987 90
94 3300048915 Ga0496112_1301582 Ga0496112_1301582_302_580 90
95 3300048925 Ga0496122_0189723 Ga0496122_0189723_195_467 90
96 3300049576 Ga0501040_0517405 Ga0501040_0517405_359_634 90
97 3300049576 Ga0501040_1180916 Ga0501040_1180916_129_404 90
98 3300049576 Ga0501040_1358823 Ga0501040_1358823_163_435 90
99 3300049578 Ga0501042_0009329 Ga0501042_0009329_2036_2311 90
100 3300049578 Ga0501042_0737738 Ga0501042_0737738_372_644 90
101 3300049578 Ga0501042_1223088 Ga0501042_1223088_177_452 90
102 3300049586 Ga0501070_0196613 Ga0501070_0196613_280_555 90
103 3300049587 Ga0501071_0440882 Ga0501071_0440882_295_570 90
104 3300049587 Ga0501071_0672290 Ga0501071_0672290_267_539 90
105 3300049588 Ga0501072_0526429 Ga0501072_0526429_127_402 90
106 3300049588 Ga0501072_0678684 Ga0501072_0678684_415_690 90
107 3300049588 Ga0501072_0828480 Ga0501072_0828480_260_535 90
108 3300049588 Ga0501072_1140801 Ga0501072_1140801_19_294 90
109 3300049591 Ga0501075_1229311 Ga0501075_1229311_40_315 90
110 3300049592 Ga0501076_0827857 Ga0501076_0827857_11_286 90
111 3300049592 Ga0501076_0838288 Ga0501076_0838288_281_553 90
112 3300049688 Ga0501259_079305 Ga0501259_079305_149_427 90
113 3300049824 Ga0501045_0960296 Ga0501045_0960296_15_287 90
114 3300050509 nmdc:mga0qj67_43226_c1 nmdc:mga0qj67_43226_c1_2189_2464 90
115 3300050511 nmdc:mga08y16_403160_c1 nmdc:mga08y16_403160_c1_1033_1311 90
116 3300054114 Ga0501084_1205062 Ga0501084_1205062_86_361 90
117 3300054114 Ga0501084_1634640 Ga0501084_1634640_244_519 90
118 3300059423 Ga0590074_095788 Ga0590074_095788_180_461 90
119 3300060353 Ga0501082_1387531 Ga0501082_1387531_235_510 90
120 3300061734 Ga0530510_0494165 Ga0530510_0494165_348_623 90
121 3300003373 JGI25407J50210_10004904 JGI25407J50210_100049044 91
122 3300005327 Ga0070658_10060177 Ga0070658_100601771 91
123 3300005329 Ga0070683_100597070 Ga0070683_1005970702 91
124 3300005330 Ga0070690_100148234 Ga0070690_1001482342 91
125 3300005331 Ga0070670_100369136 Ga0070670_1003691362 91
126 3300005331 Ga0070670_102082970 Ga0070670_1020829701 91
127 3300005334 Ga0068869_101219786 Ga0068869_1012197861 91
128 3300005335 Ga0070666_10396439 Ga0070666_103964392 91
129 3300005336 Ga0070680_100172919 Ga0070680_1001729192 91
130 3300005337 Ga0070682_100048296 Ga0070682_1000482962 91
131 3300005339 Ga0070660_100084221 Ga0070660_1000842213 91
132 3300005340 Ga0070689_100061290 Ga0070689_1000612902 91
133 3300005344 Ga0070661_100768726 Ga0070661_1007687262 91
134 3300005347 Ga0070668_101212294 Ga0070668_1012122943 91
135 3300005353 Ga0070669_100324602 Ga0070669_1003246022 91
136 3300005353 Ga0070669_101001820 Ga0070669_1010018201 91
137 3300005353 Ga0070669_101124869 Ga0070669_1011248693 91
138 3300005354 Ga0070675_100297227 Ga0070675_1002972271 91
139 3300005356 Ga0070674_100286163 Ga0070674_1002861632 91
140 3300005356 Ga0070674_101400517 Ga0070674_1014005171 91
141 3300005364 Ga0070673_100182613 Ga0070673_1001826132 91
142 3300005364 Ga0070673_100553116 Ga0070673_1005531162 91
143 3300005364 Ga0070673_100612193 Ga0070673_1006121932 91
144 3300005364 Ga0070673_101015127 Ga0070673_1010151272 91
145 3300005365 Ga0070688_100575941 Ga0070688_1005759412 91
146 3300005406 Ga0070703_10482448 Ga0070703_104824482 91
147 3300005435 Ga0070714_100001906 Ga0070714_1000019066 91
148 3300005436 Ga0070713_101537284 Ga0070713_1015372841 91
149 3300005438 Ga0070701_10029592 Ga0070701_100295922 91
150 3300005438 Ga0070701_10915777 Ga0070701_109157772 91
151 3300005441 Ga0070700_100212984 Ga0070700_1002129842 91
152 3300005444 Ga0070694_100164083 Ga0070694_1001640832 91
153 3300005466 Ga0070685_10136307 Ga0070685_101363072 91
154 3300005530 Ga0070679_100376421 Ga0070679_1003764212 91
155 3300005530 Ga0070679_100733681 Ga0070679_1007336812 91
156 3300005535 Ga0070684_100558628 Ga0070684_1005586282 91
157 3300005535 Ga0070684_101181235 Ga0070684_1011812351 91
158 3300005539 Ga0068853_101448183 Ga0068853_1014481832 91
159 3300005548 Ga0070665_100841599 Ga0070665_1008415992 91
160 3300005549 Ga0070704_100041967 Ga0070704_1000419673 91
161 3300005564 Ga0070664_101315843 Ga0070664_1013158432 91
162 3300005578 Ga0068854_100339465 Ga0068854_1003394651 91
163 3300005578 Ga0068854_100969528 Ga0068854_1009695281 91
164 3300005615 Ga0070702_100395936 Ga0070702_1003959362 91
165 3300005618 Ga0068864_100409789 Ga0068864_1004097892 91
166 3300005718 Ga0068866_10055194 Ga0068866_100551942 91
167 3300005719 Ga0068861_100006918 Ga0068861_1000069182 91
168 3300005840 Ga0068870_10353544 Ga0068870_103535442 91
169 3300005841 Ga0068863_101359322 Ga0068863_1013593222 91
170 3300005841 Ga0068863_102526692 Ga0068863_1025266921 91
171 3300005842 Ga0068858_100237538 Ga0068858_1002375382 91
172 3300005842 Ga0068858_102141505 Ga0068858_1021415051 91
173 3300005844 Ga0068862_100663317 Ga0068862_1006633172 91
174 3300005844 Ga0068862_100961143 Ga0068862_1009611432 91
175 3300005844 Ga0068862_102350884 Ga0068862_1023508842 91
176 3300005981 Ga0081538_10000279 Ga0081538_100002797 91
177 3300006028 Ga0070717_10644140 Ga0070717_106441402 91
178 3300006048 Ga0075363_100816439 Ga0075363_1008164391 91
179 3300006846 Ga0075430_101466859 Ga0075430_1014668591 91
180 3300006852 Ga0075433_10343470 Ga0075433_103434702 91
181 3300009094 Ga0111539_10027975 Ga0111539_100279755 91
182 3300009094 Ga0111539_10209172 Ga0111539_102091725 91
183 3300009094 Ga0111539_10473183 Ga0111539_104731832 91
184 3300009098 Ga0105245_10077307 Ga0105245_100773072 91
185 3300009147 Ga0114129_10003125 Ga0114129_1000312523 91
186 3300009147 Ga0114129_11514497 Ga0114129_115144972 91
187 3300009148 Ga0105243_11862039 Ga0105243_118620391 91
188 3300009174 Ga0105241_11746975 Ga0105241_117469752 91
189 3300009176 Ga0105242_10039176 Ga0105242_100391763 91
190 3300009551 Ga0105238_11769007 Ga0105238_117690071 91
191 3300009553 Ga0105249_10036123 Ga0105249_100361232 91
192 3300010375 Ga0105239_10100146 Ga0105239_101001462 91
193 3300012503 Ga0157313_1029190 Ga0157313_10291902 91
194 3300013102 Ga0157371_11215268 Ga0157371_112152682 91
195 3300013104 Ga0157370_10048494 Ga0157370_100484945 91
196 3300013105 Ga0157369_11047114 Ga0157369_110471141 91
197 3300013296 Ga0157374_10652351 Ga0157374_106523512 91
198 3300013296 Ga0157374_11695567 Ga0157374_116955672 91
199 3300013306 Ga0163162_10270040 Ga0163162_102700402 91
200 3300013307 Ga0157372_11258929 Ga0157372_112589292 91
201 3300013307 Ga0157372_12424201 Ga0157372_124242012 91
202 3300013307 Ga0157372_12581419 Ga0157372_125814192 91
203 3300013307 Ga0157372_12603839 Ga0157372_126038391 91
204 3300014325 Ga0163163_11074554 Ga0163163_110745542 91
205 3300014326 Ga0157380_11499270 Ga0157380_114992702 91
206 3300014326 Ga0157380_11515490 Ga0157380_115154902 91
207 3300014745 Ga0157377_10278337 Ga0157377_102783373 91
208 3300014745 Ga0157377_10940968 Ga0157377_109409681 91
209 3300014968 Ga0157379_11173505 Ga0157379_111735051 91
210 3300017792 Ga0163161_10450221 Ga0163161_104502212 91
211 3300020075 Ga0206349_1620359 Ga0206349_16203592 91
212 3300020081 Ga0206354_11360633 Ga0206354_113606332 91
213 3300021358 Ga0213873_10007996 Ga0213873_100079963 91
214 3300021388 Ga0213875_10000050 Ga0213875_10000050135 91
215 3300022467 Ga0224712_10541438 Ga0224712_105414382 91
216 3300025900 Ga0207710_10436570 Ga0207710_104365701 91
217 3300025900 Ga0207710_10638640 Ga0207710_106386402 91
218 3300025903 Ga0207680_10761005 Ga0207680_107610052 91
219 3300025909 Ga0207705_10257525 Ga0207705_102575252 91
220 3300025917 Ga0207660_10233488 Ga0207660_102334881 91
221 3300025918 Ga0207662_10102582 Ga0207662_101025822 91
222 3300025919 Ga0207657_10146651 Ga0207657_101466511 91
223 3300025921 Ga0207652_10166130 Ga0207652_101661302 91
224 3300025925 Ga0207650_10294751 Ga0207650_102947512 91
225 3300025925 Ga0207650_10359651 Ga0207650_103596513 91
226 3300025929 Ga0207664_10030891 Ga0207664_100308916 91
227 3300025931 Ga0207644_10493437 Ga0207644_104934371 91
228 3300025933 Ga0207706_10829646 Ga0207706_108296462 91
229 3300025934 Ga0207686_10238903 Ga0207686_102389032 91
230 3300025935 Ga0207709_10965894 Ga0207709_109658942 91
231 3300025937 Ga0207669_10370892 Ga0207669_103708922 91
232 3300025937 Ga0207669_10537846 Ga0207669_105378461 91
233 3300025937 Ga0207669_11270775 Ga0207669_112707751 91
234 3300025941 Ga0207711_11459140 Ga0207711_114591402 91
235 3300025942 Ga0207689_11795350 Ga0207689_117953501 91
236 3300025942 Ga0207689_11798832 Ga0207689_117988322 91
237 3300025944 Ga0207661_10068052 Ga0207661_100680523 91
238 3300025944 Ga0207661_12085973 Ga0207661_120859732 91
239 3300025945 Ga0207679_11120391 Ga0207679_111203912 91
240 3300025960 Ga0207651_10070170 Ga0207651_100701702 91
241 3300025960 Ga0207651_10801244 Ga0207651_108012442 91
242 3300025960 Ga0207651_11826283 Ga0207651_118262831 91
243 3300025972 Ga0207668_10779735 Ga0207668_107797352 91
244 3300025981 Ga0207640_10258311 Ga0207640_102583112 91
245 3300025981 Ga0207640_11165485 Ga0207640_111654852 91
246 3300026035 Ga0207703_10371830 Ga0207703_103718302 91
247 3300026035 Ga0207703_11418468 Ga0207703_114184682 91
248 3300026041 Ga0207639_11345096 Ga0207639_113450962 91
249 3300026088 Ga0207641_10983126 Ga0207641_109831262 91
250 3300026095 Ga0207676_11952906 Ga0207676_119529062 91
251 3300026116 Ga0207674_11290141 Ga0207674_112901411 91
252 3300026121 Ga0207683_10202436 Ga0207683_102024362 91
253 3300026121 Ga0207683_11034158 Ga0207683_110341582 91
254 3300028380 Ga0268265_10139262 Ga0268265_101392622 91
255 3300028380 Ga0268265_10634272 Ga0268265_106342722 91
256 3300028558 Ga0265326_10088075 Ga0265326_100880752 91
257 3300028563 Ga0265319_1001259 Ga0265319_100125914 91
258 3300028573 Ga0265334_10100822 Ga0265334_101008222 91
259 3300028577 Ga0265318_10099091 Ga0265318_100990912 91
260 3300031238 Ga0265332_10116420 Ga0265332_101164202 91
261 3300031240 Ga0265320_10039041 Ga0265320_100390413 91
262 3300031249 Ga0265339_10084137 Ga0265339_100841373 91
263 3300031344 Ga0265316_10075901 Ga0265316_100759014 91
264 3300031711 Ga0265314_10036397 Ga0265314_100363972 91
265 3300031712 Ga0265342_10247026 Ga0265342_102470262 91
266 3300031852 Ga0307410_10131364 Ga0307410_101313642 91
267 3300031903 Ga0307407_10450093 Ga0307407_104500932 91
268 3300031995 Ga0307409_100503708 Ga0307409_1005037082 91
269 3300032002 Ga0307416_101200859 Ga0307416_1012008592 91
270 3300034817 Ga0373948_0044978 Ga0373948_0044978_295_573 91
271 3300034957 Ga0373938_0045801 Ga0373938_0045801_309_587 91
272 3300035085 Ga0373929_0103661 Ga0373929_0103661_30_308 91
273 3300035092 Ga0373952_0243528 Ga0373952_0243528_234_512 91
274 3300035112 Ga0373932_0281751 Ga0373932_0281751_195_473 91
275 3300035172 Ga0373955_0094840 Ga0373955_0094840_237_515 91
276 3300035241 Ga0373961_0052615 Ga0373961_0052615_789_1067 91
277 3300035691 Ga0373931_0025368 Ga0373931_0025368_2697_2975 91
278 3300035724 Ga0373933_0203679 Ga0373933_0203679_501_779 91
279 3300036401 Ga0373937_0010709 Ga0373937_0010709_432_710 91
280 3300036457 Ga0265778_042238 Ga0265778_042238_44_319 91
281 3300037312 Ga0395899_0032604 Ga0395899_0032604_1950_2231 91
282 3300037312 Ga0395899_0934559 Ga0395899_0934559_154_435 91
283 3300037466 Ga0395898_0520745 Ga0395898_0520745_819_1094 91
284 3300037853 Ga0436364_0363596 Ga0436364_0363596_5037_5330 91
285 3300037853 Ga0436364_0532382 Ga0436364_0532382_21868_22146 91
286 3300038443 Ga0395901_0004943 Ga0395901_0004943_1885_2160 91
287 3300038443 Ga0395901_2063598 Ga0395901_2063598_13_294 91
288 3300039437 Ga0436365_0532644 Ga0436365_0532644_750_1025 91
289 3300039437 Ga0436365_1270888 Ga0436365_1270888_1131_1424 91
290 3300039437 Ga0436365_1704131 Ga0436365_1704131_3001_3276 91
291 3300039450 Ga0436363_0112801 Ga0436363_0112801_167_445 91
292 3300039453 Ga0436362_0100819 Ga0436362_0100819_2385_2660 91
293 3300044684 Ga0466966_0069468 Ga0466966_0069468_1881_2156 91
294 3300044693 Ga0466961_0003908 Ga0466961_0003908_4751_5044 91
295 3300044694 Ga0466963_0415979 Ga0466963_0415979_150_617 91
296 3300044694 Ga0466963_1243074 Ga0466963_1243074_168_446 91
297 3300044765 Ga0466970_0652664 Ga0466970_0652664_261_554 91
298 3300045049 Ga0466959_0104296 Ga0466959_0104296_872_1165 91
299 3300045049 Ga0466959_0543425 Ga0466959_0543425_489_764 91
300 3300045049 Ga0466959_0591218 Ga0466959_0591218_255_536 91
301 3300045836 Ga0466958_0089340 Ga0466958_0089340_1008_1286 91
302 3300045836 Ga0466958_0108348 Ga0466958_0108348_349_642 91
303 3300045976 Ga0466967_0061214 Ga0466967_0061214_2375_2653 91
304 3300046463 Ga0495653_0052458 Ga0495653_0052458_2637_2912 91
305 3300046463 Ga0495653_0431435 Ga0495653_0431435_339_617 91
306 3300046476 Ga0495662_0316440 Ga0495662_0316440_467_745 91
307 3300046514 Ga0495618_0074436 Ga0495618_0074436_61_336 91
308 3300046516 Ga0495628_0410281 Ga0495628_0410281_46_321 91
309 3300046516 Ga0495628_1251622 Ga0495628_1251622_56_334 91
310 3300046529 Ga0495652_0073699 Ga0495652_0073699_928_1203 91
311 3300046533 Ga0495640_0259653 Ga0495640_0259653_21_296 91
312 3300046559 Ga0495667_0208190 Ga0495667_0208190_499_774 91
313 3300046642 Ga0495634_0039203 Ga0495634_0039203_265_540 91
314 3300046663 Ga0495635_0132295 Ga0495635_0132295_28_306 91
315 3300046689 Ga0495613_0585575 Ga0495613_0585575_215_493 91
316 3300046692 Ga0495671_0123687 Ga0495671_0123687_34_312 91
317 3300046794 Ga0495589_0075315 Ga0495589_0075315_1202_1480 91
318 3300047317 Ga0495604_0197340 Ga0495604_0197340_1075_1350 91
319 3300047319 Ga0495674_0282608 Ga0495674_0282608_1033_1308 91
320 3300047322 Ga0495680_0354455 Ga0495680_0354455_452_727 91
321 3300047323 Ga0495683_0410357 Ga0495683_0410357_211_489 91
322 3300047444 Ga0495675_0241337 Ga0495675_0241337_529_807 91
323 3300047471 Ga0495684_0560321 Ga0495684_0560321_462_737 91
324 3300048905 Ga0496102_0097102 Ga0496102_0097102_2370_2648 91
325 3300048909 Ga0496106_0032168 Ga0496106_0032168_2228_2506 91
326 3300048914 Ga0496111_0032511 Ga0496111_0032511_2651_2929 91
327 3300048914 Ga0496111_0124566 Ga0496111_0124566_165_443 91
328 3300048915 Ga0496112_0092940 Ga0496112_0092940_2506_2784 91
329 3300049539 Ga0501323_014405 Ga0501323_014405_567_845 91
330 3300049569 Ga0501032_1051789 Ga0501032_1051789_14_313 91
331 3300049570 Ga0501033_0714583 Ga0501033_0714583_388_666 91
332 3300049576 Ga0501040_0548644 Ga0501040_0548644_396_674 91
333 3300049586 Ga0501070_0148041 Ga0501070_0148041_885_1184 91
334 3300049741 Ga0501079_1200053 Ga0501079_1200053_45_323 91
335 3300049744 Ga0501083_0567182 Ga0501083_0567182_149_427 91
336 3300050490 nmdc:mga03n38_359155_c1 nmdc:mga03n38_359155_c1_421_696 91
337 3300050507 nmdc:mga05p37_1610760_c1 nmdc:mga05p37_1610760_c1_33_311 91
338 3300050507 nmdc:mga05p37_1685_c1 nmdc:mga05p37_1685_c1_21266_21544 91
339 3300050508 nmdc:mga09592_27705_c1 nmdc:mga09592_27705_c1_1451_1729 91
340 3300050509 nmdc:mga0qj67_11680_c1 nmdc:mga0qj67_11680_c1_6292_6570 91
341 3300050509 nmdc:mga0qj67_307274_c1 nmdc:mga0qj67_307274_c1_80_358 91
342 3300050510 nmdc:mga06r32_1451555_c1 nmdc:mga06r32_1451555_c1_183_461 91
343 3300050511 nmdc:mga08y16_136835_c1 nmdc:mga08y16_136835_c1_1438_1716 91
344 3300050511 nmdc:mga08y16_206708_c1 nmdc:mga08y16_206708_c1_1731_2009 91
345 3300050511 nmdc:mga08y16_534446_c1 nmdc:mga08y16_534446_c1_819_1097 91
346 3300050514 nmdc:mga08x19_834477_c1 nmdc:mga08x19_834477_c1_291_569 91
347 3300053077 Ga0495601_0081753 Ga0495601_0081753_1604_1879 91
348 3300053078 Ga0495612_0033941 Ga0495612_0033941_1125_1403 91
349 3300053085 Ga0495619_0403758 Ga0495619_0403758_455_730 91
350 3300061734 Ga0530510_0949410 Ga0530510_0949410_70_351 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

5

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9657 2 85
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.9483 2 86
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9413 1 90
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9356 1 87
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9313 1 90
ID Description Score Start End Superfamily
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9534 2 85 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9413 1 90 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9316 2 85 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9313 1 90 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8702 3 90 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A538KAC5-F1-model_v4 MoaD/ThiS family protein 0.9972 1 90
AF-A0A7V9RV42-F1-model_v4 MoaD/ThiS family protein 0.9908 1 90
AF-A0A535CTT0-F1-model_v4 MoaD/ThiS family protein 0.9878 1 90
AF-A0A7C3P5J4-F1-model_v4 MoaD/ThiS family protein 0.9796 1 91
AF-A0A3N5I5V9-F1-model_v4 MoaD/ThiS family protein 0.9785 1 91

Feature Viewer

pLDDT pTM Quality
93.1 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map