F418085

General Info

Members Datasets Scaffolds Average Seq Length
349 197 698 353

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932398195|2932399452
Length 403
Sequence GPGAYRPRASKVDAVTAALDLTADPVDLTRALVDIASPSREEAAIAGAVHTALASVVAGFTGPAAGRTELVRDGHRVLARTSRGLPTRVVLAGHLDTVPVADNVPCRLTGEGADLVLHGCGTVDMKSGDAVFLHLFATLADSAELAHDLTLVLYDCEEIEATANGLGFLERTHRDWLTGDVAILGEPTGGLIEAGCQGTLRIRVHARGTRAHSARSWLGDNAVHRLAPVLAALGAYNARSVDIDGCVYREGLQAVRMSAGVAGNTVPDEAWLDVNFRFAPDRDTDAALAHALDALGLTGSGRVPAGGEPPSDHGLYWELTDLSPGALPGLGAPAAAELVRAAGGRVRAKYGWTDVSRFAALGVPAVNLGPGDPGLAHTRDEHCPATQITEVVEVLRAYLTTSG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
180 2547132424 Nocardia nova SH22a Isolate Unclassified
181 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
182 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
183 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
184 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
185 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
186 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
187 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
188 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
189 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
190 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
191 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
192 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
193 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
194 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
195 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
196 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
197 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0.29
Rhizoplane 2.01
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10015877 3300003320 Bacteria 3270
2 Ga0070658_10058970 3300005327 Bacteria 3125
3 Ga0070658_10062652 3300005327 Bacteria 3031
4 Ga0070658_10102287 3300005327 Bacteria 2369
5 Ga0070682_100082706 3300005337 Bacteria 2082
6 Ga0070668_100103590 3300005347 Bacteria 2257
7 Ga0070667_100255965 3300005367 Bacteria 1566
8 Ga0070713_100255541 3300005436 Bacteria 1600
9 Ga0070700_100158249 3300005441 Bacteria 1556
10 Ga0070663_100094543 3300005455 Bacteria 2220
11 Ga0070681_10188376 3300005458 Bacteria 1983
12 Ga0070685_10045449 3300005466 Bacteria 2519
13 Ga0070685_10082712 3300005466 Bacteria 1927
14 Ga0070679_100059205 3300005530 Bacteria 3818
15 Ga0070684_100174379 3300005535 Bacteria 1954
16 Ga0068853_100008943 3300005539 Bacteria 8065
17 Ga0070672_100123093 3300005543 Bacteria 2125
18 Ga0070665_100008664 3300005548 Bacteria 10295
19 Ga0068855_100004853 3300005563 Bacteria 16415
20 Ga0068855_100006352 3300005563 Bacteria 14401
21 Ga0068854_100000480 3300005578 Bacteria 24423
22 Ga0068854_100047859 3300005578 Bacteria 3048
23 Ga0068856_100214089 3300005614 Bacteria 1942
24 Ga0070702_100111057 3300005615 Bacteria 1699
25 Ga0070702_100202348 3300005615 Bacteria 1315
26 Ga0068852_100135119 3300005616 Bacteria 2276
27 Ga0068864_100119532 3300005618 Bacteria 2354
28 Ga0068860_100148066 3300005843 Bacteria 2260
29 Ga0081455_10113381 3300005937 Bacteria 2150
30 Ga0081539_10000272 3300005985 Bacteria 118649
31 Ga0075363_100009035 3300006048 Bacteria 4675
32 Ga0068865_100303487 3300006881 Bacteria 1279
33 Ga0105240_10002202 3300009093 Bacteria 31785
34 Ga0105240_10034595 3300009093 Bacteria 6516
35 Ga0111539_10114393 3300009094 Bacteria 3164
36 Ga0105245_10040017 3300009098 Bacteria 4174
37 Ga0105245_10300386 3300009098 Bacteria 1575
38 Ga0105241_10298969 3300009174 Bacteria 1381
39 Ga0105248_10398325 3300009177 Bacteria 1550
40 Ga0105237_10013611 3300009545 Bacteria 8523
41 Ga0105238_10034655 3300009551 Bacteria 5135
42 Ga0105239_10023850 3300010375 Bacteria 6737
43 Ga0105239_10393324 3300010375 Bacteria 1568
44 Ga0105239_10429257 3300010375 Bacteria 1498
45 Ga0105239_10476152 3300010375 Bacteria 1418
46 Ga0105246_10115221 3300011119 Bacteria 1982
47 Ga0157369_10125382 3300013105 Bacteria 2723
48 Ga0157374_10451331 3300013296 Bacteria 1287
49 Ga0163162_10184222 3300013306 Bacteria 2214
50 Ga0157372_10598524 3300013307 Bacteria 1285
51 Ga0157375_10254388 3300013308 Bacteria 1918
52 Ga0163163_10247305 3300014325 Bacteria 1833
53 Ga0163163_10475174 3300014325 Bacteria 1311
54 Ga0157379_10221291 3300014968 Bacteria 1715
55 Ga0157379_10258309 3300014968 Bacteria 1583
56 Ga0213876_10077834 3300021384 Bacteria 1752
57 Ga0213875_10003530 3300021388 Bacteria 8890
58 Ga0213875_10013867 3300021388 Bacteria 3944
59 Ga0207688_10073326 3300025901 Bacteria 1946
60 Ga0207688_10087494 3300025901 Bacteria 1786
61 Ga0207647_10010700 3300025904 Bacteria 6462
62 Ga0207643_10103752 3300025908 Bacteria 1669
63 Ga0207643_10150133 3300025908 Bacteria 1397
64 Ga0207705_10087365 3300025909 Bacteria 2280
65 Ga0207705_10117519 3300025909 Bacteria 1970
66 Ga0207705_10150328 3300025909 Bacteria 1745
67 Ga0207707_10127544 3300025912 Bacteria 2225
68 Ga0207695_10001339 3300025913 Bacteria 41803
69 Ga0207695_10037180 3300025913 Bacteria 5255
70 Ga0207671_10000084 3300025914 Bacteria 143562
71 Ga0207662_10160640 3300025918 Bacteria 1435
72 Ga0207657_10143257 3300025919 Bacteria 1951
73 Ga0207694_10000807 3300025924 Bacteria 27992
74 Ga0207650_10270323 3300025925 Bacteria 1381
75 Ga0207690_10114550 3300025932 Bacteria 1947
76 Ga0207706_10302940 3300025933 Bacteria 1392
77 Ga0207709_10242931 3300025935 Bacteria 1311
78 Ga0207691_10289541 3300025940 Bacteria 1409
79 Ga0207691_10293961 3300025940 Bacteria 1397
80 Ga0207689_10073916 3300025942 Bacteria 2801
81 Ga0207689_10174123 3300025942 Bacteria 1775
82 Ga0207689_10344136 3300025942 Bacteria 1239
83 Ga0207667_10049734 3300025949 Bacteria 4426
84 Ga0207640_10002189 3300025981 Bacteria 10507
85 Ga0207640_10091343 3300025981 Bacteria 2109
86 Ga0207658_10135018 3300025986 Bacteria 1988
87 Ga0207658_10249037 3300025986 Bacteria 1509
88 Ga0207639_10031481 3300026041 Bacteria 3899
89 Ga0207678_10048568 3300026067 Bacteria 3668
90 Ga0207678_10060503 3300026067 Bacteria 3258
91 Ga0207676_10127813 3300026095 Bacteria 2155
92 Ga0207675_100042012 3300026118 Bacteria 4268
93 Ga0207683_10176823 3300026121 Bacteria 1934
94 Ga0207698_10029899 3300026142 Bacteria 3909
95 Ga0207698_10118051 3300026142 Bacteria 2239
96 Ga0207428_10207801 3300027907 Bacteria 1472
97 Ga0268266_10079324 3300028379 Bacteria 2858
98 Ga0307513_10025128 3300031456 Bacteria 6912
99 Ga0307509_10149578 3300031507 Bacteria 2253
100 Ga0316579_10000576 3300031691 Bacteria 12273
101 Ga0316576_10005178 3300031727 Bacteria 7923
102 Ga0316576_10055733 3300031727 Bacteria 2885
103 Ga0316578_10001788 3300031728 Bacteria 9023
104 Ga0316578_10021092 3300031728 Bacteria 3613
105 Ga0316583_10024607 3300032133 Bacteria 2150
106 Ga0316580_10008578 3300032139 Bacteria 3063
107 Ga0316574_0023602 3300035398 Bacteria 3673
108 Ga0316582_0003824 3300036647 Bacteria 7481
109 Ga0316582_0019386 3300036647 Bacteria 3980
110 Ga0316584_0001201 3300036712 Bacteria 15333
111 Ga0316584_0064471 3300036712 Bacteria 2743
112 Ga0395900_0007073 3300037418 Bacteria 11622
113 Ga0395898_0098937 3300037466 Bacteria 2801
114 Ga0395898_0165512 3300037466 Bacteria 2115
115 Ga0395905_0040873 3300037471 Bacteria 4350
116 Ga0436364_0177961 3300037853 Bacteria 37248
117 Ga0436364_1546160 3300037853 Bacteria 10365
118 Ga0395901_0028766 3300038443 Bacteria 5717
119 Ga0395901_0134713 3300038443 Bacteria 2596
120 Ga0436365_1871383 3300039437 Bacteria 1423
121 Ga0466969_0056286 3300044656 Bacteria 1920
122 Ga0466969_0061391 3300044656 Bacteria 1826
123 Ga0466969_0101653 3300044656 Bacteria 1352
124 Ga0466972_0008927 3300044658 Bacteria 5028
125 Ga0466965_0010970 3300044683 Bacteria 4237
126 Ga0466961_0002024 3300044693 Bacteria 12629
127 Ga0466961_0025139 3300044693 Bacteria 3832
128 Ga0466961_0044600 3300044693 Bacteria 2838
129 Ga0466961_0057570 3300044693 Bacteria 2474
130 Ga0466961_0116685 3300044693 Bacteria 1677
131 Ga0466971_0000329 3300044719 Bacteria 18141
132 Ga0466970_0004990 3300044765 Bacteria 6556
133 Ga0466970_0009865 3300044765 Bacteria 4836
134 Ga0466957_0071537 3300044842 Bacteria 2145
135 Ga0466960_0002071 3300044901 Bacteria 7458
136 Ga0466959_0007967 3300045049 Bacteria 7463
137 Ga0466959_0062436 3300045049 Bacteria 2707
138 Ga0466959_0075840 3300045049 Bacteria 2429
139 Ga0466958_0002108 3300045836 Bacteria 9868
140 Ga0466958_0050206 3300045836 Bacteria 2525
141 Ga0466967_0005415 3300045976 Bacteria 8842
142 Ga0466967_0139944 3300045976 Bacteria 2253
143 Ga0495592_0139400 3300046454 Bacteria 1688
144 Ga0495603_0103679 3300046455 Bacteria 1660
145 Ga0495629_0015194 3300046459 Bacteria 5533
146 Ga0495629_0043199 3300046459 Bacteria 3165
147 Ga0495638_0042627 3300046460 Bacteria 2866
148 Ga0495651_0006132 3300046462 Bacteria 9178
149 Ga0495651_0007252 3300046462 Bacteria 8472
150 Ga0495651_0162686 3300046462 Bacteria 1597
151 Ga0495650_0033596 3300046471 Bacteria 2281
152 Ga0495662_0051981 3300046476 Bacteria 1978
153 Ga0495585_0005601 3300046492 Bacteria 7891
154 Ga0495594_0069048 3300046499 Bacteria 1963
155 Ga0495594_0184785 3300046499 Bacteria 1187
156 Ga0495607_0039926 3300046501 Bacteria 2799
157 Ga0495618_0012043 3300046514 Bacteria 5248
158 Ga0495618_0023162 3300046514 Bacteria 3838
159 Ga0495628_0004703 3300046516 Bacteria 12039
160 Ga0495628_0061523 3300046516 Bacteria 2944
161 Ga0495652_0000666 3300046529 Bacteria 39838
162 Ga0495652_0003400 3300046529 Bacteria 15732
163 Ga0495652_0039977 3300046529 Bacteria 4054
164 Ga0495645_0015075 3300046543 Bacteria 5492
165 Ga0495667_0216106 3300046559 Bacteria 1224
166 Ga0495634_0018599 3300046642 Bacteria 4943
167 Ga0495635_0062680 3300046663 Bacteria 2553
168 Ga0495657_0037402 3300046675 Bacteria 3346
169 Ga0495657_0061149 3300046675 Bacteria 2492
170 Ga0495599_0030907 3300046678 Bacteria 3362
171 Ga0495646_0162518 3300046680 Bacteria 1235
172 Ga0495613_0016791 3300046689 Bacteria 5451
173 Ga0495613_0098947 3300046689 Bacteria 2108
174 Ga0495600_0026877 3300046809 Bacteria 3717
175 Ga0495600_0038702 3300046809 Bacteria 3104
176 Ga0495600_0055353 3300046809 Bacteria 2591
177 Ga0495604_0003895 3300047317 Bacteria 11883
178 Ga0495604_0009117 3300047317 Bacteria 7853
179 Ga0495604_0018943 3300047317 Bacteria 5513
180 Ga0495604_0048254 3300047317 Bacteria 3312
181 Ga0495676_0016464 3300047321 Bacteria 6561
182 Ga0495676_0096272 3300047321 Bacteria 2201
183 Ga0495683_0000800 3300047323 Bacteria 22388
184 Ga0495675_0065664 3300047444 Bacteria 2294
185 Ga0495675_0072363 3300047444 Bacteria 2175
186 Ga0495685_036828 3300047447 Bacteria 1679
187 Ga0496101_0079985 3300048904 Bacteria 2414
188 Ga0496108_0145116 3300048911 Bacteria 2046
189 Ga0496109_0048134 3300048912 Bacteria 3879
190 Ga0496109_0156958 3300048912 Bacteria 2131
191 Ga0496110_0049615 3300048913 Bacteria 3683
192 Ga0496112_0002422 3300048915 Bacteria 15020
193 Ga0496113_0010022 3300048916 Bacteria 6249
194 Ga0496126_0107952 3300048929 Bacteria 2427
195 Ga0501031_0003380 3300049568 Bacteria 10250
196 Ga0501031_0003896 3300049568 Bacteria 9602
197 Ga0501031_0004098 3300049568 Bacteria 9413
198 Ga0501031_0086219 3300049568 Bacteria 2047
199 Ga0501032_0001468 3300049569 Bacteria 18774
200 Ga0501032_0003838 3300049569 Bacteria 11414
201 Ga0501032_0004262 3300049569 Bacteria 10804
202 Ga0501032_0071583 3300049569 Bacteria 2311
203 Ga0501033_0035843 3300049570 Bacteria 3718
204 Ga0501033_0116430 3300049570 Bacteria 1942
205 Ga0501033_0181743 3300049570 Bacteria 1507
206 Ga0501034_0008253 3300049571 Bacteria 11024
207 Ga0501034_0135907 3300049571 Bacteria 2439
208 Ga0501036_0023343 3300049572 Bacteria 5210
209 Ga0501036_0023890 3300049572 Bacteria 5152
210 Ga0501036_0042857 3300049572 Bacteria 3831
211 Ga0501036_0258137 3300049572 Bacteria 1460
212 Ga0501037_0003844 3300049573 Bacteria 10900
213 Ga0501037_0021347 3300049573 Bacteria 4783
214 Ga0501037_0215025 3300049573 Bacteria 1354
215 Ga0501038_0007991 3300049574 Bacteria 9747
216 Ga0501038_0012665 3300049574 Bacteria 7708
217 Ga0501038_0018003 3300049574 Bacteria 6380
218 Ga0501038_0027002 3300049574 Bacteria 5110
219 Ga0501038_0168972 3300049574 Bacteria 1772
220 Ga0501038_0333222 3300049574 Bacteria 1185
221 Ga0501039_0001924 3300049575 Bacteria 15387
222 Ga0501039_0031470 3300049575 Bacteria 4091
223 Ga0501039_0045466 3300049575 Bacteria 3392
224 Ga0501039_0291744 3300049575 Bacteria 1282
225 Ga0501039_0320213 3300049575 Unclassified 1219
226 Ga0501040_0003404 3300049576 Bacteria 10259
227 Ga0501040_0004025 3300049576 Bacteria 9546
228 Ga0501040_0036232 3300049576 Bacteria 3347
229 Ga0501040_0112742 3300049576 Bacteria 1902
230 Ga0501040_0162633 3300049576 Bacteria 1578
231 Ga0501040_0296804 3300049576 Bacteria 1155
232 Ga0501041_0003948 3300049577 Bacteria 8556
233 Ga0501041_0038108 3300049577 Bacteria 2914
234 Ga0501041_0059500 3300049577 Bacteria 2338
235 Ga0501041_0163230 3300049577 Bacteria 1393
236 Ga0501042_0008970 3300049578 Bacteria 6640
237 Ga0501042_0014339 3300049578 Bacteria 5408
238 Ga0501042_0020386 3300049578 Bacteria 4614
239 Ga0501042_0077496 3300049578 Bacteria 2380
240 Ga0501043_0004077 3300049579 Bacteria 11930
241 Ga0501043_0034313 3300049579 Bacteria 3991
242 Ga0501043_0042235 3300049579 Bacteria 3583
243 Ga0501046_0023382 3300049580 Bacteria 5085
244 Ga0501046_0084094 3300049580 Bacteria 2455
245 Ga0501047_0000064 3300049581 Bacteria 136110
246 Ga0501047_0003182 3300049581 Bacteria 15562
247 Ga0501047_0008095 3300049581 Bacteria 9920
248 Ga0501047_0066672 3300049581 Bacteria 3470
249 Ga0501047_0238532 3300049581 Bacteria 1670
250 Ga0501048_0002896 3300049582 Bacteria 13099
251 Ga0501048_0008708 3300049582 Bacteria 7649
252 Ga0501048_0203568 3300049582 Unclassified 1403
253 Ga0501067_0081440 3300049583 Bacteria 1794
254 Ga0501068_0004581 3300049584 Bacteria 7518
255 Ga0501068_0035969 3300049584 Bacteria 2958
256 Ga0501069_0037122 3300049585 Bacteria 2688
257 Ga0501070_0009724 3300049586 Bacteria 8131
258 Ga0501070_0085733 3300049586 Bacteria 2608
259 Ga0501070_0131295 3300049586 Bacteria 2069
260 Ga0501071_0008338 3300049587 Bacteria 6845
261 Ga0501071_0011439 3300049587 Bacteria 5978
262 Ga0501071_0031014 3300049587 Bacteria 3786
263 Ga0501071_0048658 3300049587 Bacteria 3050
264 Ga0501071_0060071 3300049587 Bacteria 2751
265 Ga0501072_0001203 3300049588 Bacteria 19305
266 Ga0501072_0002509 3300049588 Bacteria 13747
267 Ga0501072_0102869 3300049588 Bacteria 2270
268 Ga0501073_0014546 3300049589 Bacteria 5716
269 Ga0501073_0138033 3300049589 Bacteria 1690
270 Ga0501074_0008519 3300049590 Bacteria 7429
271 Ga0501074_0019721 3300049590 Bacteria 4896
272 Ga0501074_0024139 3300049590 Bacteria 4418
273 Ga0501074_0305332 3300049590 Bacteria 1130
274 Ga0501075_0001150 3300049591 Bacteria 17089
275 Ga0501075_0002172 3300049591 Bacteria 12990
276 Ga0501075_0003732 3300049591 Bacteria 10238
277 Ga0501075_0027664 3300049591 Bacteria 4181
278 Ga0501075_0064571 3300049591 Bacteria 2761
279 Ga0501076_0002292 3300049592 Bacteria 13096
280 Ga0501076_0007406 3300049592 Bacteria 7987
281 Ga0501076_0100341 3300049592 Bacteria 2332
282 Ga0501077_0008911 3300049593 Bacteria 6225
283 Ga0501077_0015756 3300049593 Bacteria 4761
284 Ga0501077_0092163 3300049593 Bacteria 1920
285 Ga0501079_0003291 3300049741 Bacteria 11840
286 Ga0501079_0024391 3300049741 Bacteria 4640
287 Ga0501079_0057091 3300049741 Bacteria 3012
288 Ga0501080_0007553 3300049742 Bacteria 9826
289 Ga0501081_0006026 3300049743 Bacteria 7847
290 Ga0501081_0014568 3300049743 Bacteria 5188
291 Ga0501081_0219196 3300049743 Bacteria 1383
292 Ga0501081_0317562 3300049743 Bacteria 1144
293 Ga0501083_0002149 3300049744 Bacteria 13523
294 Ga0501083_0110175 3300049744 Bacteria 1810
295 Ga0501035_0003389 3300049822 Bacteria 15250
296 Ga0501035_0022969 3300049822 Bacteria 5725
297 Ga0501044_0005544 3300049823 Bacteria 14011
298 Ga0501044_0025281 3300049823 Bacteria 6293
299 Ga0501044_0070171 3300049823 Bacteria 3565
300 Ga0501044_0111719 3300049823 Bacteria 2740
301 Ga0501044_0159110 3300049823 Bacteria 2237
302 Ga0501044_0160090 3300049823 Bacteria 2229
303 Ga0501044_0240930 3300049823 Bacteria 1752
304 Ga0501045_0022277 3300049824 Bacteria 4535
305 Ga0501045_0091404 3300049824 Bacteria 2250
306 Ga0501045_0142299 3300049824 Bacteria 1783
307 Ga0501045_0225277 3300049824 Bacteria 1396
308 nmdc:mga03n38_1305_c1 3300050490 Bacteria 7036
309 nmdc:mga06r32_25_c5 3300050510 Bacteria 17189
310 nmdc:mga08y16_150082_c1 3300050511 Bacteria 2423
311 Ga0495601_0049753 3300053077 Bacteria 2643
312 Ga0495612_0011047 3300053078 Bacteria 3644
313 Ga0500641_0046570 3300053096 Bacteria 1771
314 Ga0500652_003199 3300053131 Bacteria 4949
315 Ga0500616_0000151 3300053153 Bacteria 116796
316 Ga0500645_000516 3300053730 Bacteria 25902
317 Ga0501084_0002605 3300054114 Bacteria 14528
318 Ga0501084_0022848 3300054114 Bacteria 5218
319 Ga0501084_0042103 3300054114 Bacteria 3820
320 Ga0501084_0122239 3300054114 Bacteria 2189
321 Ga0501082_0015873 3300060353 Bacteria 6476
322 Ga0501082_0046465 3300060353 Bacteria 3742
323 Ga0501082_0074990 3300060353 Bacteria 2914
324 Ga0501082_0117823 3300060353 Bacteria 2300
325 Ga0501082_0382711 3300060353 Bacteria 1228
326 Ga0466962_0000622 3300061719 Bacteria 15716
327 Ga0530510_0004591 3300061734 Bacteria 9548
328 Ga0530510_0004793 3300061734 Bacteria 9367
329 Ga0530510_0004958 3300061734 Bacteria 9194
330 Ga0530510_0122170 3300061734 Bacteria 1912
331 2932399452 2932398195 Bacteria 3847976
332 2548698703 2547132424 Bacteria 8348532
333 2558909317 2558860112 Bacteria 9931328
334 2623500552 2622736605 Bacteria 4992138
335 2644017488 2643221601 Bacteria 7493239
336 2686533915 2684623035 Bacteria 8032739
337 2689995353 2687453743 Bacteria 8361025
338 2738706521 2738541274 Bacteria 6909446
339 2739333140 2738543028 Bacteria 6917070
340 2784471583 2784132109 Bacteria 3141763
341 2816511577 2816332139 Bacteria 9138787
342 2819740836 2818991472 Bacteria 10089953
343 2842890907 2842888712 Bacteria 4279094
344 2870783445 2870782633 Bacteria 9624083
345 2895880980 2895880812 Bacteria 11255272
346 2902799931 2902799365 Bacteria 5419524
347 2919719379 2919713450 Bacteria 7431245
348 3006323893 3006321560 Bacteria 8247479
349 8054475726 8054472261 Bacteria 7464355
350 rootH2_10015877
351 Ga0070658_10058970
352 Ga0070658_10062652
353 Ga0070658_10102287
354 Ga0070682_100082706
355 Ga0070668_100103590
356 Ga0070667_100255965
357 Ga0070713_100255541
358 Ga0070700_100158249
359 Ga0070663_100094543
360 Ga0070681_10188376
361 Ga0070685_10045449
362 Ga0070685_10082712
363 Ga0070679_100059205
364 Ga0070684_100174379
365 Ga0068853_100008943
366 Ga0070672_100123093
367 Ga0070665_100008664
368 Ga0068855_100004853
369 Ga0068855_100006352
370 Ga0068854_100000480
371 Ga0068854_100047859
372 Ga0068856_100214089
373 Ga0070702_100111057
374 Ga0070702_100202348
375 Ga0068852_100135119
376 Ga0068864_100119532
377 Ga0068860_100148066
378 Ga0081455_10113381
379 Ga0081539_10000272
380 Ga0075363_100009035
381 Ga0068865_100303487
382 Ga0105240_10002202
383 Ga0105240_10034595
384 Ga0111539_10114393
385 Ga0105245_10040017
386 Ga0105245_10300386
387 Ga0105241_10298969
388 Ga0105248_10398325
389 Ga0105237_10013611
390 Ga0105238_10034655
391 Ga0105239_10023850
392 Ga0105239_10393324
393 Ga0105239_10429257
394 Ga0105239_10476152
395 Ga0105246_10115221
396 Ga0157369_10125382
397 Ga0157374_10451331
398 Ga0163162_10184222
399 Ga0157372_10598524
400 Ga0157375_10254388
401 Ga0163163_10247305
402 Ga0163163_10475174
403 Ga0157379_10221291
404 Ga0157379_10258309
405 Ga0213876_10077834
406 Ga0213875_10003530
407 Ga0213875_10013867
408 Ga0207688_10073326
409 Ga0207688_10087494
410 Ga0207647_10010700
411 Ga0207643_10103752
412 Ga0207643_10150133
413 Ga0207705_10087365
414 Ga0207705_10117519
415 Ga0207705_10150328
416 Ga0207707_10127544
417 Ga0207695_10001339
418 Ga0207695_10037180
419 Ga0207671_10000084
420 Ga0207662_10160640
421 Ga0207657_10143257
422 Ga0207694_10000807
423 Ga0207650_10270323
424 Ga0207690_10114550
425 Ga0207706_10302940
426 Ga0207709_10242931
427 Ga0207691_10289541
428 Ga0207691_10293961
429 Ga0207689_10073916
430 Ga0207689_10174123
431 Ga0207689_10344136
432 Ga0207667_10049734
433 Ga0207640_10002189
434 Ga0207640_10091343
435 Ga0207658_10135018
436 Ga0207658_10249037
437 Ga0207639_10031481
438 Ga0207678_10048568
439 Ga0207678_10060503
440 Ga0207676_10127813
441 Ga0207675_100042012
442 Ga0207683_10176823
443 Ga0207698_10029899
444 Ga0207698_10118051
445 Ga0207428_10207801
446 Ga0268266_10079324
447 Ga0307513_10025128
448 Ga0307509_10149578
449 Ga0316579_10000576
450 Ga0316576_10005178
451 Ga0316576_10055733
452 Ga0316578_10001788
453 Ga0316578_10021092
454 Ga0316583_10024607
455 Ga0316580_10008578
456 Ga0316574_0023602
457 Ga0316582_0003824
458 Ga0316582_0019386
459 Ga0316584_0001201
460 Ga0316584_0064471
461 Ga0395900_0007073
462 Ga0395898_0098937
463 Ga0395898_0165512
464 Ga0395905_0040873
465 Ga0436364_0177961
466 Ga0436364_1546160
467 Ga0395901_0028766
468 Ga0395901_0134713
469 Ga0436365_1871383
470 Ga0466969_0056286
471 Ga0466969_0061391
472 Ga0466969_0101653
473 Ga0466972_0008927
474 Ga0466965_0010970
475 Ga0466961_0002024
476 Ga0466961_0025139
477 Ga0466961_0044600
478 Ga0466961_0057570
479 Ga0466961_0116685
480 Ga0466971_0000329
481 Ga0466970_0004990
482 Ga0466970_0009865
483 Ga0466957_0071537
484 Ga0466960_0002071
485 Ga0466959_0007967
486 Ga0466959_0062436
487 Ga0466959_0075840
488 Ga0466958_0002108
489 Ga0466958_0050206
490 Ga0466967_0005415
491 Ga0466967_0139944
492 Ga0495592_0139400
493 Ga0495603_0103679
494 Ga0495629_0015194
495 Ga0495629_0043199
496 Ga0495638_0042627
497 Ga0495651_0006132
498 Ga0495651_0007252
499 Ga0495651_0162686
500 Ga0495650_0033596
501 Ga0495662_0051981
502 Ga0495585_0005601
503 Ga0495594_0069048
504 Ga0495594_0184785
505 Ga0495607_0039926
506 Ga0495618_0012043
507 Ga0495618_0023162
508 Ga0495628_0004703
509 Ga0495628_0061523
510 Ga0495652_0000666
511 Ga0495652_0003400
512 Ga0495652_0039977
513 Ga0495645_0015075
514 Ga0495667_0216106
515 Ga0495634_0018599
516 Ga0495635_0062680
517 Ga0495657_0037402
518 Ga0495657_0061149
519 Ga0495599_0030907
520 Ga0495646_0162518
521 Ga0495613_0016791
522 Ga0495613_0098947
523 Ga0495600_0026877
524 Ga0495600_0038702
525 Ga0495600_0055353
526 Ga0495604_0003895
527 Ga0495604_0009117
528 Ga0495604_0018943
529 Ga0495604_0048254
530 Ga0495676_0016464
531 Ga0495676_0096272
532 Ga0495683_0000800
533 Ga0495675_0065664
534 Ga0495675_0072363
535 Ga0495685_036828
536 Ga0496101_0079985
537 Ga0496108_0145116
538 Ga0496109_0048134
539 Ga0496109_0156958
540 Ga0496110_0049615
541 Ga0496112_0002422
542 Ga0496113_0010022
543 Ga0496126_0107952
544 Ga0501031_0003380
545 Ga0501031_0003896
546 Ga0501031_0004098
547 Ga0501031_0086219
548 Ga0501032_0001468
549 Ga0501032_0003838
550 Ga0501032_0004262
551 Ga0501032_0071583
552 Ga0501033_0035843
553 Ga0501033_0116430
554 Ga0501033_0181743
555 Ga0501034_0008253
556 Ga0501034_0135907
557 Ga0501036_0023343
558 Ga0501036_0023890
559 Ga0501036_0042857
560 Ga0501036_0258137
561 Ga0501037_0003844
562 Ga0501037_0021347
563 Ga0501037_0215025
564 Ga0501038_0007991
565 Ga0501038_0012665
566 Ga0501038_0018003
567 Ga0501038_0027002
568 Ga0501038_0168972
569 Ga0501038_0333222
570 Ga0501039_0001924
571 Ga0501039_0031470
572 Ga0501039_0045466
573 Ga0501039_0291744
574 Ga0501039_0320213
575 Ga0501040_0003404
576 Ga0501040_0004025
577 Ga0501040_0036232
578 Ga0501040_0112742
579 Ga0501040_0162633
580 Ga0501040_0296804
581 Ga0501041_0003948
582 Ga0501041_0038108
583 Ga0501041_0059500
584 Ga0501041_0163230
585 Ga0501042_0008970
586 Ga0501042_0014339
587 Ga0501042_0020386
588 Ga0501042_0077496
589 Ga0501043_0004077
590 Ga0501043_0034313
591 Ga0501043_0042235
592 Ga0501046_0023382
593 Ga0501046_0084094
594 Ga0501047_0000064
595 Ga0501047_0003182
596 Ga0501047_0008095
597 Ga0501047_0066672
598 Ga0501047_0238532
599 Ga0501048_0002896
600 Ga0501048_0008708
601 Ga0501048_0203568
602 Ga0501067_0081440
603 Ga0501068_0004581
604 Ga0501068_0035969
605 Ga0501069_0037122
606 Ga0501070_0009724
607 Ga0501070_0085733
608 Ga0501070_0131295
609 Ga0501071_0008338
610 Ga0501071_0011439
611 Ga0501071_0031014
612 Ga0501071_0048658
613 Ga0501071_0060071
614 Ga0501072_0001203
615 Ga0501072_0002509
616 Ga0501072_0102869
617 Ga0501073_0014546
618 Ga0501073_0138033
619 Ga0501074_0008519
620 Ga0501074_0019721
621 Ga0501074_0024139
622 Ga0501074_0305332
623 Ga0501075_0001150
624 Ga0501075_0002172
625 Ga0501075_0003732
626 Ga0501075_0027664
627 Ga0501075_0064571
628 Ga0501076_0002292
629 Ga0501076_0007406
630 Ga0501076_0100341
631 Ga0501077_0008911
632 Ga0501077_0015756
633 Ga0501077_0092163
634 Ga0501079_0003291
635 Ga0501079_0024391
636 Ga0501079_0057091
637 Ga0501080_0007553
638 Ga0501081_0006026
639 Ga0501081_0014568
640 Ga0501081_0219196
641 Ga0501081_0317562
642 Ga0501083_0002149
643 Ga0501083_0110175
644 Ga0501035_0003389
645 Ga0501035_0022969
646 Ga0501044_0005544
647 Ga0501044_0025281
648 Ga0501044_0070171
649 Ga0501044_0111719
650 Ga0501044_0159110
651 Ga0501044_0160090
652 Ga0501044_0240930
653 Ga0501045_0022277
654 Ga0501045_0091404
655 Ga0501045_0142299
656 Ga0501045_0225277
657 nmdc:mga03n38_1305_c1
658 nmdc:mga06r32_25_c5
659 nmdc:mga08y16_150082_c1
660 Ga0495601_0049753
661 Ga0495612_0011047
662 Ga0500641_0046570
663 Ga0500652_003199
664 Ga0500616_0000151
665 Ga0500645_000516
666 Ga0501084_0002605
667 Ga0501084_0022848
668 Ga0501084_0042103
669 Ga0501084_0122239
670 Ga0501082_0015873
671 Ga0501082_0046465
672 Ga0501082_0074990
673 Ga0501082_0117823
674 Ga0501082_0382711
675 Ga0466962_0000622
676 Ga0530510_0004591
677 Ga0530510_0004793
678 Ga0530510_0004958
679 Ga0530510_0122170
680 2932399452
681 2548698703
682 2558909317
683 2623500552
684 2644017488
685 2686533915
686 2689995353
687 2738706521
688 2739333140
689 2784471583
690 2816511577
691 2819740836
692 2842890907
693 2870783445
694 2895880980
695 2902799931
696 2919719379
697 3006323893
698 8054475726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

195

298

0.91

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

90

401

0.87

PF04389

Peptidase_M28

Peptidase family M28

76

179

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tx8-assembly1.cif.gz_A-2 crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution 0.9356 9 359
3tx8-assembly1.cif.gz_A-2 crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution 0.9105 9 359
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8921 13 360
3ct9-assembly1.cif.gz_A crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8627 12 360
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8585 13 360
ID Description Score Start End Superfamily
3tx8A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.944 9 359 3.40.630.10
af_P9WHS9_166_276_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9385 176 283 3.40.630.10
3tx8A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.925 9 359 3.40.630.10
af_P9WHS9_166_276_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9064 176 283 3.40.630.10
3ct9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8686 12 360 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7W7H7E5-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9788 6 359 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A7X0NMJ1-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9766 7 359 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A4U3M977-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9739 8 359 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A1M5T9Y9-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9737 7 359 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-Q47SN4-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9704 7 359 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872

Map